Mycobacterium bovis BCG Pasteur 1173P2 uid58781

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|121635899|ref|YP_976122.1| putative thioredoxin reductase trxB2 (TRXR) [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTGVENYPGFRNGITGPELMDEMREQ
    ALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSS
    CATCDGFFFRDQDIAV
    IGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLP
    VTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAA
    TGEADSTDALIGAQR

    >gi|121635900|ref|YP_976123.1| thioredoxin trxC (TRX) (MPT46) [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSI
    PTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN

    >gi|121636005|ref|YP_976228.1| putative cation transporter p-type atpase A ctpA [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTAAVTGEHHASVQRIQLRISGMSCSACAHRVESTLNKLPGVRAAVNFGTRVATIDTSEAVDAAALCQAVRRAGYQADLC
    TDDGRSASDPDADHARQLLIRLAIAAVLFVPVADLSVMFGVVPATRFTGWQWVLSALALPVVTWAAWPFHRVAMRNARHH
    AASMETLISVGITAATIWSLYTVFGNHSPIERSGIWQALLGSDAIYFEVAAGVTVFVLVGRYFEARAKSQAGSALRALAA
    LSAKEVAVLLPDGSEMVIPADELKEQQRFVVRPGQIVAADGLAVDGSAAVDMSAMTGEAKPTRVRPGGQVIGGTTVLDGR
    LIVEAAAVGADTQFAGMVRLVEQAQAQKADAQRLADRISSVFVPAVLVIAALTAAGWLIAGGQPDRAVSAALAVLVIACP
    CALGLATPTAMMVASGRGAQLGIFLKGYKSLEATRAVDTVVFDKTGTLTTGRLQVSAVTAAPGWEADQVLALAATVEAAS
    EHSVALAIAAATTRRDAVTDFRAIPGRGVSGTVSGRAVRVGKPSWIGSSSCHPNMRAARRHAESLGETAVFVEVDGEPCG
    VIAVADAVKDSARDAVAALADRGLRTMLLTGDNPESAAAVATRVGIDEVIADILPEGKVDVIEQLRDRGHVVAMVGDGIN
    DGPALARADLGMAIGRGTDVAIGAADIILVRDHLDVVPLALDLARATMRTVKLNMVWAFGYNIAAIPVAAAGLLNPLVAG
    AAMAFSSFFVVSNSLRLRKFGRYPLGCGTVGGPQMTAPSSA

    >gi|121636016|ref|YP_976239.1| putative cation-transporter P-type atpase B ctpB [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MAAPVVGDADLQSVRRIRLDVSGMSCAACASRVETKLNKIPGVRASVNFATRVATIDAVGMAADELCGVVEKAGYHAAPH
    TETTVLDKRTKDPDGAHARRLLRRLLVAAVLFVPLADLSTLFAIVPSARVPGWGYILTALAAPVVTWAAWPFHSVALRNA
    RHRTTSMETLISVGIVAATAWSLSSVFGDQPPREGSGIWRAILNSDSIYLEVAAGVTVFVLAGRYFEARAKSKAGSALRA
    LAELGAKNVAVLLPDGAELVIPASELKKRQRFVTRPGETIAADGVVVDGSAAIDMSAMTGEAKPVRAYPAASVVGGTVVM
    DGRLVIEATAVGADTQFAAMVRLVEQAQTQKARAQRLADHIAGVFVPVVFVIAGLAGAAWLVSGAGADRAFSVTLGVLVI
    ACPCALGLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAVSTVTMAGSGTSERDREEVLGLA
    AAVESASEHAMAAAIVAASPDPGPVNGFVAVAGCGVSGEVGGHHVEVGKPSWITRTTPCHDAALVSARLDGESRGETVVF
    VSVDGVVRAALTIADTLKDSAAAAVAALRSRGLRTILLTGDNRAAADAVAAQVGIDSAVADMLPEGKVDVIQRLREEGHT
    VAMVGDGINDGPALVGADLGLAIGRGTDVALGAADIILVRDDLNTVPQALDLARATMRTIRMNMIWAFGYNVAAIPIAAA
    GLLNPLIAGAAMAFSSFFVVSNSLRLRNFGAQ

    >gi|121636049|ref|YP_976272.1| methionine sulfoxide reductase A [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTT
    KDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPG
    WRLPRRTAESALRASLSPELGT

