Mycobacterium bovis BCG Tokyo 172 uid59281

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|224988478|ref|YP_002643165.1| putative cation transporter p-type ATPase A [Mycobacterium bovis BCG str. Tokyo 172]
    MTAAVTGEHHASVQRIQLRISGMSCSACAHRVESTLNKLPGVRAAVNFGTRVATIDTSEAVDAAALCQAVRRAGYQADLC
    TDDGRSASDPDADHARQLLIRLAIAAVLFVPVADLSVMFGVVPATRFTGWQWVLSALALPVVTWAAWPFHRVAMRNARHH
    AASMETLISVGITAATIWSLYTVFGNHSPIERSGIWQALLGSDAIYFEVAAGVTVFVLVGRYFEARAKSQAGSALRALAA
    LSAKEVAVLLPDGSEMVIPADELKEQQRFVVRPGQIVAADGLAVDGSAAVDMSAMTGEAKPTRVRPGGQVIGGTTVLDGR
    LIVEAAAVGADTQFAGMVRLVEQAQAQKADAQRLADRISSVFVPAVLVIAALTAAGWLIAGGQPDRAVSAALAVLVIACP
    CALGLATPTAMMVASGRGAQLGIFLKGYKSLEATRAVDTVVFDKTGTLTTGRLQVSAVTAAPGWEADQVLALAATVEAAS
    EHSVALAIAAATTRRDAVTDFRAIPGRGVSGTVSGRAVRVGKPSWIGSSSCHPNMRAARRHAESLGETAVFVEVDGEPCG
    VIAVADAVKDSARDAVAALADRGLRTMLLTGDNPESAAAVATRVGIDEVIADILPEGKVDVIEQLRDRGHVVAMVGDGIN
    DGPALARADLGMAIGRGTDVAIGAADIILVRDHLDVVPLALDLARATMRTVKLNMVWAFGYNIAAIPVAAAGLLNPLVAG
    AAMAFSSFFVVSNSLRLRKFGRYPLGCGTVGGPQMTAPSSA

    >gi|224988489|ref|YP_002643176.1| putative cation-transporter P-type ATPase B [Mycobacterium bovis BCG str. Tokyo 172]
    MAAPVVGDADLQSVRRIRLDVSGMSCAACASRVETKLNKIPGVRASVNFATRVATIDAVGMAADELCGVVEKAGYHAAPH
    TETTVLDKRTKDPDGAHARRLLRRLLVAAVLFVPLADLSTLFAIVPSARVPGWGYILTALAAPVVTWAAWPFHSVALRNA
    RHRTTSMETLISVGIVAATAWSLSSVFGDQPPREGSGIWRAILNSDSIYLEVAAGVTVFVLAGRYFEARAKSKAGSALRA
    LAELGAKNVAVLLPDGAELVIPASELKKRQRFVTRPGETIAADGVVVDGSAAIDMSAMTGEAKPVRAYPAASVVGGTVVM
    DGRLVIEATAVGADTQFAAMVRLVEQAQTQKARAQRLADHIAGVFVPVVFVIAGLAGAAWLVSGAGADRAFSVTLGVLVI
    ACPCALGLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAVSTVTMAGSGTSERDREEVLGLA
    AAVESASEHAMAAAIVAASPDPGPVNGFVAVAGCGVSGEVGGHHVEVGKPSWITRTTPCHDAALVSARLDGESRGETVVF
    VSVDGVVRAALTIADTLKDSAAAAVAALRSRGLRTILLTGDNRAAADAVAAQVGIDSAVADMLPEGKVDVIQRLREEGHT
    VAMVGDGINDGPALVGADLGLAIGRGTDVALGAADIILVRDDLNTVPQALDLARATMRTIRMNMIWAFGYNVAAIPIAAA
    GLLNPLIAGAAMAFSSFFVVSNSLRLRNFGAQ

    >gi|224988522|ref|YP_002643209.1| methionine sulfoxide reductase A [Mycobacterium bovis BCG str. Tokyo 172]
    MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTT
    KDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPG
    WRLPRRTAESALRASLSPELGT

    >gi|224988712|ref|YP_002643399.1| putative transcriptional regulatory protein [Mycobacterium bovis BCG str. Tokyo 172]
    MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQALKSGGLVEARREGTRQYYR
    IAGEDVARLFALVQVVADEHLADVAVAAADVLGSPEDAITRAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAEL
    ADRLAELAGDRDIVAY
    CRGAYCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPVGHGD

    >gi|224988849|ref|YP_002643536.1| dihydrolipoamide dehydrogenase [Mycobacterium bovis BCG str. Tokyo 172]
    MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHIFTKDAKAFGISGEVTFDYG
    IAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANTLLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVT
    YEEQILSRELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIAD
    GGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTNVGHIYAIGDVNGLLQLAHVA
    EAQGVVAAETIAGAETLTLGDHRMLPRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVAD
    AKHGELLGGHLVGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGHMINF

    >gi|224988898|ref|YP_002643585.1| hypothetical protein JTY_0521 [Mycobacterium bovis BCG str. Tokyo 172]
    MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAASTGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLR
    ADIARSTFGSPPDKRLP

    >gi|224988916|ref|YP_002643603.1| putative thioredoxin protein [Mycobacterium bovis BCG str. Tokyo 172]
    MQSRATRRSGALTMRRLVIAAAVSALLLTGCSGRDAVAQGGTFEFVSPGGKTDIFYDPPASRGRPGPLSGPELADPARSV
    SLDDFPGQVVVVNVWGQW
    CGPCRAEVSQLQRVYDATRGAGVSFLGIDVRDNNRQAPQDFINDRHVTYPSIYDPAMRTLIA
    FGGKYPTSVIPSTLVLDRQHRVAAVFLRELLAADLQPVVERVAEEEPSGRAPVGAQ

    >gi|224989192|ref|YP_002643879.1| putative oxidoreductase [Mycobacterium bovis BCG str. Tokyo 172]
    MTAAQQDQAPMATPGCREGETYDVVVLGAGPVGQNVADRARAGGLRVAVVERELVGGECSYWACVPSKALLRPVIAISDA
    RRVDGAREAVDGSINTAGVFGRRNRYVAHWDDTGQADWVSGIGATLIRGDGRLDGPRRVVVTKSSGESVALTARHAVVIC
    TGSRPALPDLPGITEARPWTNRQATDNSTVPDRLAIVGAGGVGVEMATAWQGLGASVTLLARGSGLLPRMEPFVGELIGR
    GLADAGVDVRVGVSVRALGRPNPLAQWSSSWTTVPSCGSTRYSSPPAEHREPTTSAWRQ

    >gi|224989210|ref|YP_002643897.1| putative thiosulfate sulfurtransferase [Mycobacterium bovis BCG str. Tokyo 172]
    MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNL
    IDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAY
    CRIGERSS
    HTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS

    >gi|224989211|ref|YP_002643898.1| putative thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
    MTTMIVASVATGALATIARWLLTRRSVILREVGPETTPAAPARTAELGLSGAGPTVVHFRAPGCAPCDRVRRGVGDVCAD
    LGDVAHIEVDLDSNPQAARRFSVLSLPTTLIFDVDGRQRYRTSGVPKAADLRSALKPLLA

    >gi|224989486|ref|YP_002644173.1| hypothetical protein JTY_1115 [Mycobacterium bovis BCG str. Tokyo 172]
    MSPANPSGTNTLALATSPYLRQHADNPVHWQQWTPQALAEAAARAVPILLSVGYAACHWCHVMAHESFDDDEVAAAMNAG
    FVCIKVDREERPDIDAVYMNATVALTGQGGWPMTCFLTPNGRPFFCGTYYPKAAFLQLLSAISETWRERRAEVEQASDHI
    AAELRSMASGLPGGGPEVAPELCDDAVAGVLREQDTAHGGFGGAPKFPPSALLEALMRHYERTRSPAALEAVARTGNAMA
    RGGIYDQLGGGFARYSVDGAWVVPHFEKMLYDNALLLRAYAHWARRTGDPLARRVAAQTARFLLDELGSKAPADMFTSSL
    DADADGREGSTYVWTPVQLTEVLGGDDGRWAAEVFGVTEAGTFEHGTSVLQLPADPDDAARLDRVRAALLVARLARAQPA
    RDDKVVTSWNGLAITALAEASVALDDPALAHAARRCATRLLDLHVVDGRLRRASLGGVVGDSAAILEDHAMLATGLLALY
    QLTSEGAWLTAATGLLDTAVAHFGDPQRPGRWFDTADDAERLMLRPSDPLDGATPSGASSIAEALLTAGHVVDGARAERY
    WQLAADTLRAHAVLLARAPRSAGHWLAVAEAVVRGPLQIAVACDLPRSSLLADARRLAPGGAIVVGGAAGSSALLVGRDR
    VAGADAAYVCRGRVCDLPVTSAAELATALGVPG

    >gi|224989720|ref|YP_002644407.1| putative methylated-DNA--protein-cysteine methyltransferase [Mycobacterium bovis BCG str. Tokyo 172]
    MIHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRV
    WKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVP
    CHRVIGASGKLTGYGGGINRKRALLELEKSRAPAD
    LTLFD

    >gi|224989729|ref|YP_002644416.1| putative thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
    MTRPRPPLGPAMAGAVDLSGIKQRAQQNAAASTDADRALSTPSGVTEITEANFEDEVIVRSDEVPVVVLLWSPRSEVCVD
    LLDTLSGLAAAAKGKWSLASVNVDVAPRVAQIFGVQAVPTVVALAAGQPISSFQGLQPADQLSRWVDSLLSATAGKLKGA
    ASSEESTEVDPAVAQARQQLEDGDFVAARKSYQAILDANPGSVEAKAAIRQIEFLIRATAQRPDAVSVADSLSDDIDAAF
    AAADVQVLNQDVSAAFERLIALVRRTSGEERTRVRTRLIELFELFDPADPEVVAGRRNLANALY

    >gi|224989875|ref|YP_002644562.1| putative thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
    MTTRDLTAAYFQQTISANSNVLVYFWAPLCAPCDLFTPTYEASSRKHFDVVHGKVNIETEKDLASIAGVKLLPTLMAFKK
    GKLVFKQAGIANPAIMDNLVQQLRAYTFKSPAGEGIGPGTKTSS

    >gi|224989876|ref|YP_002644563.1| putative thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
    MTTRDLTAAQFNETIQSSDMVLVDYWASWCGPCRAFAPTFAESSEKHPDVVHAKVDTEAERELAAAAQIRSIPTIMAFKN
    GKLLFNQAGALPPAALESLVQQLKAYEVEAGEATTQNGRAQQA

    >gi|224989990|ref|YP_002644677.1| putative peroxidoxin [Mycobacterium bovis BCG str. Tokyo 172]
    MKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVRKQAKFA
    EVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRSG

    >gi|224990056|ref|YP_002644743.1| putative transcriptional regulatory protein [Mycobacterium bovis BCG str. Tokyo 172]
    MSGAKKLIFEQFALVGQALSSGHRLELLDLLVQGERSVDALARASGLTFANASQHLLQLRRAGLVTSRRDGKRVIYALSD
    PQVWDVVRAVRAVAERNLASVGSLVRQYYTDRDSLEPISRDELQARVAAGSVLVLDVRPAMEYAAGHLPGAVSIPLDELA
    ERLDELPSGIDIVA
    CCRGPYCVYAYDALELLRPNGFSARRLDGGFSEWLAADLPVVRT

    >gi|224990058|ref|YP_002644745.1| hypothetical protein JTY_1689 [Mycobacterium bovis BCG str. Tokyo 172]
    MACPEWEISRSKRTRKPVLRPRHSVSTLTNRFLAEFCHRYGIGVPTRLARGATVPTRRLQDINDQPVDVPAATGRTHLQF
    RRFAA
    CPICHLHLRSFANRHQEVADSGITEVVFFHSAADALRGYQSLLPFAVIADPDRVQYREFGVEKSLGAITHPRALW
    AAVRGSAAMLHRNDPERAGVGFGDGTTHLGLPADFLLDADGTVAAVHYGRHADDQWSVDQLIDINRSLGGKGTQ

    >gi|224990059|ref|YP_002644746.1| putative lipoprotein [Mycobacterium bovis BCG str. Tokyo 172]
    MTHSRLIGALTVVAIIVTACGSQPKSQPAVAPTGDAAAATQVPAGQTVPAQLQFSAKTLDGHDFHGESLLGKPAVLWFWA
    PW
    CPTCQGEAPVVGQVAASHPEVTFVGVAGLDQVPAMQEFVNKYPVKTFTQLADTDGSVWANFGVTQQPAYAFVDPHGNV
    DVVRGRMSQDELTRRVTALTSR

    >gi|224990115|ref|YP_002644802.1| hypothetical protein JTY_1746 [Mycobacterium bovis BCG str. Tokyo 172]
    MAVESSMLALGTPAPSFTLPQPATGATVSLDELTGPALVVTFICNHCPYVQHVAAGLATLGRDLADQGVPMVGISSNDVV
    TYPQDGPDQMVAEARRHGWTFPYLYDETQDVARAFSAACTPDTFVFDGQRRLVYRGQLDDSRPGNGRPVTAADVRAAVDA
    LLAGRPVNPDQRPSIGCGIKWR

    >gi|224990153|ref|YP_002644840.1| hypothetical protein JTY_1784 [Mycobacterium bovis BCG str. Tokyo 172]
    MSDQPRHHQVLDDLLPQHRALRHQIPQVYQRFVALGDAALTDGALSRKVKELVALAIAVVQGCDGCVASHAQAAVRAGAT
    AQEAAEAIGVTILMHGGPATIHGARAYAAFCEFADTTPS

    >gi|224990321|ref|YP_002645008.1| thiol peroxidase [Mycobacterium bovis BCG str. Tokyo 172]
    MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVCATSVRTFDERAAASGATVLC
    VSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAAL
    AALGA

    >gi|224990579|ref|YP_002645266.1| hypothetical protein JTY_2214 [Mycobacterium bovis BCG str. Tokyo 172]
    MTVQNEPSAKTHGVILTEAAAAKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDQTAEFGGVRLIVDRMS
    APYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|224990614|ref|YP_002645301.1| peroxiredoxin [Mycobacterium bovis BCG str. Tokyo 172]
    MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIW
    ATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA

    >gi|224990635|ref|YP_002645322.1| putative transcriptional regulatory protein [Mycobacterium bovis BCG str. Tokyo 172]
    MSGALETTEEFGNRFVAAIDSAGLAILVSVGHQTGLLDTMAGLPPATSMEIAEAAGLEERYVREWLGGMTTGQIVEYDAG
    SSTYSLPAHRAGMLTRAAGPDNLAVIAQFVSLLGEVEQKVIRCFREGGGVPYSEYPRFHKLMAEMSGMVFDAALIDVVLP
    LVDGLPDRLRSGADVADFGCGSGRAVKLMAQAFGASRFTGIDFSDEAVAAGTEEAARLGLANATFERHDLAELDKVGAYD
    VITVFDAIHDQAQPARVLQNIYRALRPGGVLLMVDIKASSQLEDNVGVPLSTYLYTTSLMH
    CMTVSLALDGAGLGTVWGR
    QLATSMLADAGFTDVTVAEIESDVLNNYYIARK

    >gi|224990661|ref|YP_002645348.1| hypothetical protein JTY_2296 [Mycobacterium bovis BCG str. Tokyo 172]
    MTTVDFHFDPLCPFAYQTSVWIRDVRAQLGITINWRFFSLEEINLVAGKKHPWERDWSYGWSLMRIGALLRRTNMSLLDR
    WYAAIGHELHTLGGKPHDPAVARRLLCDVGVNAAILDAALDDPTTHDDVRADH

    >gi|224990667|ref|YP_002645354.1| putative thiosulfate sulfurtransferase [Mycobacterium bovis BCG str. Tokyo 172]
    MQARGQVLITAAELAGMIQAGDPVSILDVRWRLDEPDGHAAYLQGHLPGAVFVSLEDELSDHTIAGRGRHPLPSGASLQA
    TVRRCGIRHDVPVVVYDDWNRAGSARAWWVLTAAGIANVRILDGGLPAWRSAGGSIETGQVSPQLGNVTVLHDDLYAGQR
    LTLTAQQAGAGGVTLLDARVPERFRGDVEPVDAVAGHIPGAINVPSGSVLADDGTFLGNGALNALLSDHGIDHGGRVGVY
    CGSGVSAAVIVAALAVIGQDAALFPGSWSEWSSDPTRPVGRGTA

    >gi|224990804|ref|YP_002645491.1| alkyl hydroperoxide reductase C protein [Mycobacterium bovis BCG str. Tokyo 172]
    MPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDA
    QILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDE
    VLRVLDALQSDELCACNWRKGDPTLDAGELLKASA

    >gi|224990843|ref|YP_002645530.1| hypothetical protein JTY_2480 [Mycobacterium bovis BCG str. Tokyo 172]
    MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQYREGMARAWGPVRVAIAAEQ
    AHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNG
    VAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQFD

    >gi|224990898|ref|YP_002645585.1| putative bacterioferritin comigratory protein [Mycobacterium bovis BCG str. Tokyo 172]
    MTKTTRLTPGDKAPAFTLPDADGNNVSLADYRGRRVIVYFYPAASTPGCTKQACDFRDNLGDFTTAGLNVVGISPDKPEK
    LATFRDAQGLTFPLLSDPDREVLTAWGAYGEKQMYGKTVQGVIRSTFVVDEDGKIVVAQYNVKATGHVAKLRRDLSV

    >gi|224991041|ref|YP_002645730.1| hypothetical protein JTY_2681 [Mycobacterium bovis BCG str. Tokyo 172]
    MTRPKLELSDDEWRQKLTPQEFHVLRRAGTERPFTGEYTDTTTAGIYQCRACGAELFRSTEKFESHCGWPSFFDPKSSDA
    VTLRPDHSLGMTRTEVLCANCDSHLGHVFAGEGYPTPTDKRY
    CINSISLRLVPGSV

    >gi|224991080|ref|YP_002645769.1| soluble pyridine nucleotide transhydrogenase [Mycobacterium bovis BCG str. Tokyo 172]
    MREYDIVVIGSGPGGQKAAIASAKLGKSVAIVERGRMLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASYRVKDRIT
    PADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDPHTILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEE
    RVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFGEEVT
    AVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAGLEVQGRGRIFVDDRFQTKVDHIYAVGDVIGFPALAAT
    SMEQGRLAAYHAFGEPTDGITELQPIGIYSIPEVSYVGATEVELTKSSIPYEVGVARYRELARGQIAGDSYGMLKLLVST
    EDLKLLGVHIFGTSATEMVHIGQAVMGCGGSVEYLVDAVFNYPTFSEAYKNAALDVMNKMRALNQFRR

    >gi|224991227|ref|YP_002645916.1| mycothione reductase [Mycobacterium bovis BCG str. Tokyo 172]
    METYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTIRGASRYGIDAHIDRVRWDDV
    VSRVFGRIDPIALSGEDYRRCAPNIDVYRTHTRFGPVQADGRYLLRTDAGEEFTAEQVVIAAGSRPVIPPAILASGVDYH
    TSDTVMRIAELPEHIVIVGSGFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNVVDGQQ
    RGSGVALRLDDGCTINADLLLVATGRVSNADLLDAEQAGVDVEDGRVIVDEYQRTSARGVFALGDVSSPYLLKHVANHEA
    RVVQHNLLCDWEDTQSMIVTDHRYVPAAVFTDPQIAAVGLTENQAVAKGLDISVKIQDYGDVAYGWAMEDTSGIVKLITE
    RGSGRLLGAHIMGYQASSLIQPLIQAMSFGLTAAEMARGQYWIHPALPEVVENALLGLR

    >gi|224991248|ref|YP_002645937.1| putative integral membrane C-type cytochrome biogenesis protein [Mycobacterium bovis BCG str. Tokyo 172]
    MVESRRAAAAASAYASRCGIAPATSQRSLATPPTISVPSGEGRCRCHVARGAGRDPRRRLRRRRWCGRCGYHSHLTGGEF
    DVNRLCQQRSRERSCQLVAVPADPRPKRQRITDVLTLALVGFLGGLITGISPCILPVLPVIFFSGAQSVDAAQVAKPEGA
    VAVRRKRALSATLRPYRVIGGLVLSFGMVTLLGSALLSVLHLPQDAIRWAALVALVAIGAGLIFPRFEQLLEKPFSRIPQ
    KQIVTRSNGFGLGLALGVLYVPCAGPILAAIVVAGATATIGLGTVVLTATFALGAALPLLFFALAGQRIAERVGAFRRRQ
    REIRIATGSVTILLAVALVFDLPAALQRAIPDYTASLQQQISTGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTA
    PDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYS
    CINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAK
    GAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPD
    LTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVV
    GGTGTLTVVRDGKPATLPISGPPTTHQVVAGDRLASETLEVRPSKGLQVFSFTYG

    >gi|224991252|ref|YP_002645941.1| soluble secreted antigen [Mycobacterium bovis BCG str. Tokyo 172]
    MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLSGAPFDGASLQGKPAVLWFWTPWCPFCNAEA
    PSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMS
    QDELSGRVAALTS

    >gi|224991429|ref|YP_002646118.1| putative glutaredoxin electron transport component of nrdEF [Mycobacterium bovis BCG str. Tokyo 172]
    MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTA

    >gi|224991493|ref|YP_002646182.1| putative molybdenum cofactor biosynthesis protein [Mycobacterium bovis BCG str. Tokyo 172]
    MTEALIPAPSQISLTRDEVRRYSRHLIIPDIGVNGQQRLKDARVLCIGAGGLGSPALLYLAAAGVGTIGIIDGDHVDESN
    LQRQIIHGTSDVGRPKVESAAEAVAEINPHVRVTQYREMLTHDNALEIFGDHDLIVDGTDNFTTRYLINDAAVLAGKPYV
    WGSIYRFNGQTSVFWPGRGPCYRCLHPAPPPPGLVPS
    CAEGGVLGAICATIASIQVTEVLKLLTGVGTPLVGRLLMYEAL
    DATYHQIRIAKNPDCAICGDAPTITELVDDSVSCASTQSVDPELVISCDELRTKQQSDQNFLLVDVREPAEFDIAHIPGS
    ILIPKGEIGSAAGLAQLPLDKEIVLY
    CKSGIRSAQALTTLKAAGLHNVKHLDGGIAEWTRTIDSSLLVY

    >gi|224991494|ref|YP_002646183.1| putative thiosulfate sulfurtransferase [Mycobacterium bovis BCG str. Tokyo 172]
    MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNL
    IDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAY
    CRIGERSS
    HTWFVLRELLGHQNVNIAFGYGPHACPASAYSRMCLTTFFTSLTQRFPQLQLARPFEDLERRGKGLHSVGIKELLVTWPT


    >gi|224991575|ref|YP_002646264.1| putative glutaredoxin protein [Mycobacterium bovis BCG str. Tokyo 172]
    MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLV
    KIAG

    >gi|224991584|ref|YP_002646273.1| molybdopterin biosynthesis-like protein [Mycobacterium bovis BCG str. Tokyo 172]
    MSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDFDVVDES
    NLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPY
    VWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPEPPPPGMVPS
    CAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLL
    VYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDSGRKLALIDVRDPVEWDIVHI
    DGAQLIPKSLINSGEGLAKLPQDRTAVLY
    CKTGVRSAEALAAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY

    >gi|224991665|ref|YP_002646354.1| putative thiosulfate sulfurtransferase [Mycobacterium bovis BCG str. Tokyo 172]
    MPLPADPSPTLSAYAHPERLVTADWLSAHMGAPGLAIVESDEDVLLYDVGHIPGAVKIDWHTDLNDPRVRDYINGEQFAE
    LMDRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHADVRLLNGGRDLWLAERRETTLDVPTKTCTGYPVVQRNDAPIRA
    FRDDVLAILGAQPLIDVRSPEEYTGKRTHMPDYPEEGALRAGHIPTAVHIPWGKAADESGRFRSREELERLYDFINPDDQ
    TVVY
    CRIGERSSHTWFVLTHLLGKADVRNYDGSWTEWGNAVRVPIVAGEEPGVVPVV

    >gi|224991752|ref|YP_002646441.1| putative transposase fusion protein [Mycobacterium bovis BCG str. Tokyo 172]
    MVVVGTDAHKYSHTFVATDEVGRQLGEKTVKATTAGHATAIMWAREQFGLELIWGIEDCRNMSARLERDLLAAGQQVVRV
    PTKLMAQTRKSARSRGKSDPIDALAVARAVLRETDLPLATHDETSRELKLLTDRRDVLVAQRTSAINRLRWLVHELDPER
    APAARSLDAAKHQQALRTWLDTQPGLVAELARAELTDIIRLTGEINTLAQRISARVHQVAPALLEIPGCAELTAAKIVGE
    AAGVTRFKSEAAFACHAAVAPIPVWSGNTAGQMRLSRSGNRQLNAALHRIALTQIRMTDSRGQAYYQRLQDAGKTKRAAL
    RCLKRRLARTVFQALRTVHQPSSEHTQPAAACHRSYCSSHLGEPPRLTDMTQKTRIQPLPPKRAGLLIRALYRIAKRRFG
    EVPEPFTVTAHHRRLLIANVVHEALLQRASRKLPPSVRELAVFWTARSIGCSW
    CVDFGAMLQRLDGLDVDRLTDIDNYAT
    SSKFSDDERAAIAYAEAMTADPHSVTDEQVADLRARFGEAGVIELTYQIGVENMRARMNSALGITEQGFNSGDACRVPWA
    APDVPSAESR

    >gi|224992082|ref|YP_002646771.1| putative membrane-anchored thioredoxin-like protein [Mycobacterium bovis BCG str. Tokyo 172]
    MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPC
    PAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHW
    CAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAA
    ALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG

    >gi|224992141|ref|YP_002646830.1| putative transferase [Mycobacterium bovis BCG str. Tokyo 172]
    MFVEYTKSICPVCKVVVDAQVNIRHDKVYLRKRCREHGSFEALVYGDAQMYLESARFNKPGTFPLRFQTEVRDGCPSDCG
    LCPDHKQHACLGLIEVNTHCNLDCPICFADSGHQPDGYAITAAQCERMLDTLVAAEGEPEVVMFSGGEPTIHKQLLEFVD
    AAQARPVKTIIINTNGIRLASDRRFVDQLATRNRPGHPVHIYLQFDGLDEATHRRIRGHDLRDVKQRALDNCAAAGLTVS
    LVAAVERGLNEHELGAVIRHGMAQPGVQSVVFQPVTHAGRHVQFDPLTRLTNSDIIACITAQLPEWFRPGDFFPVPCCFP
    SCRSITYLLTDGEHVVPIPRLLNVEDYLDYVSNRVIPDLAIREALENLWSASAVPGTDTMTAQLQRATAALNCAEGCGIN
    LPEALTHLTDRVFAIVIQDFQDPYTLNVKQLMKCCVQQITPDGRLIPFCAYNSVGYREQVREQLTGVPVPDIVPNAIPLA
    GLLADAPHGSKQANTGGSIARLAGPTRGAPMALPPQQIKACCADAYSRDIVALLLGDSFHPGGATLTRRLADQLGLRSTG
    DPRRVADIAAGPGASARLLASDYGVAVDGVDISEINVKRAQAAVAQTGLTERVRFHLGDAESVPLPDDTFDALVCECAFC
    TFPDKNAAAQQFARILRPGGLAGITDVTVGDGGLPAELTPLAAWVA
    CIADARTVTDYTDILEGAGLRTRHIESHDESLLD
    MIDRIDARITALHVAAPEILADNGIRHDSVRDFTALARAAVQTGRIGYTLMIAEKP

    >gi|224992319|ref|YP_002647009.1| putative thioredoxin reductase [Mycobacterium bovis BCG str. Tokyo 172]
    MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTGVENYPGFRNGITGPELMDEMREQ
    ALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSS
    CATCDGFFFRDQDIAV
    IGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLP
    VTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAA
    TGEADSTDALIGAQR

    >gi|224992320|ref|YP_002647010.1| thioredoxin [Mycobacterium bovis BCG str. Tokyo 172]
    MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSI
    PTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN