Mycobacterium gilvum PYR GCK uid59421

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|145220658|ref|YP_001131336.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MNRVVAFGRTLMAACAATAVFAGCATGSDAVAQGGTFEFVAPGGQTDIFYDPPQERGTPGPLSGPDLMDTDRTISLDDFA
    GKVVVINVWGQW
    CGPCRTEITELQKVYDATRDRGVAFLGIDVRDNNIDAPRDFIIDRAITFPSIYDPPMRTMIAFGGRYP
    TTVIPSTVVLDREHRVAAVFLRELLAQDLQPVVERLAAEQ

    >gi|145220674|ref|YP_001131352.1| glutaredoxin 2 [Mycobacterium gilvum PYR-GCK]
    MDRQVELLTREGCPMCAAAAAQLDALAGELGFTVVVTDVDAAAAAGDAALRAEYGDRLPVVLLDGVEHSYWEVDEARLRA
    DLSG

    >gi|145220719|ref|YP_001131397.1| dihydrolipoamide dehydrogenase [Mycobacterium gilvum PYR-GCK]
    MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELAHVFHKDAKTFGISGDVSFDYG
    AAFDRSRKVADGRVAGVHFLMKKNKITEVHGYGRFTGPNSIEVEPTGDGEEGPVKLEFDNAIIATGSSTRLVPGTSLSEN
    VVTYEKQILTRELPGSIIIAGAGAIGMEFAYVLKNYGVDVTIVEFLPRALPNEDAEVSKEIEKQYKKLGVKILTGTKVEK
    IEDDGKQVTVTVSKNDKTEELKADKVMQAIGFAPNVEGFGLDKAGVELTDRKAIGIDDYMRTNVPHIYAIGDVTAKLQLA
    HVAEAMGVVAAETIAGADTLPFEDYRMMPRATFCQPQVASFGLTEQQAKDEGYDVVVAKFPFTANGKAHGLGDPTGFVKL
    IADKKHLELLGGHLIGPDVAELLPELTLAQKWDLTANELARNVHTHPTLSEAMQECFHGLVGHMINF

    >gi|145220869|ref|YP_001131547.1| mycothione/glutathione reductase [Mycobacterium gilvum PYR-GCK]
    MRTHDLVVIGAGSGNMVVDDRFSDLDVAIIDDRKFGGTCVNYGCIPSKMLSYTAQVADTVAAAGDFDIHIDIDADTDTDA
    DFGRLRWAQLRDRVFGRTDAIAADGEQGRRDSDFITVYNGHARFTQPGRLQVAVDGDTVEIAADRIVIAAGSRPVIPDVV
    AGSGLPYETSDTVMRVDAPPAHLAVLGGGYIAAELAHVFAAAGSRITVIERSDRLLGGPQDDAVRTTYTELMRSRYNLRC
    GSQVTEISGAPGALRIRLDDGSIVDADMLLVAAGRRSNSDRLDVAKGDIDTHEDGRVVVDEYCRTTSDGVFALGDVSSEI
    PLKHVANREAAVVKHNLLHAANLRAVSHELVPSAVFTHPQIASIGRTEKDCRDENLDYRTGVAEFSDVAYGWAMQDESGL
    CKVLAAPDGRILGAHVIGPQAATLVQIFVVALNFGITAAELARRPYWIHPALTEVVENALLALDKDGS

    >gi|145221103|ref|YP_001131781.1| thioredoxin [Mycobacterium gilvum PYR-GCK]
    MTTTNVKCPHCGTVNRLPAAANGTPRCPKCKNPLPWIAVAGDGDFAEVVERSKVPVLVDLWATWCGPCRMVSPALEQLAA
    ERAGQLKLVKVDVDSARQTAARFSVQAVPTLLVIAGGAVLARRAGAAPVATLRTWLDQTLASPR

    >gi|145221432|ref|YP_001132110.1| thioredoxin [Mycobacterium gilvum PYR-GCK]
    MSDSSTVTVTDDSFSDDVLSSGTPVLVDFWATWCGPCKMVAPVLEEIASEKAGSLTVAKLDVDENPATARDFQVVSIPTM
    ILFKDGQPVKRIVGAKGKAALLREIADVV

    >gi|145221433|ref|YP_001132111.1| thioredoxin reductase [Mycobacterium gilvum PYR-GCK]
    MTSSDTVHDVIIIGSGPAGYTAAVYAARAQLTPLVFEGSQFGGALMTTTEVENYPGFRNGITGPELMDEMREQALRFGAD
    LRMEDVDAVDLTGPVKTVTVGDETHSARAVILAMGAAARHLGVPGEDEMLGMGVST
    CATCDGFFFRDQDIVVVGGGDSAM
    EEATFLTRFARSVTLIHRRDEFRASKIMLERAQQNEKITFLTNTQVLSIEGDPKVTGIRLRNSETGEESRLEVTGVFVAI
    GHDPRSELVRGQVDVDDEGYVSVQGRTTYTSVEGVFAAGDLVDHTYRQAITAAGSGCAAAIDAERWLAEHAEPGERTSTT
    TDDTATDDTDLIGAQQ

    >gi|145221502|ref|YP_001132180.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
    MNMKGLVAILTNTRVLLTAFVIVAATIGTAVFLSVRDTGSEPAIKGSEPPIELDGSAGQAVRENSHRLNAVLDSPVYFVE
    FLDFE
    CEGCRAVYPEIEQLRAEYGDRVNFVLRYFPLPGHFNAERAARAVEAAAQQGQLEAMYRKMYDTQAEWGEQQVPAD
    DVFRGFAQQLGLDMSAFDATYNDPATLERIQLDIADGTALGVQGTPTFFLNGERIQPRSYEDLSTALDQALARG

    >gi|145221504|ref|YP_001132182.1| heavy metal transport/detoxification protein [Mycobacterium gilvum PYR-GCK]
    MSTITYAVTGMTCGHCELSVREEVSGVAGVEDVEVSATTGTLIVTSSGLVDDAQILHAVDEAGYSAVRVA

    >gi|145221506|ref|YP_001132184.1| heavy metal translocating P-type ATPase [Mycobacterium gilvum PYR-GCK]
    MALMTTSTSTPVSGANVELRIGGMTCASCANRIERKLNKLDGVAATVNYATEKATVTVPDGYDPALLIAEVEKTGYTATL
    PTPRAPAPSDASGDTPNADGIDDPELASLRHRLRASTVLTVPVIAMAMIPALQFTYWQWASLTLAAPVIVWAAWPFHRAA
    WANLRHGTATMDTLISLGTVSAFLWSLYALFFGTAGTPGMKHPFELTLAPSHGAANIYLEVAAGVTTFILAGRYFEKRSK
    RQAGAALRALLNLGAKDVSVLRDGVETKIAIEELMVGDEFVVRPGEKIATDGVVTSGSSAVDASMLTGESVPVEVAAGDT
    VVGATVNAGGRLVVRASRVGSDTQLAQMAELVERAQTGKAEVQRLADRISGVFVPIVIAIAVITLGAWLGAGFSVTAAFT
    AAVAVLVIACPCALGLATPTALLVGTGRGAQMGVLIKGPEVLESTRKVDTVVLDKTGTVTTGKMALVDVIAAPGTERAEL
    LRLAGALENASEHPIAHAIATAAAEEVGTLPTPEGFANVEGKGVQGVVDGHAVVVGRESLLADWAQHLSPDLSRAKAGAE
    AQGKTVVAVGWDGQARGVLVVADTVKPTSAQAISQMRDLGLTPVLLTGDNEAVARQIAAEVGIDTVIAEVMPKDKVDVIA
    RLQSEGKTVAMVGDGVNDAPALAQADLGLAMGTGTDVAIEASDITLVRGDLRSAVDAIRLSRRTLSTIKTNLFWAFAYNV
    AAIPVAALGMLNPMLAGAAMAFSSVFVVGNSLRLRGFTSTSSAPTH

    >gi|145221573|ref|YP_001132251.1| beta-lactamase domain-containing protein [Mycobacterium gilvum PYR-GCK]
    MSSAIDVSIIETSGLGDRSYLISADGTAVVVDPQRDIDRVLDLARERGVRISHVLETHIHNDYVTGGLELSRVTGAEYVV
    PAGDDVGYERRAVSDGDTVDAGPVRLQVMHTPGHTHHHVSYVLRDAGGSGDSVLGVFTGGSMLHGTTGRTDLLGDEHTQE
    LSHAQFHSVRRLAAELPDTAEVYPTHGFGSFCSATPASGDSSTIADQRQTNPALTQDEQSYVDELIAGLGAYPAYYAHMG
    VINTEGPDPVDLSVPEPVDPDELRRRIEGGEWVVDLRNRTAFAAGHLGGTLGFELSDNFVTYLGWLYSWGSPLTLIGDDV
    DQIADARRELARIGVDNLTGSATGDIHDLAEGTPLRSYRVADFAALADAMQAQAPAVLDVRQSGEFADGHIAGAVNIPLH
    ELSRRLDEVPDGEVWVH
    CASGYRSSIAASMIDRGDRTVVLVDDAFDQAEKTGLVS

    >gi|145221577|ref|YP_001132255.1| rhodanese domain-containing protein [Mycobacterium gilvum PYR-GCK]
    MTAPVTIDSHDLSQMLGSPTPPRVLDVRTPGEFETAHIAGAYNVPLDLLREHRDEIVKHLDEDVVLVCRSGQRAAQAEET
    LRNAGLSNVHILDGGITAWEAKGFAVNRGAQRWDLERQVRLVAGSIVLSSILGSIAAPKLKWVAGAVGGGLTFAALSNTC
    AMGMLLSKLPYNRGASCDAEGIVAQLVEGSAS

    >gi|145221578|ref|YP_001132256.1| beta-lactamase domain-containing protein [Mycobacterium gilvum PYR-GCK]
    MKFIQYYLDCLSHASYLIADETTGRAVVVDPQRDVAEYLSDAEEFGYTIELVIETHFHADFLSGHLELAEATGAKIVYSS
    VAETEFESMGVADGERYSLGDVTLEFRHTPGHTPESMSIVVYEHADDQVPYGVLTGDALFIGDVGRPDLLASIGFTREEL
    AEKLYDSLHNKLMTLPDATRVYPAHGAGSACGKNLSTDLWSTMGEQKETNYALRAPDKATFMALVTEGQPPAPSYFVYDA
    ILNRKDRELLDQTKMPAAMTYEQVRDAMAAGAILVDGRGPEEFATGHLRGAVNIGLAGRYAEFAGSVVPTDVDIVLFTEP
    GQELEGKNRLARIGFDRVVGYLDRPFEVMFTHPGDVQMASRLTAKAFDQRAAEVADLQIVDVRNPGEVAAGTIPNAITIP
    VGQLPARLGELDPAKPTVVY
    CAGGYRSSVAASLLRGNGFTDVSDILGGFGAWEETHQNA

    >gi|145221580|ref|YP_001132258.1| thioredoxin [Mycobacterium gilvum PYR-GCK]
    MATKNLTYDDFESTITGNSIVLVDFWASWCGPCRAFGPVYERSSEAHPEVVHAKVDTQHERDLAATLEITSIPTVMAFRD
    GVLVYRQAGAMPPAALEDLIGRVKTLDMAEVRAKINARRAAAQA

    >gi|145221652|ref|YP_001132330.1| hypothetical protein Mflv_1059 [Mycobacterium gilvum PYR-GCK]
    MSIALGSRFAGELSELTVPWKAEEAPQPRLLVLNEPLATELGLDPDWLRGPDGLGLLTGTRVPAEASPVAQAYAGHQFGG
    FQPRLGDGRALLLGEIEGPDGHLHDLHLKGSGRTPFARGGDGLAAVGPMLREYVISEAMHALGIPTTRALAVVATGKTVY
    RESPLPGAVLARVASSHLRVGTFQFAPLLMRASGNTDLLRRLADHAIARHHPAAADAEQPYLALLEAVSAAQARLVAQWM
    SVGFIHGVMNTDNMTISGETIDYGPCAFMEAFDPATVFSSIDSWGRYAYGNQPSIALWNLARFAEALLPLLADDAEAGIA
    VAEASLGEFQGLYEAAWTDAMARKLGVAGASADTVEALVGDLLTQLQQSGLDWTLFFRRLAGAARGDAEPVRGEFIDLAT
    FDGWLQRWRDLGPDADAMDRVNPVYIPRNHLVEEALTAATGGDLGPVEKLLDAIRSPFDVRAGLDRYAEPGPREFSASFQ
    TF
    CGT

    >gi|145221697|ref|YP_001132375.1| methionine sulfoxide reductase A [Mycobacterium gilvum PYR-GCK]
    MSDHKRAVLAGGCFWGMQDLIRKQPGVVSTRVGYTGGQNDHPTYRNHPGHAEAIEIVYDPAQTDYRALLEFFFQIHDPTT
    KNRQGNDIGTSYRSEIFYVDEEQRQIALDTIADVDASGLWPGKVVTEVSPAPDFWEAEPEHQDYLERYPTGYTCHFPRPG
    WKLPKRAEV

    >gi|145221698|ref|YP_001132376.1| methionine-R-sulfoxide reductase [Mycobacterium gilvum PYR-GCK]
    MTLPYNKNPAAVNALSPEQYHVTQQNGTERPFTGEYWDNHEPGIYVDVVSGEPLFASVDKFESGSGWPSFTRPIDSGNVV
    EKRDFSHLMIRTEVRSAHGDSHLGHVFKDGPREAGGLRY
    CINSAALRFVHLDDLEEQGYGQYRGLFVAETATEEEQA

    >gi|145221730|ref|YP_001132408.1| rhodanese domain-containing protein [Mycobacterium gilvum PYR-GCK]
    MDDPDVPQAAISDVPSTFGDGVVLLDVREDDEWQRGHAPQARHIPMGDVPARLAELDADAELYVVCHVGGRSQRVAQYLA
    RNGFRPVNVTGGMLAWAGAGRPVVTDAGNVGTV

    >gi|145221774|ref|YP_001132452.1| alkylhydroperoxidase [Mycobacterium gilvum PYR-GCK]
    MGHCGPTVDDMTQTLATRSRLKIYKASPELYDAMMVLSTAAAKDVDPALGELIKIRASQMNRCAFCLDMHTRDARKIGVS
    EQKLDLLSAWAEAAGVFDDAERAALALTEAITELGHAGVSDDVYEDAAAVFSDRELGQVIAMAVTINAWNRINAAVRTPP
    PRR

    >gi|145221966|ref|YP_001132644.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MALVILVALGVAFWSELDAQDPASPAGNDARDTVSARDKRDADTPEALAGLRAAAGLEPCPAPGEGQGPAPLRGIVLECV
    GDGAPTDIAAAVAGRPVVLNLWAYW
    CGPCADELPAMAEYQRRVGPEVLVLTVHQDENESAALIRLAELGVHLPTVQDGRR
    SIAAALQVPNVMPATVVLRADGSVAEILPRSFATADDIAAAVDPKIGVA

    >gi|145222044|ref|YP_001132722.1| 3-mercaptopyruvate sulfurtransferase [Mycobacterium gilvum PYR-GCK]
    MSRADVFVTATDLSRMIAEDRPVSVLDVRWRLDAPDGRQAYAQGHVPGAVYVSLDDELSDHSVPDRGRHPLPSGVALQAA
    ARRWGLREGVPTVVYDDWNRAGSARAWWVLRAAGIEDVRILDGGLAAWAAAGGDLEAGEVSRPPGDVVVRCADLYRGALP
    TLTVDEVAEFDGLLLDARAPERFRGDTEPVDPVAGHIPGATNAPSTGVLDGDGVLLPTEELVAFAERVGADGDSAVGVY
    C
    GSGVTAAVTVAALMATGVPARLFPGSWSQWSADPSRPVATGH

    >gi|145222211|ref|YP_001132889.1| glutathione peroxidase [Mycobacterium gilvum PYR-GCK]
    MTSALTAIPLTTLDGRSTTLAELADGAALVVNVASKCGLTPQYTALEQLAKDYGPRGLTVIGVPCNQFMGQEPGSAEEIQ
    EFCSTTYGVTFPLLAKTDVNGADRHALYAELTKTADDAGEAGDVQWNFEKFLLAPGGEVVKRFRPRTTPDDPAVIAAIDD
    VLGT

    >gi|145222238|ref|YP_001132916.1| thiosulfate sulfurtransferase [Mycobacterium gilvum PYR-GCK]
    MARSDVLVSTDWAESNLDAPNTVFVEVDEDTSAYDTGHIPGAIKLDWKTDLQDQVKRDFVDAAQFSKLLSERGIANDDTV
    ILYGGNNNWFAAYAYWYFKLYGHQNVKLLDGGRKKWELDARPLSKDAVERPQTSYTAKEPDTSIRAFRDEVIAAIGTKNL
    VDVRSPDEFSGKILAPAHLPQEQSQRAGHIPSAINVPWSKAANEDGTFKSDEDLAKLYADAGLDGEKETIAY
    CRIGERSS
    HTWFVLQELLGHKNVKNYDGSWTEYGSLVGAPIELGN

    >gi|145222240|ref|YP_001132918.1| thioredoxin domain-containing protein [Mycobacterium gilvum PYR-GCK]
    MSSSWIAVLAVLIGAVGVAFMVSRMISSRSEMTPTDDEARAVDTAGLGLSTTGPTVLHFSASWCGPCAGVRRVVDRVCED
    LPAVEHVEIDMDANPEAARRLSVLSLPTTIIFDADGRPRYRTSRVPTAADLRSALEPLLA

    >gi|145222532|ref|YP_001133210.1| arsenate reductase [Mycobacterium gilvum PYR-GCK]
    MARILHNPKCSTSRKTLDLLRDNGIEPEIVLYLKTPPTRAELETMIRDAGIDVRSAVRKRESLYTELGLDSADDDALLDA
    MAEHPILIERPFVITDKGTRLARPLDNVREIL

    >gi|145222640|ref|YP_001133318.1| hypothetical protein Mflv_2052 [Mycobacterium gilvum PYR-GCK]
    MSPPADGPGNLLADATSPYLRQHADNPVHWRQWGADALAEAAARDVPILLSIGYAACHWCHVMAHESFSDDEVAAAANRD
    FVCIKVDREERPDLDAVYMSVTVALTGQGGWPMTCFLTPDGRPFFCGTYYPKVSFLQLLAAVSETWRTRRDEVEQTSDHI
    AAELRSMATGLPRGSRTVDSAGCDDAVAAVLRDEDVARGGFSNSPSGAPKFPPSALLEALLRHHERTASPEALATVERTC
    TAMARGGIYDQLAGGFARYSVDSSWVVPHFEKMLYDNAQLLRVYAHWARRTADPSARRIADETARFLLDDLRRDALFVSS
    LDADTEGVEGLTYVWTPDQLRRVLGEDDGRWAAEVFEVTSDGTFEDGQSVLQLLRDPDDPERFERVRIALRAERRARPQP
    ARDDKVIAAWNGLAITALAEAAFALGRPEYFSAAVDCAQALLDLHIVDGRLRRSSLGGVVGDGAAILEDHAALATALLTL
    HQGTGERRWLDAATRLLNLALDHFADPDEPGRWYDVADDAERLVVRPSDPMDGATPSGASLVAEALQVAAHLADDGADRY
    AAAADAALSSAAVLLERAPRSAGHWLAVAEAAVRGPIQIAVACEGPDSALLAAARALAPGGAVVIGGVTDSSALLRDRPR
    VRGADAAYVCRGRACDLPVTTAGELAAALGCSV

    >gi|145222832|ref|YP_001133510.1| heavy metal translocating P-type ATPase [Mycobacterium gilvum PYR-GCK]
    MNTLELSIGGMTCASCAARVEKKLNKLDGVTATVNYATEKARVEFGDNVSTDQLVSAVESAGYQAALPEPPNPPDVEPAD
    PTAALRRRLIICVALSVPVIAMAMAPPLQFTYWQWLSLTLAAPVVVWGAWPFHRATWANLRHGTATMDTLISVGTLAAFG
    WSIYALFWGTAGVPGMTHPFELTIARTDGSGNIYLEAAAGVTTFILAGRYFEARAKRRAGAALRALLELGVRDVTVRRGA
    AEHRIPIDQLRVDDEFVVRPGEKVAADGIIVEGASAVDASMLTGESVPLEVKPGDRVVGATVNVDGRLVVRAERVGADTQ
    LAQMARLVEDAQNGKAQAQRLADRISGVFVPVVLGLAVATLGFWIGSGYPVAAAFTAAVAVLIIACPCALGLATPMALMV
    GTGRGAQLGILIKGPEVLESTRRVDTVIVDKTGTVTTGDMTLVDVFAADGEQPDEVLRMAGAVESPSEHPIAAAIAGGAR
    DKLGDLPAVDGFANLRGLGVEGDVEGRRLTLGRLRLLSDRSFEIPDDLASAVARAEAGGSTAVTVGWDGRARGVLMVADA
    VKPTSAEAISLLKRAGLTPIMVTGDNEAVARTVAAQVGIDEVVAGVLPQDKVDTVTRLQRDGRVVAMVGDGVNDAAALAQ
    ADLGMAMGSGTDVAIEASDLTLVSNDLRAVPDAIRLSRKTLSTIKSNLFWAFAYNVAALPLAAAGLLNPMIAGAAMAFSS
    VFVVTNSLRLRAFTPSR

    >gi|145222913|ref|YP_001133591.1| methylated-DNA--protein-cysteine methyltransferase [Mycobacterium gilvum PYR-GCK]
    MQYRVMDSPVGPLTLAGSHGRLQHLRMVDQTYEPDRADWMRDDTAFDAVIAQLQEYFAGERKDFALDLELVGTPFQRRVW
    EALLTIPYGETRSYGEVARQIGAPGAFRAVGLANGRNPIGIIIP
    CHRVIGTNGSLTGYGGGLAQIFRGLLLVTACR

    >gi|145223122|ref|YP_001133800.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MPQTPRLEVGDKAPTFSLPDADGNTVSLSDYKGRKVIVYFYPAASTPGCTKQACDFRDSLAELNDAGLDIIGISPDKPEK
    LAKFRDAEKLTFPLLSDPEKKVLEAWGAFGEKTMYGKTVQGVIRSTFVVDENGKIEVAQYNVRATGHVAKLRRDLSV

    >gi|145223165|ref|YP_001133843.1| DsbA oxidoreductase [Mycobacterium gilvum PYR-GCK]
    MSEKSRADFWFDPLCPWAWITSRWVLEAEKVRDIEVNFHVMSLAVLNEGRDLPEEYLEMMKTAWGPVRVAIAAEQAKGPE
    VLGPLYTAFGTRIHNLGYRETDPDFTRVIAESLDEVGLPAELAAAATSTDYDEALRKSHHEGMDPVGPDVGTPTIHVNGV
    AFFGPVLSRIPRGEEAGKLWDASVIFASYPHFWELKRTRTESPEFD

    >gi|145223371|ref|YP_001134049.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MLSVGSPAPDFTLKDQNNQVVSLAAFRGDRDVVLVFFPLAFTGICQRELDEIRHHIGDFVNDETATLTISVGPSPVHKVW
    ATQRGYSFPVLSDFWPHGAVSQAYGVFNDATGFSNRGTFVVDRSGLVRFAECKEPGEARDQAAWTRALAALRG

    >gi|145223399|ref|YP_001134077.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MTRRLTDAPRMSPSRLDVGVERRRRMRPPIHWSLVVRRGIVAGLSAVLLGAAVSGCSSGDDAVAQGGTFEFVSPGGQVDI
    FYDPPQSRGRPGLIRGPDLMYPNRTLSLDDFAEQVVVINVWGQW
    CGPCRTEMPELQRVYDATRDEGVAFLGIDVRDNNRQ
    AAVDFIVDRKVTFPSIYDPPMRTMIALGARYPTTVIPSTIVLDRSHRVAAVFLRALLAEDLEPVVRRLAAETTTGSGPPR


    >gi|145223415|ref|YP_001134093.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
    MAPLTRILLTVFAVITMIIGVGVYLSAQDKDAPTSAQGQGEDVGQLVRDNSRRLTTVPNSDVTFVEFLDFECEACRAAFP
    MVEQLRAEYGDRVNFVIRYFPIQSHFNAERAARAVEAAAQQDKFEPMYKKMYETQSEWGEQQTPADSRFRGFAAELGLDM
    AAFDAAYNDPATLDRVNVDVADGKALGVKGTPTFFIDGTEVEFRSYDDLKAAVEQALNG

    >gi|145223434|ref|YP_001134112.1| heavy metal transport/detoxification protein [Mycobacterium gilvum PYR-GCK]
    MPRPASTRHQQEPEEPTLAPYPRGVYLDVRIPGRGTTESEDGSSVMSTITYAVTGMTCGHCELSVREEVSGVAGVQDVEV
    SATAGTLIVTSSGPVDDAQILRAVDEAGYSAVRVV

    >gi|145223436|ref|YP_001134114.1| heavy metal translocating P-type ATPase [Mycobacterium gilvum PYR-GCK]
    MTTSIPVSGPSIELRIGGMTCASCANRIERKLNKIDGVAATVNYATEKATVTVPDGYDPALLIAEVQNAGYSAALPTPEK
    PALTGETGETEDPDLVSLRHRLTGSVLLSVPVIAMAMIPVLQFTYWQWASLVLAAPVIVWAAWPFHRAAWANLRHATATM
    DTLISLGTLSAFLWSLYALFFGTAGTPGMKHPFELTLAPSHGAANIYLEVAAGVTTFILAGRYFEKRSKRQAGAALRALL
    EMGAKEVSVLRDGVESKIAVEDLVVGDEFVVRPGEKIATDGVVASGTSAVDASMLTGESVPVEVGPGDTVVGATVNAGGR
    LVVRAARVGSDTQLAQMAQLVENAQTGKAQVQRLADRISGVFVPIVLAIAVITLGAWLGAGFPVAAAFTAAVAVLVIACP
    CALGLATPTALLVGTGRGAQMGVLIKGPEVLESTRKVDTVVLDKTGTVTTGKMTLVDVVTAPGTDRGNLLRLAGALENAS
    EHPIAQAVATAATEELGTLPTPEDFANVEGKGVQGIVDGHAVVVGRESLLADWSQHLSPELARAKASAEAQGKTAVAVGW
    DGEARGVLVVADTVKPTSAQAISQMREIGLTPVLLTGDNEAVARQIAAEVGIDTVIAEVMPKDKVDVIVRLQAEGKTVAM
    VGDGVNDAPALAQADLGLAMGTGTDVAIEASDITLVRGDLRSAVDAIRLSRRTLSTIKTNLFWAFVYNVAAIPVAALGML
    NPMLAGAAMAFSSVFVVGNSLRLRGFTSTSTSSAPTH

    >gi|145223451|ref|YP_001134129.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MRSRLRWTVFALVVIAAMAVAIWPRTPQVDGTNTSGPGLTLPAAAVGDADTGELARLTARAALAPCPTPREGAPPKGDLA
    GALASCLGARTMFDVGAALAGEQTLINLWASW
    CAPCREEIPVLDAYAGQPGAVRVVGMNVQDTDTVALSLLADLGVHYPS
    FGNADAVGQVLGAPPVLPLSYLVGTDGTVRRVTTPTVFRDVEQVRAAVAAMNP

    >gi|145223456|ref|YP_001134134.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MRSVRQIVAVAAALVIAAAQVTGCTTGDDAVSQGGTFDFASPGGKTAIFYDPPSSRGTIGDLSGPDLFTDDPIRLSDYTG
    KVVLINVWGSW
    CAPCRTETPELETVYAEYRDRGVQFLGIDVRDNRDTARDFVTDRNVEYPSIFDPAMRSLITLGRTYPTS
    VVPTTMVLDRQHRVAAVYLMALLAEDLRPLLRSADHRALS

    >gi|145223481|ref|YP_001134159.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Mycobacterium gilvum PYR-GCK]
    MEDIWDCVIVGGGAAGLSAALVLGRARRRTLLVDAGAQSNLAAHGIGGLLGFDGVPPAQLYAQGRRELTRYPDVAVCDGD
    VTGAVAVEGGFTVELAGRSDVRTRRILLAMGMRYDMPALPGLAELWGDSVFH
    CPFCHGWEARDRPLAVLADGDRGVHMAT
    LLSGWSDDVVLLTSGPADLTDAQRDRLAEAGIAIDERAVAELVSADGQLAQVVFADGSGIARSGLLIATTLHQRSSLAAE
    LGVAFAAPSPVTAEAVDVDAMYRTTVPGVFAAGDVSARMPQVAAAIAAGSGAAASVVASFLEEEK

    >gi|145223532|ref|YP_001134210.1| iron-sulfur cluster assembly accessory protein [Mycobacterium gilvum PYR-GCK]
    MTVQDESAVQAGQTTEAAHGVTLSDAAAAKAKALLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDLTVDFSGVV
    LTVDRMSAPYVQGATIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|145223646|ref|YP_001134324.1| mercuric reductase [Mycobacterium gilvum PYR-GCK]
    MSETATQKFDAIIIGAGQAGPPLAARLTAAGQTVAVIERKLVGGTCVNYGCIPTKTLVASAHAAHLARRGADFGIGTSEV
    TVDMAAVKARKDRISGGDREGLESWLDGMDGATLIRGHARFESPNTVRVDGTLLGAERIFLNVGGRAVVPDIPGLADVDY
    LTNVGILDLGVVPEHLVIIGGSYIALEFAQMYRRFGAEVTVVEKGPRLTAREDEDVSAVIKDILEAEGIRVELGADAISV
    AKRRNGIAVTPRDGAAPIDASHLLVAVGRVPNTDDLGLEAAGVETDKRGYVVVDDQLRTSAENIWAMGDCNGRGAFTHTS
    YNDFEIVAANLLDDDPRRVSDRITTYALYIDPPLGRAGMTADEVRRTGRKALVGKRPMTRVGRAVEKGETQGFMKVVVDA
    ETEEILGASILGVGGDEVVHLILDVMTAKLPYTAISRTMHIHPTVSELVPTLLQDLHPLT

    >gi|145223800|ref|YP_001134478.1| mercuric reductase [Mycobacterium gilvum PYR-GCK]
    MSQGLDLAVIGSGGAAMAAAIRATALGKSVVMIERGIFGGTCVNTGCVPSKALIAAAEARHTAADTARFPGIATTAGPVD
    MAALIAGTHDLVESLRSEKYLNVAESYGWQRIQGQARFAGTPDAPVIEVGDATIEAEHYLIATGANPVIPPAFEGVAYLT
    STTAMEVTEVPESLLVIGGGYVALEQAQLFARLGSTVTVLVRSTLASKEEPEVGMALLEVFADDGIRVVRRATVSEVEQA
    DDQVTVTATITGGTQQFRAAKVLVATGRRPNTDGLNLEAVQVKTGENNEVVVSDGLQSSNPRIWAAGDVTGHREFVYVAA
    HHGAMVADNIFTDAGRRVDYRHLPRVTFTSPAVGAAGTTEAELLAAGTRCDCRVLPLKHVPRAVVNRDTRGFIKLVADAG
    TGRIHGITAVAKDAGEIAAAAVYILDAAMTVDQVAGSWAPYLTMAEGIKIAAQSFSADMSRLSCCAS

    >gi|145223841|ref|YP_001134519.1| thiol peroxidase [Mycobacterium gilvum PYR-GCK]
    MAQITLRGNPINTVGELPSVGSAAPGFTLTGTDLGTVSDEQFRGKPLLLNIFPSVDTPVCSASVRKFNEAAASSGVTVLN
    VSNDLPFAQKRFCGAEGIENVTSASGFRDSFGDDFGIKIVDGPMAGLLGRAVVVVDGDGKVTYTELVPEIGQEPDYDAAL
    SALKA

    >gi|145224187|ref|YP_001134865.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MEIVNRGDRVTEFELPDQTGTTRTLTGLLADGPVVLFFYPAAMTPGCTKEACHFRDLAAEFAAVGATRVGISADPVDKQA
    QFADKQNFDYPLLSDTEGTVAAQFGVKRGLLGKFMPVKRTTFVIDTDRTVLEVIASEFSMDTHADKALEVLRAR

    >gi|145224254|ref|YP_001134932.1| thioredoxin [Mycobacterium gilvum PYR-GCK]
    MATKDITAEEFEKTIKDNDIVLVDFWASWCGPCKAFAPTFAASSEKHPDIVYAKVDTEAEQQLAAAADIRAIPTLMAFKK
    GTPVLNRAGALPPAALEDLIQQIRDLDVDAAIAAQEDGQS

    >gi|145224490|ref|YP_001135168.1| methylated-DNA--protein-cysteine methyltransferase [Mycobacterium gilvum PYR-GCK]
    MIDIAFDVPGFDIPTSDEDDTLRRLHDRLAEAAEPAGVLDVAYRTIDSPVGTLLLAATPAGLVRVAFDVEGHEVVLARLA
    ESVSPRILRAPDRLDDVARQLDEYFAKRRTTFDVAVDLTLARGFRRNVVEHLRHIGYGRRASYADVAAAVGSPRAVRAVG
    SACAHNPLPVVIP
    CHRVVRSDGTSGQYIGGPEAKTALLQLESSSG

    >gi|145224497|ref|YP_001135175.1| methionine-R-sulfoxide reductase [Mycobacterium gilvum PYR-GCK]
    MTAPKLVLSDDQWRERLTPQEFAVLRQAGTERPFTGEYTDTKTQGVYQCRACGAELFRSTEKFESHCGWPSFFDPADSDA
    VILRTDDSLGMRRVEVLCANCHSHLGHVFEGEGYPTPTDQRY
    CINSISLRLVPSGS

    >gi|145224634|ref|YP_001135312.1| mycothione/glutathione reductase [Mycobacterium gilvum PYR-GCK]
    MADFDLAIIGTGSGNSILDERYVDKRVAICEQGVFGGTCLNVGCIPTKMFVYAAGVAEQIRESARFGVDGRLDGVRWPDI
    VSRVFGRIDPLAGGGEQYRRSSPNVEVFASHTRFAGPDSGDGYRLHTDDGDEFTAEQVVIAAGARATVPQAILECGVPYH
    TSDTIMRISDLPEHLVIVGGGFVAAEFAHVFSALGSRVTIVLRGTTMLSHCDDTVCERFTDIAGKKWEIRSRRNIVSGES
    DGSGVSLRLDDGATLRADVLLVATGRVPNGDRLDAHLAGVEVTDGLVTVDEFQRTTARNVFALGDVSSPYQLKHVANHEA
    RVVKHNLLQDWDDTEALMPANHDNVPSAVFTEPQIACVGLTENEARAAGYRIRSKVQDYGDVAYGWAMEDSTGFAKLIVD
    DETGLLLGAHIMGHQASSIIQPLIQAMAFGLPAQDMARGQYWIHPALPEVVENALLSLCGEPPWPRPRRH

    >gi|145224781|ref|YP_001135459.1| hypothetical protein Mflv_4202 [Mycobacterium gilvum PYR-GCK]
    MASKPKKNARYDLKAADRKRNLLIQIGLTAVVVIFAVALVLYIVGSADDKPTAGESRGIRVESTSVIKKEGTDEPKAVVS
    MYEDFL
    CPHCGAFEQQFGPTINKLVDAGAIAADYYMVGILDRPQNQNYPARAGGAAYCVADESIDAFKRFHAALYAQQPG
    ETGSTYPDNARLIEIARQSGATGGVPECINKGTYVDMVGGLARATEIKSTPTVRINGEEYQYSTPDALVAKIKEIVGDVP
    GLEAAPPAPAPQPAPAS

    >gi|145224886|ref|YP_001135564.1| glutaredoxin-like protein NrdH [Mycobacterium gilvum PYR-GCK]
    MPAHPAFLIGAVPQMTQPAPVTVYTKPACVQCNATYKALDKQGIAYEVVDISVDTEARDYVMALGYLQAPVVVAGSDHWS
    GFRPDRIKALAGAVTATA

    >gi|145225085|ref|YP_001135763.1| cyclohexanone monooxygenase [Mycobacterium gilvum PYR-GCK]
    MPFLTGEHVRSPELTALTGLPFDDDDEVLRAAIDDASVPALLMSMVHMTGDPGILDRLPRPYMLIAMDLQGGMSEPDKQV
    VRDKAFEVAREYRDRGCPPPFVPDEHQLRVMLDVITGGQVGSELIEYIAADLRVTDADQNGPPLASTARQRADFPVLVIG
    CGEAGLLAGIKLKAAGLPFTIVEKQSGVGGTWLANRYPGCRVDIASQYYTYSFEPTDHWEHHYATQPEILRYLRDVMDRH
    GIADHVRFDTEVVGARWDELSATWRVRVRTGGGAVEELTARALICAVGQFSNPVIPDIDGADTFEGPT
    CHTADWDDTLDL
    TGRRVAVIGAGASGFQLVPAIAGTAAHVDVYQRTPQWMAPNVHYHEAVSDGARWATRHLPYYGRWLRFVSWWPIADALDE
    QITIDPDWDTGGLSVSAGNQMIRDMFIAWMQAFTDDEDLLAKVTPKYPPMGKRTLQDDGTWLRTLQRDDVELINDVIAAI
    TADGVTDVHGVHRRADVLVWATGFDVNHQLGPIDIRGRDGLSLNEVWGDAAYAYLGMTVTGFPNFYCMFGPGTNAVNGAS
    LIYNSECQMRYILGCIDMIIASGAAAAEPRAEVCRDYDRRSQQRLQTMVYAHPAVTSSYYKNSTGELPTLFAWRIADYWK
    WTRYPDPADYQLETAAPQEVS

    >gi|145225239|ref|YP_001135917.1| glutaredoxin-like protein [Mycobacterium gilvum PYR-GCK]
    MSTDVPAVTMYTTSWCGYCVRLKKVLKNEGITFAEVNIEEDPAAAEFVGSVNGGNHVVPTLKFADGSTLTNPTGAQVKAK
    LAS

    >gi|145225248|ref|YP_001135926.1| molybdopterin biosynthesis-like protein MoeZ [Mycobacterium gilvum PYR-GCK]
    MSTPLPPLVEPAAELTKEEVARYSRHLIIPDLGLDGQKRLKNARVLVIGAGGLGSPTLLYLAAAGVGTIGIVEFDVVDES
    NLQRQIIHGQSDIGRPKAQSAKDSVLEVNPLVTVNLHEFRLEPDNAVELFEQYDLILDGTDNFATRYLVNDAAVLAGKPY
    VWGSIYRFEGQVSIFWEDAPNGLGLNYRDLYPEPPPPGMVPS
    CAEGGVLGILCASIASVMGTEAIKLITGIGDPLLGRLM
    VYDALDMSYRTIKIRKDPSTPKITELIDYEAFCGVVSDAAAEAAADSTITPRELRELLDSGKPLALIDVREPVEWDINRI
    EGAELIPKGGFESGEALSKLDNDRTPVFY
    CKTGIRSAEVLAIVKKAGFADAMHVQGGIVAWGKQLEPDMVMY

    >gi|145225358|ref|YP_001136036.1| rhodanese domain-containing protein [Mycobacterium gilvum PYR-GCK]
    MPLPADPSPALQSYAHPERLVTADWLSGNLGRPGLAIVESDEDVLLYDTGHIPGAVKIDWHTDLNDPNVRDYITGEQFAD
    LMNRKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHPDVRLLDGGRSLWISDGRDTTLDVPTKQTTGYPVVERNDAPIRA
    FKEDVLAVLGTEPLIDVRSPQEYTGERTHMPDYPEEGALRGGHIPTAVSIPWAKAALDNGKFRSRAELDELYGFLSEHDN
    PETVVY
    CRIGERSSHTWFVLTHLLGMPGVRNYDGSWTEWGNAVRVPVAVGSEPGDAPGEAPATAR

    >gi|145225400|ref|YP_001136078.1| flavoprotein disulfide reductase [Mycobacterium gilvum PYR-GCK]
    MVTRIVIIGGGPAGYEAALVAAGLGRELTQVTVVDSDGLGGACVLYDCVPSKTFIASTGVRTELRRAQGMGYDIGIDDAP
    ISLPKINNRVKTLAASQSADISSQLLNQRVTIIGGRGELVDDVAGMAHHRVKVTTHDGKVGVLKADVVLIATGASPRVLP
    NAVPDGERILTWRHVYDLEELPEHLIIVGSGVTGAEFCNAYTELGVTVTVVASRDQILPHEDSDAAAALEQVFNERGVTL
    IKNARAESVTRTDTGVRVTIADGRVVEGSHALMTVGSVPNTSGLGLERVGVELNPGGYIPVDRVSRTPAPGVYAAGDCTG
    LLPLASVAAMQGRIAMYHALGEGVAPIRLRTVASATFTRPEIAAVGIPQSAIDDGSVPARTLMLPLSTNARAKMSLLRHG
    FVKIFCRPATGVVIGGVVVAPIASELILPIALAVQNRISVTDLAQTLSVYPSLSGSIVEAARRLMAHDDLD

    >gi|145225429|ref|YP_001136107.1| hypothetical protein Mflv_4851 [Mycobacterium gilvum PYR-GCK]
    MTTTTRIEPVSPQRASLMTRLLWRYAKRRFGEVPEPFTIYAHHPGVMLAGAMHEGMLERASTALPANVRELAVYWVARQI
    GCSW
    CVDFGAMLMRLDGLDLARLTHIDDYATSTSFTDDERAAIDYAAAMTTDPHTVSDEQVADLRRRFGDKGLMELTYQV
    GVENMRARMNAALGITEQGFSSGDACRVPWTQ

    >gi|145225741|ref|YP_001136419.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Mycobacterium gilvum PYR-GCK]
    MPNRADSGNRPSVDYECAVVGAGAAGLSAALVLGRARRSTVVVDTADPSNRAAPVIGGLLGFDQRPPDELYETGRAQLRA
    YPSVEYRHGEVLAGRASDHGFELDIDDGRQIRAKRVLLATGMSYCPPQLPGLAELWGTAVFH
    CPFCHGWEMRDRKLAALA
    AGNAGLHAALMLRGWTDDVVLLTDGKTDLTPDDERVLTAAGVRIDDRRVVELHGDDGELESIAFADGDTLARDGLLVEAP
    VRQRSALAEQLGATCTPGPLGTEPLSVDEMARTSTGGVFAAGDVCTEQPHISGAIAAGSEAAMIIVQSLLADDFGLPYPP
    GS

    >gi|145225751|ref|YP_001136429.1| OsmC family protein [Mycobacterium gilvum PYR-GCK]
    MLGRPPGRATASRLRHPVTDPEQLFAVGYAACFHSALRVVARQQKADVSDSAVGAKVELGSLDDGGFGLAVELEVTLPNV
    DHETAQKLTEAAHQV
    CPYSNATRGNIEVTLTVTDD

    >gi|145225902|ref|YP_001136556.1| heavy metal translocating P-type ATPase [Mycobacterium gilvum PYR-GCK]
    MSLPNHVVGVDQPHSIELSIGGMTCASCAARIEKKLNKIDGVEASVNYATEKAKVDYPNSVDPAVLIAAVEATGYTATAP
    AAPNDAAPTDSGRDAGEADSLRSRLLISLVLTVPVIAMSMIPALQFTNWQWLALTLASPVVVWGALPFHRAAWANARHRA
    ATMDTLISLGVSAAYLWSLWALFIGHAGMPGMRMAFSLLPDAGSETEHIYLEVAAAVTVFILAGRYFEARAKTRSGAALR
    ALLDMGAKDVAVVRNGTEIRIPTAELSVGDVFVVRPGEKIATDGVVTDGASAVDASMLTGESVPVEVRPGDHVTGATVNA
    GGRLLVRATRIGADTQLAQMARLVEDAQNGKASVQRLADRVSAVFVPIVLALSVATLAVWLLTGHSATVAFTAAVAVLII
    ACPCALGLATPTALMVGTGRGAQLGILIKGPQVLESTRRVDTIVLDKTGTVTTGRMSLVGVYPGAGQNSDELLEFAGALE
    SASQHPIAEAIAASASAGGALPAVEDFSNHNGYGVSGVVAGHAVLVGRLSWLNDDWSLTAPDDLASAAEHAESQGHTPVW
    VAWDGAVRGVIVVADTVKGTSADAIGQFRKLGLRPFLLTGDNRRAALAVAAEVGIDADDVIAEVLPAGKVDTIKSLQAQG
    RTVAMVGDGVNDAAALVQADLGLAMGTGSDVAIEASDLTLVRGDLRAAADAIRLARSTLRTIKGNLFWAFAYNVAALPLA
    ALGLLNPLIAGAAMAFSSVFVVSNSLRLRRFTSSASPGQTEDVHVATVPPGGDEYRRAHTAP

    >gi|145225923|ref|YP_001136577.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
    MAPLTRILLTVFAVITMIIGVGVYLSAQDKDTPGSAQAQGGDVGQLVRENSRRLTNVPNSDVTFVEFLDFECEACRAAFP
    MVEQLRAEYGDRVNFVIRYFPIQSHFNAERAARAVEAAAQQDKFEPMYKKMYETQSEWGEQQTPADSRFRGFAAELGLDM
    AAFDAAYNDPATLDRVNVDVADGKALGVQGTPTFFLDGTEVEFRSYDDLKTAVEQALNG

    >gi|145225944|ref|YP_001136598.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MGIERWRRRRPPTRWSLVIRRGIAAGLSAVLFGAAVSGCSSGDDAVAQGGTFEFISPGGQVDIFYDPPQSRGRPGPIRGP
    DLMDPNRTLSLDDFAEQVVVINVWGQW
    CGPCRTEMPELQRVYDATRNEGVAFLGIDVRDNNRQAAVDFIVDRKVTFPSIY
    DPPMRTMIALGARYPTTVIPSTIVLDRSHRVAAVFLRALLAEDLEPVVRRLAAETATGSGPPR

    >gi|145225977|ref|YP_001136631.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium gilvum PYR-GCK]
    MTHRLTDAPRMSRSRLDMGVERWCRRRPPTRWSPLMRRGIAAGLSAVLLGAAVSGCSSGADAVAQGGTFEFVSPGGQVDI
    FYDPPLSRGRPGPISGPDLMDPDRTLSLDDFSEKVVVINVWGQW
    CGPCRTEMPELQRVYDATRNEGVAFLGIDVRDNNRE
    AAVDFIVDRKVTFSSIYDPPMRTMIALGARYPTTAIPSTIVLDRSHRVAAVFLRALLAEDLEPVVRRLAAETATGSGPPR


    >gi|145223389|ref|YP_001134067.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
    MNPMTRILLTFFVVITVAIGAGVYFSSRDGGTAGSGGTQADGEAQVVRENSHRLSSAPDSDVTFVEFLDFECEGCRAAFP
    AVEQLRAQYGQQVTFVARYFPMPGHFNGERAARAVEAAAQQGQFEPMYKKMFETQDQWGEKQVPADEVFRGYATELGLDV
    AAWDEAYNAPATLDRIQEDVADGTALGVQGTPTFFVNGKQLEIKTYADLGAAIKNALGE

    >gi|145223639|ref|YP_001134317.1| hypothetical protein Mflv_3052 [Mycobacterium gilvum PYR-GCK]
    MTPSDFGGPKRSDLPDLRDTIIVAAFEGWNDAGDAASDALEHLDAIWEAETIVEIDDEAYYDYQVNRPVIRQVDGVTREL
    VWPSMRISHCRPPGADRDIVLMHGVEPNMRWRTF
    CAELLNIADKLNVQTVVILGALLADTPHTRPVPVSGAAYSADSAKT
    FGLEETRYEGPTGIAGVFQDACVQAGIPAVTFWAAVPHYVSQPPNPKATVALLRRVEDVLDIEVPLADLPAQAEEWEQAV
    TEMTSEDDEIAEYVQSLEERGDAEVDMNEALGKIDGDALAAEFERYLRRRGR

    >gi|145225999|ref|YP_001136653.1| DSBA oxidoreductase [Mycobacterium gilvum PYR-GCK]
    MNPLTRILLTFFIVITVAIGAGVYFSTRDGGTAGSGGTQADGEAQVVRENSHRLSSAPDSDVTFVEFLDFECEGCRAAFP
    AVEQLRAQYGQQVTFVARYFPMPGHFNGERAARAVEAAAQQGQFEPMYKKMFETQSQWGEKQVPADEVFRGFATELGLDV
    AAWEEAYNAPATLDRIEEDVADGTALGVQGTPTFFVNGKQIEIKTYADLGAAIKNALGEQQ