    >gi|121636239|ref|YP_976462.1| ArsR family transcriptional regulator [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQALKSGGLVEARREGTRQYYR
    IAGEDVARLFALVQVVADEHLADVAVAAADVLGSPEDAITRAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAEL
    ADRLAELAGDRDIVAY
    CRGAYCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPVGHGD

    >gi|121636377|ref|YP_976600.1| dihydrolipoamide dehydrogenase [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHIFTKDAKAFGISGEVTFDYG
    IAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANTLLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVT
    YEEQILSRELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIAD
    GGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTNVGHIYAIGDVNGLLQLAHVA
    EAQGVVAAETIAGAETLTLGDHRMLPRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVAD
    AKHGELLGGHLVGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGHMINF

    >gi|121636426|ref|YP_976649.1| hypothetical protein BCG_0551 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAASTGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLR
    ADIARSTFGSPPDKRLP

    >gi|121636444|ref|YP_976667.1| putative thioredoxin protein [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MQSRATRRSGALTMRRLVIAAAVSALLLTGCSGRDAVAQGGTFEFVSPGGKTDIFYDPPASRGRPGPLSGPELADPARSV
    SLDDFPGQVVVVNVWGQW
    CGPCRAEVSQLQRVYDATRGAGVSFLGIDVRDNNRQAPQDFINDRHVTYPSIYDPAMRTLIA
    FGGKYPTSVIPSTLVLDRQHRVAAVFLRELLAADLQPVVERVAEEEPSGRAPVGAQ

    >gi|121636720|ref|YP_976943.1| putative oxidoreductase [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTAAQQDQAPMATPGCREGETYDVVVLGAGPVGQNVADRARAGGLRVAVVERELVGGECSYWACVPSKALLRPVIAISDA
    RRVDGAREAVDGSINTAGVFGRRNRYVAHWDDTGQADWVSGIGATLIRGDGRLDGPRRVVVTKSSGESVALTARHAVVIC
    TGSRPALPDLPGITEARPWTNRQATDNSTVPDRLAIVGAGGVGVEMATAWQGLGASVTLLARGSGLLPRMEPFVGELIGR
    GLADAGVDVRVGVSVRALGRPNPLAQWSSSWTTVPSCGSTRYSSPPAEHREPTTSAWRQ

    >gi|121636739|ref|YP_976962.1| putative thiosulfate sulfurtransferase cysA2 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNL
    IDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAY
    CRIGERSS
    HTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS

    >gi|121636740|ref|YP_976963.1| putative thioredoxin thiX [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTTMIVASVATGALATIARWLLTRRSVILREVGPETTPAAPARTAELGLSGAGPTVVHFRAPGCAPCDRVRRGVGDVCAD
    LGDVAHIEVDLDSNPQAARRFSVLSLPTTLIFDVDGRQRYRTSGVPKAADLRSALKPLLA

    >gi|121637013|ref|YP_977236.1| hypothetical protein BCG_1142 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MSPANPSGTNTLALATSPYLRQHADNPVHWQQWTPQALAEAAARAVPILLSVGYAACHWCHVMAHESFDDDEVAAAMNAG
    FVCIKVDREERPDIDAVYMNATVALTGQGGWPMTCFLTPNGRPFFCGTYYPKAAFLQLLSAISETWRERRAEVEQASDHI
    AAELRSMASGLPGGGPEVAPELCDDAVAGVLREQDTAHGGFGGAPKFPPSALLEALMRHYERTRSPAALEAVARTGNAMA
    RGGIYDQLGGGFARYSVDGAWVVPHFEKMLYDNALLLRAYAHWARRTGDPLARRVAAQTARFLLDELGSKAPADMFTSSL
    DADADGREGSTYVWTPVQLTEVLGGDDGRWAAEVFGVTEAGTFEHGTSVLQLPADPDDAARLDRVRAALLVARLARAQPA
    RDDKVVTSWNGLAITALAEASVALDDPALAHAARRCATRLLDLHVVDGRLRRASLGGVVGDSAAILEDHAMLATGLLALY
    QLTSEGAWLTAATGLLDTAVAHFGDPQRPGRWFDTADDAERLMLRPSDPLDGATPSGASSIAEALLTAGHVVDGARAERY
    WQLAADTLRAHAVLLARAPRSAGHWLAVAEAVVRGPLQIAVACDLPRSSLLADARRLAPGGAIVVGGAAGSSALLVGRDR
    VAGADAAYVCRGRVCDLPVTSAAELATALGVPG

    >gi|121637246|ref|YP_977469.1| putative methylated-DNA--protein-cysteine methyltransferase ogt [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MIHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRV
    WKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVP
    CHRVIGASGKLTGYGGGINRKRALLELEKSRAPAD
    LTLFD

    >gi|121637255|ref|YP_977478.1| putative thioredoxin [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTRPRPPLGPAMAGAVDLSGIKQRAQQNAAASTDADRALSTPSGVTEITEANFEDEVIVRSDEVPVVVLLWSPRSEVCVD
    LLDTLSGLAAAAKGKWSLASVNVDVAPRVAQIFGVQAVPTVVALAAGQPISSFQGLQPADQLSRWVDSLLSATAGKLKGA
    ASSEESTEVDPAVAQARQQLEDGDFVAARKSYQAILDANPGSVEAKAAIRQIEFLIRATAQRPDAVSVADSLSDDIDAAF
    AAADVQVLNQDVSAAFERLIALVRRTSGEERTRVRTRLIELFELFDPADPEVVAGRRNLANALY

    >gi|121637400|ref|YP_977623.1| putative thioredoxin trxA [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTTRDLTAAYFQQTISANSNVLVYFWAPLCAPCDLFTPTYEASSRKHFDVVHGKVNIETEKDLASIAGVKLLPTLMAFKK
    GKLVFKQAGIANPAIMDNLVQQLRAYTFKSPAGEGIGPGTKTSS

    >gi|121637401|ref|YP_977624.1| putative thioredoxin trxB1 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTTRDLTAAQFNETIQSSDMVLVDYWASWCGPCRAFAPTFAESSEKHPDVVHAKVDTEAERELAAAAQIRSIPTIMAFKN
    GKLLFNQAGALPPAALESLVQQLKAYEVEAGEATTQNGRAQQA

    >gi|121637515|ref|YP_977738.1| putative peroxidoxin bcpB [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVRKQAKFA
    EVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRSG

    >gi|121637581|ref|YP_977804.1| putative transcriptional regulatory protein [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MSGAKKLIFEQFALVGQALSSGHRLELLDLLVQGERSVDALARASGLTFANASQHLLQLRRAGLVTSRRDGKRVIYALSD
    PQVWDVVRAVRAVAERNLASVGSLVRQYYTDRDSLEPISRDELQARVAAGSVLVLDVRPAMEYAAGHLPGAVSIPLDELA
    ERLDELPSGIDIVA
    CCRGPYCVYAYDALELLRPNGFSARRLDGGFSEWLAADLPVVRT

    >gi|121637583|ref|YP_977806.1| hypothetical protein BCG_1714 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MACPEWEISRSKRTRKPVLRPRHSVSTLTNRFLAEFCHRYGIGVPTRLARGATVPTRRLQDINDQPVDVPAATGRTHLQF
    RRFAA
    CPICHLHLRSFANRHQEVADSGITEVVFFHSAADALRGYQSLLPFAVIADPDRVQYREFGVEKSLGAITHPRALW
    AAVRGSAAMLHRNDPERAGVGFGDGTTHLGLPADFLLDADGTVAAVHYGRHADDQWSVDQLIDINRSLGGKGTQ

    >gi|121637584|ref|YP_977807.1| putative lipoprotein dsbF [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTHSRLIGALTVVAIIVTACGSQPKSQPAVAPTGDAAAATQVPAGQTVPAQLQFSAKTLDGHDFHGESLLGKPAVLWFWA
    PW
    CPTCQGEAPVVGQVAASHPEVTFVGVAGLDQVPAMQEFVNKYPVKTFTQLADTDGSVWANFGVTQQPAYAFVDPHGNV
    DVVRGRMSQDELTRRVTALTSR

    >gi|121637640|ref|YP_977863.1| hypothetical protein BCG_1771c [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MAVESSMLALGTPAPSFTLPQPATGATVSLDELTGPALVVTFICNHCPYVQHVAAGLATLGRDLADQGVPMVGISSNDVV
    TYPQDGPDQMVAEARRHGWTFPYLYDETQDVARAFSAACTPDTFVFDGQRRLVYRGQLDDSRPGNGRPVTAADVRAAVDA
    LLAGRPVNPDQRPSIGCGIKWR

    >gi|121637837|ref|YP_978060.1| thiol peroxidase [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVCATSVRTFDERAAASGATVLC
    VSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAAL
    AALGA

    >gi|121638085|ref|YP_978309.1| hypothetical protein BCG_2220c [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTVQNEPSAKTHGVILTEAAAAKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDQTAEFGGVRLIVDRMS
    APYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|121638120|ref|YP_978344.1| peroxiredoxin AhpE [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIW
    ATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA

    >gi|121638141|ref|YP_978365.1| putative transcriptional regulatory protein [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MSGALETTEEFGNRFVAAIDSAGLAILVSVGHQTGLLDTMAGLPPATSMEIAEAAGLEERYVREWLGGMTTGQIVEYDAG
    SSTYSLPAHRAGMLTRAAGPDNLAVIAQFVSLLGEVEQKVIRCFREGGGVPYSEYPRFHKLMAEMSGMVFDAALIDVVLP
    LVDGLPDRLRSGADVADFGCGSGRAVKLMAQAFGASRFTGIDFSDEAVAAGTEEAARLGLANATFERHDLAELDKVGAYD
    VITVFDAIHDQAQPARVLQNIYRALRPGGVLLMVDIKASSQLEDNVGVPLSTYLYTTSLMH
    CMTVSLALDGAGLGTVWGR
    QLATSMLADAGFTDVTVAEIESDVLNNYYIARK

    >gi|121638167|ref|YP_978391.1| hypothetical protein BCG_2302c [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTTVDFHFDPLCPFAYQTSVWIRDVRAQLGITINWRFFSLEEINLVAGKKHPWERDWSYGWSLMRIGALLRRTNMSLLDR
    WYAAIGHELHTLGGKPHDPAVARRLLCDVGVNAAILDAALDDPTTHDDVRADH

    >gi|121638173|ref|YP_978397.1| putative thiosulfate sulfurtransferase SseB [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MQARGQVLITAAELAGMIQAGDPVSILDVRWRLDEPDGHAAYLQGHLPGAVFVSLEDELSDHTIAGRGRHPLPSGASLQA
    TVRRCGIRHDVPVVVYDDWNRAGSARAWWVLTAAGIANVRILDGGLPAWRSAGGSIETGQVSPQLGNVTVLHDDLYAGQR
    LTLTAQQAGAGGVTLLDARVPERFRGDVEPVDAVAGHIPGAINVPSGSVLADDGTFLGNGALNALLSDHGIDHGGRVGVY
    CGSGVSAAVIVAALAVIGQDAALFPGSWSEWSSDPTRPVGRGTA

    >gi|121638310|ref|YP_978534.1| Alkyl hydroperoxide reductase C protein ahpC [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDA
    QILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDE
    VLRVLDALQSDELCACNWRKGDPTLDAGELLKASA

    >gi|121638349|ref|YP_978573.1| hypothetical protein BCG_2486c [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQYREGMARAWGPVRVAIAAEQ
    AHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNG
    VAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQFD

    >gi|121638404|ref|YP_978628.1| putative bacterioferritin comigratory protein bcp [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTKTTRLTPGDKAPAFTLPDADGNNVSLADYRGRRVIVYFYPAASTPGCTKQACDFRDNLGDFTTAGLNVVGISPDKPEK
    LATFRDAQGLTFPLLSDPDREVLTAWGAYGEKQMYGKTVQGVIRSTFVVDEDGKIVVAQYNVKATGHVAKLRRDLSV

    >gi|121638549|ref|YP_978773.1| hypothetical protein BCG_2687 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTRPKLELSDDEWRQKLTPQEFHVLRRAGTERPFTGEYTDTTTAGIYQCRACGAELFRSTEKFESHCGWPSFFDPKSSDA
    VTLRPDHSLGMTRTEVLCANCDSHLGHVFAGEGYPTPTDKRY
    CINSISLRLVPGSV

    >gi|121638588|ref|YP_978812.1| soluble pyridine nucleotide transhydrogenase [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MREYDIVVIGSGPGGQKAAIASAKLGKSVAIVERGRMLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASYRVKDRIT
    PADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDPHTILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEE
    RVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFGEEVT
    AVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAGLEVQGRGRIFVDDRFQTKVDHIYAVGDVIGFPALAAT
    SMEQGRLAAYHAFGEPTDGITELQPIGIYSIPEVSYVGATEVELTKSSIPYEVGVARYRELARGQIAGDSYGMLKLLVST
    EDLKLLGVHIFGTSATEMVHIGQAVMGCGGSVEYLVDAVFNYPTFSEAYKNAALDVMNKMRALNQFRR

    >gi|121638735|ref|YP_978959.1| mycothione reductase [Mycobacterium bovis BCG str. Pasteur 1173P2]
    METYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTIRGASRYGIDAHIDRVRWDDV
    VSRVFGRIDPIALSGEDYRRCAPNIDVYRTHTRFGPVQADGRYLLRTDAGEEFTAEQVVIAAGSRPVIPPAILASGVDYH
    TSDTVMRIAELPEHIVIVGSGFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNVVDGQQ
    RGSGVALRLDDGCTINADLLLVATGRVSNADLLDAEQAGVDVEDGRVIVDEYQRTSARGVFALGDVSSPYLLKHVANHEA
    RVVQHNLLCDWEDTQSMIVTDHRYVPAAVFTDPQIAAVGLTENQAVAKGLDISVKIQDYGDVAYGWAMEDTSGIVKLITE
    RGSGRLLGAHIMGYQASSLIQPLIQAMSFGLTAAEMARGQYWIHPALPEVVENALLGLR

    >gi|121638756|ref|YP_978980.1| putative integral membrane C-type cytochrome biogenesis protein dipZ [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MVESRRAAAAASAYASRCGIAPATSQRSLATPPTISVPSGEGRCRCHVARGAGRDPRRRLRRRRWCGRCGYHSHLTGGEF
    DVNRLCQQRSRERSCQLVAVPADPRPKRQRITDVLTLALVGFLGGLITGISPCILPVLPVIFFSGAQSVDAAQVAKPEGA
    VAVRRKRALSATLRPYRVIGGLVLSFGMVTLLGSALLSVLHLPQDAIRWAALVALVAIGAGLIFPRFEQLLEKPFSRIPQ
    KQIVTRSNGFGLGLALGVLYVPCAGPILAAIVVAGATATIGLGTVVLTATFALGAALPLLFFALAGQRIAERVGAFRRRQ
    REIRIATGSVTILLAVALVFDLPAALQRAIPDYTASLQQQISTGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTA
    PDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYS
    CINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAK
    GAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPD
    LTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVV
    GGTGTLTVVRDGKPATLPISGPPTTHQVVAGDRLASETLEVRPSKGLQVFSFTYG

    >gi|121638760|ref|YP_978984.1| soluble secreted antigen mpb53 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLSGAPFDGASLQGKPAVLWFWTPWCPFCNAEA
    PSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMS
    QDELSGRVAALTS

    >gi|121638937|ref|YP_979161.1| putative glutaredoxin electron transport component of nrdEF (glutaredoxin-like protein) nrdH [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTA

    >gi|121639001|ref|YP_979225.1| putative molybdenum cofactor biosynthesis protein moeB2 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTEALIPAPSQISLTRDEVRRYSRHLIIPDIGVNGQQRLKDARVLCIGAGGLGSPALLYLAAAGVGTIGIIDGDHVDESN
    LQRQIIHGTSDVGRPKVESAAEAVAEINPHVRVTQYREMLTHDNALEIFGDHDLIVDGTDNFTTRYLINDAAVLAGKPYV
    WGSIYRFNGQTSVFWPGRGPCYRCLHPAPPPPGLVPS
    CAEGGVLGAICATIASIQVTEVLKLLTGVGTPLVGRLLMYEAL
    DATYHQIRIAKNPDCAICGDAPTITELVDDSVSCASTQSVDPELVISCDELRTKQQSDQNFLLVDVREPAEFDIAHIPGS
    ILIPKGEIGSAAGLAQLPLDKEIVLY
    CKSGIRSAQALTTLKAAGLHNVKHLDGGIAEWTRTIDSSLLVY

    >gi|121639002|ref|YP_979226.1| putative thiosulfate sulfurtransferase cysA3 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNL
    IDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAY
    CRIGERSS
    HTWFVLRELLGHQNVNIAFGYGPHACPASAYSRMCLTTFFTSLTQRFPQLQLARPFEDLERRGKGLHSVGIKELLVTWPT


    >gi|121639083|ref|YP_979307.1| putative glutaredoxin protein [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLV
    KIAG

    >gi|121639092|ref|YP_979316.1| molybdopterin biosynthesis-like protein MoeZ [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDFDVVDES
    NLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPY
    VWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPEPPPPGMVPS
    CAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLL
    VYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDSGRKLALIDVRDPVEWDIVHI
    DGAQLIPKSLINSGEGLAKLPQDRTAVLY
    CKTGVRSAEALAAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY

    >gi|121639172|ref|YP_979396.1| putative thiosulfate sulfurtransferase sseA [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MPLPADPSPTLSAYAHPERLVTADWLSAHMGAPGLAIVESDEDVLLYDVGHIPGAVKIDWHTDLNDPRVRDYINGEQFAE
    LMDRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHADVRLLNGGRDLWLAERRETTLDVPTKTCTGYPVVQRNDAPIRA
    FRDDVLAILGAQPLIDVRSPEEYTGKRTHMPDYPEEGALRAGHIPTAVHIPWGKAADESGRFRSREELERLYDFINPDDQ
    TVVY
    CRIGERSSHTWFVLTHLLGKADVRNYDGSWTEWGNAVRVPIVAGEEPGVVPVV

    >gi|121639255|ref|YP_979479.1| putative transposase fusion protein [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MVVVGTDAHKYSHTFVATDEVGRQLGEKTVKATTAGHATAIMWAREQFGLELIWGIEDCRNMSARLERDLLAAGQQVVRV
    PTKLMAQTRKSARSRGKSDPIDALAVARAVLRETDLPLATHDETSRELKLLTDRRDVLVAQRTSAINRLRWLVHELDPER
    APAARSLDAAKHQQALRTWLDTQPGLVAELARAELTDIIRLTGEINTLAQRISARVHQVAPALLEIPGCAELTAAKIVGE
    AAGVTRFKSEAAFACHAAVAPIPVWSGNTAGQMRLSRSGNRQLNAALHRIALTQIRMTDSRGQAYYQRLQDAGKTKRAAL
    RCLKRRLARTVFQALRTVHQPSSEHTQPAAACHRSYCSSHLGEPPRLTDMTQKTRIQPLPPKRAGLLIRALYRIAKRRFG
    EVPEPFTVTAHHRRLLIANVVHEALLQRASRKLPPSVRELAVFWTARSIGCSW
    CVDFGAMLQRLDGLDVDRLTDIDNYAT
    SSKFSDDERAAIAYAEAMTADPHSVTDEQVADLRARFGEAGVIELTYQIGVENMRARMNSALGITEQGFNSGDACRVPWA
    APDVPSAESR

    >gi|121639586|ref|YP_979810.1| putative membrane-anchored thioredoxin-like protein [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPC
    PAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHW
    CAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAA
    ALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG

    >gi|121639645|ref|YP_979869.1| putative transferase [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MFVEYTKSICPVCKVVVDAQVNIRHDKVYLRKRCREHGSFEALVYGDAQMYLESARFNKPGTFPLRFQTEVRDGCPSDCG
    LCPDHKQHACLGLIEVNTHCNLDCPICFADSGHQPDGYAITAAQCERMLDTLVAAEGEPEVVMFSGGEPTIHKQLLEFVD
    AAQARPVKTIIINTNGIRLASDRRFVDQLATRNRPGHPVHIYLQFDGLDEATHRRIRGHDLRDVKQRALDNCAAAGLTVS
    LVAAVERGLNEHELGAVIRHGMAQPGVQSVVFQPVTHAGRHVQFDPLTRLTNSDIIACITAQLPEWFRPGDFFPVPCCFP
    SCRSITYLLTDGEHVVPIPRLLNVEDYLDYVSNRVIPDLAIREALENLWSASAVPGTDTMTAQLQRATAALNCAEGCGIN
    LPEALTHLTDRVFAIVIQDFQDPYTLNVKQLMKCCVQQITPDGRLIPFCAYNSVGYREQVREQLTGVPVPDIVPNAIPLA
    GLLADAPHGSKQANTGGSIARLAGPTRGAPMALPPQQIKACCADAYSRDIVALLLGDSFHPGGATLTRRLADQLGLRSTG
    DPRRVADIAAGPGASARLLASDYGVAVDGVDISEINVKRAQAAVAQTGLTERVRFHLGDAESVPLPDDTFDALVCECAFC
    TFPDKNAAAQQFARILRPGGLAGITDVTVGDGGLPAELTPLAAWVA
    CIADARTVTDYTDILEGAGLRTRHIESHDESLLD
    MIDRIDARITALHVAAPEILADNGIRHDSVRDFTALARAAVQTGRIGYTLMIAEKP

    >gi|121639824|ref|YP_980048.1| putative thioredoxin reductase trxB2 [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTGVENYPGFRNGITGPELMDEMREQ
    ALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSS
    CATCDGFFFRDQDIAV
    IGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLP
    VTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAA
    TGEADSTDALIGAQR

    >gi|121639825|ref|YP_980049.1| thioredoxin trxC [Mycobacterium bovis BCG str. Pasteur 1173P2]
    MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSI
    PTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN