Mycobacterium bovis AF2122 97 uid57695

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|31791270|ref|NP_853763.1| cation transporter P-type ATPase A [Mycobacterium bovis AF2122/97]
    MTAAVTGEHHASVQRIQLRISGMSCSACAHRVESTLNKLPGVRAAVNFGTRVATIDTSEAVDAAALCQAVRRAGYQADLC
    TDDGRSASDPDADHARQLLIRLAIAAVLFVPVADLSVMFGVVPATRFTGWQWVLSALALPVVTWAAWPFHRVAMRNARHH
    AASMETLISVGITAATIWSLYTVFGNHSPIERSGIWQALLGSDAIYFEVAAGVTVFVLVGRYFEARAKSQAGSALRALAA
    LSAKEVAVLLPDGSEMVIPADELKEQQRFVVRPGQIVAADGLAVDGSAAVDMSAMTGEAKPTRVRPGGQVIGGTTVLDGR
    LIVEAAAVGADTQFAGMVRLVEQAQAQKADAQRLADRISSVFVPAVLVIAALTAAGWLIAGGQPDRAVSAALAVLVIACP
    CALGLATPTAMMVASGRGAQLGIFLKGYKSLEATRAVDTVVFDKTGTLTTGRLQVSAVTAAPGWEADQVLALAATVEAAS
    EHSVALAIAAATTRRDAVTDFRAIPGRGVSGTVSGRAVRVGKPSWIGSSSCHPNMRAARRHAESLGETAVFVEVDGEPCG
    VIAVADAVKDSARDAVAALADRGLRTMLLTGDNPESAAAVATRVGIDEVIADILPEGKVDVIEQLRDRGHVVAMVGDGIN
    DGPALARADLGMAIGRGTDVAIGAADIILVRDHLDVVPLALDLARATMRTVKLNMVWAFGYNIAAIPVAAAGLLNPLVAG
    AAMAFSSFFVVSNSLRLRKFGRYPLGCGTVGGPQMTAPSSA

    >gi|31791281|ref|NP_853774.1| cation-transporter P-type ATPase B [Mycobacterium bovis AF2122/97]
    MAAPVVGDADLQSVRRIRLDVSGMSCAACASRVETKLNKIPGVRASVNFATRVATIDAVGMAADELCGVVEKAGYHAAPH
    TETTVLDKRTKDPDGAHARRLLRRLLVAAVLFVPLADLSTLFAIVPSARVPGWGYILTALAAPVVTWAAWPFHSVALRNA
    RHRTTSMETLISVGIVAATAWSLSSVFGDQPPREGSGIWRAILNSDSIYLEVAAGVTVFVLAGRYFEARAKSKAGSALRA
    LAELGAKNVAVLLPDGAELVIPASELKKRQRFVTRPGETIAADGVVVDGSAAIDMSAMTGEAKPVRAYPAASVVGGTVVM
    DGRLVIEATAVGADTQFAAMVRLVEQAQTQKARAQRLADHIAGVFVPVVFVIAGLAGAAWLVSGAGADRAFSVTLGVLVI
    ACPCALGLATPTAMMVASGRGAQLGIFIKGYRALETIRSIDTVVFDKTGTLTVGQLAVSTVTMAGSGTSERDREEVLGLA
    AAVESASEHAMAAAIVAASPDPGPVNGFVAVAGCGVSGEVGGHHVEVGKPSWITRTTPCHDAALVSARLDGESRGETVVF
    VSVDGVVRAALTIADTLKDSAAAAVAALRSRGLRTILLTGDNRAAADAVAAQVGIDSAVADMLPEGKVDVIQRLREEGHT
    VAMVGDGINDGPALVGADLGLAIGRGTDVALGAADIILVRDDLNTVPQALDLARATMRTIRMNMIWAFGYNVAAIPIAAA
    GLLNPLIAGAAMAFSSFFVVSNSLRLRNFGAQ

    >gi|31791315|ref|NP_853808.1| methionine sulfoxide reductase A [Mycobacterium bovis AF2122/97]
    MTSNQKAILAGGCFWGLQDLIRNQPGVVSTRVGYSGGNIPNATYRNHGTHAEAVEIIFDPTVTDYRTLLEFFFQIHDPTT
    KDRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHFVRPG
    WRLPRRTAESALRASLSPELGT

    >gi|31791503|ref|NP_853996.1| ArsR family transcriptional regulator [Mycobacterium bovis AF2122/97]
    MAGQSDRKAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQALKSGGLVEARREGTRQYYR
    IAGEDVARLFALVQVVADEHLADVAVAAADVLGSPEDAITRAELLRRREAGEVTLVDVRPHEEYQAGHIPGAINIPIAEL
    ADRLAELAGDRDIVAY
    CRGAYCVMAPDAVRIARDAGREVKRLDDGMLEWRLAGLPVDEGAPVGHGD

    >gi|31791641|ref|NP_854134.1| dihydrolipoamide dehydrogenase [Mycobacterium bovis AF2122/97]
    MTHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHIFTKDAKAFGISGEVTFDYG
    IAYDRSRKVAEGRVAGVHFLMKKNKITEIHGYGTFADANTLLVDLNDGGTESVTFDNAIIATGSSTRLVPGTSLSANVVT
    YEEQILSRELPKSIIIAGAGAIGMEFGYVLKNYGVDVTIVEFLPRALPNEDADVSKEIEKQFKKLGVTILTATKVESIAD
    GGSQVTVTVTKDGVAQELKAEKVLQAIGFAPNVEGYGLDKAGVALTDRKAIGVDDYMRTNVGHIYAIGDVNGLLQLAHVA
    EAQGVVAAETIAGAETLTLGDHRMLPRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVAD
    AKHGELLGGHLVGHDVAELLPELTLAQRWDLTASELARNVHTHPTMSEALQECFHGLVGHMINF

    >gi|31791690|ref|NP_854183.1| hypothetical protein Mb0520 [Mycobacterium bovis AF2122/97]
    MSRPQVELLTRAGCAICVRVAEQLAELSSELGFDMMTIDVDVAASTGNPGLRAEFGDRLPVVLLDGREHSYWEVDEHRLR
    ADIARSTFGSPPDKRLP

    >gi|31791708|ref|NP_854201.1| thioredoxin protein [Mycobacterium bovis AF2122/97]
    MQSRATRRSGALTMRRLVIAAAVSALLLTGCSGRDAVAQGGTFEFVSPGGKTDIFYDPPASRGRPGPLSGPELADPARSV
    SLDDFPGQVVVVNVWGQW
    CGPCRAEVSQLQRVYDATRGAGVSFLGIDVRDNNRQAPQDFINDRHVTYPSIYDPAMRTLIA
    FGGKYPTSVIPSTLVLDRQHRVAAVFLRELLAADLQPVVERVAEEEPSGRAPVGAQ

    >gi|31791984|ref|NP_854477.1| oxidoreductase [Mycobacterium bovis AF2122/97]
    MTAAQQDQAPMATPGCREGETYDVVVLGAGPVGQNVADRARAGGLRVAVVERELVGGECSYWACVPSKALLRPVIAISDA
    RRVDGAREAVDGSINTAGVFGRRNRYVAHWDDTGQADWVSGIGATLIRGDGRLDGPRRVVVTKSSGESVALTARHAVVIC
    TGSRPALPDLPGITEARPWTNRQATDNSTVPDRLAIVGAGGVGVEMATAWQGLGASVTLLARGSGLLPRMEPFVGELIGR
    GLADAGVDVRVGVSVRALGRPNPLAQWSSSWTTVPSCGSTRYSSPPAEHREPTTSAWRQ

    >gi|31792003|ref|NP_854496.1| thiosulfate sulfurtransferase CysA2 [Mycobacterium bovis AF2122/97]
    MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNL
    IDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAY
    CRIGERSS
    HTWFVLRELLGHQNVKNYDGSWTEYGSLVGAPIELGS

    >gi|31792004|ref|NP_854497.1| thioredoxin ThiX [Mycobacterium bovis AF2122/97]
    MTTMIVASVATGALATIARWLLTRRSVILREVGPETTPAAPARTAELGLSGAGPTVVHFRAPGCAPCDRVRRGVGDVCAD
    LGDVAHIEVDLDSNPQAARRFSVLSLPTTLIFDVDGRQRYRTSGVPKAADLRSALKPLLA

    >gi|31792275|ref|NP_854768.1| hypothetical protein Mb1113 [Mycobacterium bovis AF2122/97]
    MSPANPSGTNTLALATSPYLRQHADNPVHWQQWTPQALAEAAARAVPILLSVGYAACHWCHVMAHESFDDDEVAAAMNAG
    FVCIKVDREERPDIDAVYMNATVALTGQGGWPMTCFLTPNGRPFFCGTYYPKAAFLQLLSAISETWRERRAEVEQASDHI
    AAELRSMASGLPGGGPEVAPELCDDAVAGVLREQDTAHGGFGGAPKFPPSALLEALMRHYERTRSPAALEAVARTGNAMA
    RGGIYDQLGGGFARYSVDGAWVVPHFEKMLYDNALLLRAYAHWARRTGDPLARRVAAQTARFLLDELGSKAPADMFTSSL
    DADADGREGSTYVWTPVQLTEVLGGDDGRWAAEVFGVTEAGTFEHGTSVLQLPADPDDAARLDRVRAALLVARLARAQPA
    RDDKVVTSWNGLAITALAEASVALDDPALAHAARRCATRLLDLHVVDGRLRRASLGGVVGDSAAILEDHAMLATGLLALY
    QLTSEGAWLTAATGLLDTAVAHFGDPQRPGRWFDTADDAERLMLRPSDPLDGATPSGASSIAEALLTAGHVVDGARAERY
    WQLAADTLRAHAVLLARAPRSAGHWLAVAEAVVRGPLQIAVACDLPRSSLLADARRLAPGGAIVVGGAAGSSALLVGRDR
    VAGADAAYVCRGRVCDLPVTSAAELATALGVPG

    >gi|31792510|ref|NP_855003.1| methylated-DNA--protein-cysteine methyltransferase [Mycobacterium bovis AF2122/97]
    MIHYRTIDSPIGPLTLAGHGSVLTNLRMLEQTYEPSRTHWTPDPGAFSGAVDQLNAYFAGELTEFDVELDLRGTDFQQRV
    WKALLTIPYGETRSYGEIADQIGAPGAARAVGLANGHNPIAIIVP
    CHRVIGASGKLTGYGGGINRKRALLELEKSRAPAD
    LTLFD

    >gi|31792520|ref|NP_855013.1| thioredoxin [Mycobacterium bovis AF2122/97]
    MTRPRPPLGPAMAGAVDLSGIKQRAQQNAAASTDADRALSTPSGVTEITEANFEDEVIVRSDEVPVVVLLWSPRSEVCVD
    LLDTLSGLAAAAKGKWSLASVNVDVAPRVAQIFGVQAVPTVVALAAGQPISSFQGLQPADQLSRWVDSLLSATAGKLKGA
    ASSEESTEVDPAVAQARQQLEDGDFVAARKSYQAILDANPGSVEAKAAIRQIEFLIRATAQRPDAVSVADSLSDDIDAAF
    AAADVQVLNQDVSAAFERLIALVRRTSGEERTRVRTRLIELFELFDPADPEVVAGRRNLANALY

    >gi|31792664|ref|NP_855157.1| thioredoxin TRXA [Mycobacterium bovis AF2122/97]
    MTTRDLTAAYFQQTISANSNVLVYFWAPLCAPCDLFTPTYEASSRKHFDVVHGKVNIETEKDLASIAGVKLLPTLMAFKK
    GKLVFKQAGIANPAIMDNLVQQLRAYTFKSPAGEGIGPGTKTSS

    >gi|31792665|ref|NP_855158.1| thioredoxin TRXB1 [Mycobacterium bovis AF2122/97]
    MTTRDLTAAQFNETIQSSDMVLVDYWASWCGPCRAFAPTFAESSEKHPDVVHAKVDTEAERELAAAAQIRSIPTIMAFKN
    GKLLFNQAGALPPAALESLVQQLKAYEVEAGEATTQNGRAQQA

    >gi|31792794|ref|NP_855287.1| peroxidoxin bcpB [Mycobacterium bovis AF2122/97]
    MKTGDTVADFELPDQTGTPRRLSVLLSDGPVVLFFYPAAMTPGCTKEACHFRDLAKEFAEVRASRVGISTDPVRKQAKFA
    EVRRFDYPLLSDAQGTVAAQFGVKRGLLGKLMPVKRTTFVIDTDRKVLDVISSEFSMDAHADKALATLRAIRSG

    >gi|31792860|ref|NP_855353.1| transcriptional regulatory protein [Mycobacterium bovis AF2122/97]
    MSGAKKLIFEQFALVGQALSSGHRLELLDLLVQGERSVDALARASGLTFANASQHLLQLRRAGLVTSRRDGKRVIYALSD
    PQVWDVVRAVRAVAERNLASVGSLVRQYYTDRDSLEPISRDELQARVAAGSVLVLDVRPAMEYAAGHLPGAVSIPLDELA
    ERLDELPSGIDIVA
    CCRGPYCVYAYDALELLRPNGFSARRLDGGFSEWLAADLPVVRT

    >gi|31792862|ref|NP_855355.1| hypothetical protein Mb1703 [Mycobacterium bovis AF2122/97]
    MACPEWEISRSKRTRKPVLRPRHSVSTLTNRFLAEFCHRYGIGVPTRLARGATVPTRRLQDINDQPVDVPAATGRTHLQF
    RRFAA
    CPICHLHLRSFANRHQEVADSGITEVVFFHSAADALRGYQSLLPFAVIADPDRVQYREFGVEKSLGAITHPRALW
    AAVRGSAAMLHRNDPERAGVGFGDGTTHLGLPADFLLDADGTVAAVHYGRHADDQWSVDQLIDINRSLGGKGTQ

    >gi|31792863|ref|NP_855356.1| lipoprotein DsbF [Mycobacterium bovis AF2122/97]
    MTHSRLIGALTVVAIIVTACGSQPKSQPAVAPTGDAAAATQVPAGQTVPAQLQFSAKTLDGHDFHGESLLGKPAVLWFWA
    PW
    CPTCQGEAPVVGQVAASHPEVTFVGVAGLDQVPAMQEFVNKYPVKTFTQLADTDGSVWANFGVTQQPAYAFVDPHGNV
    DVVRGRMSQDELTRRVTALTSR

    >gi|31792920|ref|NP_855413.1| hypothetical protein Mb1761c [Mycobacterium bovis AF2122/97]
    MAVESSMLALGTPAPSFTLPQPATGATVSLDELTGPALVVTFICNHCPYVQHVAAGLATLGRDLADQGVPMVGISSNDVV
    TYPQDGPDQMVAEARRHGWTFPYLYDETQDVARAFSAACTPDTFVFDGQRRLVYRGQLDDSRPGNGRPVTAADVRAAVDA
    LLAGRPVNPDQRPSIGCGIKWR

    >gi|31792956|ref|NP_855449.1| hypothetical protein Mb1796 [Mycobacterium bovis AF2122/97]
    MSDQPRHHQVLDDLLPQHRALRHQIPQVYQRFVALGDAALTDGALSRKVKELVALAIAVVQGCDGCVASHAQAAVRAGAT
    AQEAAEAIGVTILMHGGPATIHGARAYAAFCEFADTTPS

    >gi|31793124|ref|NP_855617.1| thiol peroxidase [Mycobacterium bovis AF2122/97]
    MAQITLRGNAINTVGELPAVGSPAPAFTLTGGDLGVISSDQFRGKSVLLNIFPSVDTPVCATSVRTFDERAAASGATVLC
    VSKDLPFAQKRFCGAEGTENVMPASAFRDSFGEDYGVTIADGPMAGLLARAIVVIGADGNVAYTELVPEIAQEPNYEAAL
    AALGA

    >gi|31793383|ref|NP_855876.1| hypothetical protein Mb2227c [Mycobacterium bovis AF2122/97]
    MTVQNEPSAKTHGVILTEAAAAKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRTLDGDQTAEFGGVRLIVDRMS
    APYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|31793418|ref|NP_855911.1| peroxiredoxin AhpE [Mycobacterium bovis AF2122/97]
    MLNVGATAPDFTLRDQNQQLVTLRGYRGAKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAALAISVGPPPTHKIW
    ATQSGFTFPLLSDFWPHGAVSQAYGVFNEQAGIANRGTFVVDRSGIIRFAEMKQPGEVRDQRLWTDALAALTA

    >gi|31793438|ref|NP_855931.1| transcriptional regulator [Mycobacterium bovis AF2122/97]
    MSGALETTEEFGNRFVAAIDSAGLAILVSVGHQTGLLDTMAGLPPATSMEIAEAAGLEERYVREWLGGMTTGQIVEYDAG
    SSTYSLPAHRAGMLTRAAGPDNLAVIAQFVSLLGEVEQKVIRCFREGGGVPYSEYPRFHKLMAEMSGMVFDAALIDVVLP
    LVDGLPDRLRSGADVADFGCGSGRAVKLMAQAFGASRFTGIDFSDEAVAAGTEEAARLGLANATFERHDLAELDKVGAYD
    VITVFDAIHDQAQPARVLQNIYRALRPGGVLLMVDIKASSQLEDNVGVPLSTYLYTTSLMH
    CMTVSLALDGAGLGTVWGR
    QLATSMLADAGFTDVTVAEIESDVLNNYYIARK

    >gi|31793464|ref|NP_855957.1| hypothetical protein Mb2308c [Mycobacterium bovis AF2122/97]
    MTTVDFHFDPLCPFAYQTSVWIRDVRAQLGITINWRFFSLEEINLVAGKKHPWERDWSYGWSLMRIGALLRRTNMSLLDR
    WYAAIGHELHTLGGKPHDPAVARRLLCDVGVNAAILDAALDDPTTHDDVRADH

    >gi|31793470|ref|NP_855963.1| thiosulfate sulfurtransferase SseB [Mycobacterium bovis AF2122/97]
    MRWRLDEPDGHAAYLQGHLPGAVFVSLEDELSDHTIAGRGRHPLPSGASLQATVRRCGIRHDVPVVVYDDWNRAGSARAW
    WVLTAAGIANVRILDGGLPAWRSAGGSIETGQVSPQLGNVTVLHDDLYAGQRLTLTAQQAGAGGVTLLDARVPERFRGDV
    EPVDAVAGHIPGAINVPSGSVLADDGTFLGNGALNALLSDHGIDHGGRVGVY
    CGSGVSAAVIVAALAVIGQDAALFPGSW
    SEWSSDPTRPVGRGTA

    >gi|31793608|ref|NP_856101.1| alkyl hydroperoxide reductase subunit C [Mycobacterium bovis AF2122/97]
    MPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDA
    QILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDE
    VLRVLDALQSDELCACNWRKGDPTLDAGELLKASA

    >gi|31793647|ref|NP_856140.1| hypothetical protein Mb2493c [Mycobacterium bovis AF2122/97]
    MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQYREGMARAWGPVRVAIAAEQ
    AHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNG
    VAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQFD

    >gi|31793702|ref|NP_856195.1| bacterioferritin comigratory protein BCP [Mycobacterium bovis AF2122/97]
    MTKTTRLTPGDKAPAFTLPDADGNNVSLADYRGRRVIVYFYPAASTPGCTKQACDFRDNLGDFTTAGLNVVGISPDKPEK
    LATFRDAQGLTFPLLSDPDREVLTAWGAYGEKQMYGKTVQGMIRSTFVVDEDGKIVVAQYNVKATGHVAKLRRDLSV

    >gi|31793846|ref|NP_856339.1| hypothetical protein Mb2693 [Mycobacterium bovis AF2122/97]
    MTRPKLELSDDEWRQKLTPQEFHVLRRAGTERPFTGEYTDTTTAGIYQCRACGAELFRSTEKFESHCGWPSFFDPKSSDA
    VTLRPDHSLGMTRTEVLCANCDSHLGHVFAGEGYPTPTDKRY
    CINSISLRLVPGSV

    >gi|31793885|ref|NP_856378.1| soluble pyridine nucleotide transhydrogenase [Mycobacterium bovis AF2122/97]
    MREYDIVVIGSGPGGQKAAIASAKLGKSVAIVERGRMLGGVCVNTGTIPSKTLREAVLYLTGMNQRELYGASYRVKDRIT
    PADLLARTQHVIGKEVDVVRNQLMRNRVDLIVGHGRFIDPHTILVEDQARREKTTVTGDYIIIATGTRPARPSGVEFDEE
    RVLDSDGILDLKSLPSSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDNMLDFCDPEVVEALKFHLRDLAVTFRFGEEVT
    AVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAGLEVQGRGRIFVDDRFQTKVDHIYAVGDVIGFPALAAT
    SMEQGRLAAYHAFGEPTDGITELQPIGIYSIPEVSYVGATEVELTKSSIPYEVGVARYRELARGQIAGDSYGMLKLLVST
    EDLKLLGVHIFGTSATEMVHIGQAVMGCGGSVEYLVDAVFNYPTFSEAYKNAALDVMNKMRALNQFRR

    >gi|31794032|ref|NP_856525.1| mycothione reductase [Mycobacterium bovis AF2122/97]
    METYDIAIIGTGSGNSILDERYASKRAAICEQGTFGGTCLNVGCIPTKMFVYAAEVAKTIRGASRYGIDAHIDRVRWDDV
    VSRVFGRIDPIALSGEDYRRCAPNIDVYRTHTRFGPVQADGRYLLRTDAGEEFTAEQVVIAAGSRPVIPPAILASGVDYH
    TSDTVMRIAELPEHIVIVGSGFIAAEFAHVFSALGVRVTLVIRGSCLLRHCDDTICERFTRIASTKWELRTHRNVVDGQQ
    RGSGVALRLDDGCTINADLLLVATGRVSNADLLDAEQAGVDVEDGRVIVDEYQRTSARGVFALGDVSSPYLLKHVANHEA
    RVVQHNLLCDWEDTQSMIVTDHRYVPAAVFTDPQIAAVGLTENQAVAKGLDISVKIQDYGDVAYGWAMEDTSGIVKLITE
    RGSGRLLGAHIMGYQASSLIQPLIQAMSFGLTAAEMARGQYWIHPALPEVVENALLGLR

    >gi|31794051|ref|NP_856544.1| integral membrane C-type cytochrome biogenesis protein DipZ [Mycobacterium bovis AF2122/97]
    MVESRRAAAAASAYASRCGIAPATSQRSLATPPTISVPSGEGRCRCHVARGAGRDPRRRLRRRRWCGRCGYHSHLTGGEF
    DVNRLCQQRSRERSCQLVAVPADPRPKRQRITDVLTLALVGFLGGLITGISPCILPVLPVIFFSGAQSVDAAQVAKPEGA
    VAVRRKRALSATLRPYRVIGGLVLSFGMVTLLGSALLSVLHLPQDAIRWAALVALVAIGAGLIFPRFEQLLEKPFSRIPQ
    KQIVTRSNGFGLGLALGVLYVPCAGPILAAIVVAGATATIGLGTVVLTATFALGAALPLLFFALAGQRIAERVGAFRRRQ
    REIRIATGSVTILLAVALVFDLPAALQRAIPDYTASLQQQISTGTEIREQLNLGGIVNAQNAQLSNCSDGAAQLESCGTA
    PDLKGITGWLNTPGNKPIDLKSLRGKVVLIDFWAYS
    CINCQRAIPHVVGWYQAYKDSGLAVIGVHTPEYAFEKVPGNVAK
    GAANLGISYPIALDNNYATWTNYRNRYWPAEYLIDATGTVRHIKFGEGDYNVTETLVRQLLNDAKPGVKLPQPSSTTTPD
    LTPRAALTPETYFGVGKVVNYGGGGAYDEGSAVFDYPPSLAANSFALRGRWALDYQGATSDGNDAAIKLNYHAKDVYIVV
    GGTGTLTVVRDGKPATLPISGPPTTHQVVAGDRLASETLEVRPSKGLQVFSFTYG

    >gi|31794055|ref|NP_856548.1| soluble secreted antigen mpb53 [Mycobacterium bovis AF2122/97]
    MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLSGAPFDGASLQGKPAVLWFWTPWCPFCNAEA
    PSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMS
    QDELSGRVAALTS

    >gi|31794231|ref|NP_856724.1| glutaredoxin electron transport protein NrdH [Mycobacterium bovis AF2122/97]
    MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTA

    >gi|31794295|ref|NP_856788.1| molybdenum cofactor biosynthesis protein MoeB [Mycobacterium bovis AF2122/97]
    MTEALIPAPSQISLTRDEVRRYSRHLIIPDIGVNGQQRLKDARVLCIGAGGLGSPALLYLAAAGVGTIGIIDGDHVDESN
    LQRQIIHGTSDVGRPKVESAAEAVAEINPHVRVTQYREMLTHDNALEIFGDHDLIVDGTDNFTTRYLINDAAVLAGKPYV
    WGSIYRFNGQTSVFWPGRGPCYRCLHPAPPPPGLVPS
    CAEGGVLGAICATIASIQVTEVLKLLTGVGTPLVGRLLMYEAL
    DATYHQIRIAKNPDCAICGDAPTITELVDDSVSCASTQSVDPELVISCDELRTKQQSDQNFLLVDVREPAEFDIAHIPGS
    ILIPKGEIGSAAGLAQLPLDKEIVLY
    CKSGIRSAQALTTLKAAGLHNVKHLDGGIAEWTRTIDSSLLVY

    >gi|31794296|ref|NP_856789.1| thiosulfate sulfurtransferase CysA3 [Mycobacterium bovis AF2122/97]
    MARCDVLVSADWAESNLHAPKVVFVEVDEDTSAYDRDHIAGAIKLDWRTDLQDPVKRDFVDAQQFSKLLSERGIANEDTV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRPLSSDPVSRPVTSYTASPPDNTIRAFRDEVLAAINVKNL
    IDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSRAANEDGTFKSDEELAKLYADAGLDNSKETIAY
    CRIGERSS
    HTWFVLRELLGHQNVNIAFGYGPHACPASAYSRMCLTTFFTSLTQRFPQLQLARPFEDLERRGKGLHSVGIKELLVTWPT


    >gi|31794375|ref|NP_856868.1| glutaredoxin protein [Mycobacterium bovis AF2122/97]
    MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVKFADGSTLTNPSADEVKAKLV
    KIAG

    >gi|31794383|ref|NP_856876.1| molybdopterin biosynthesis-like protein MoeZ [Mycobacterium bovis AF2122/97]
    MSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDFDVVDES
    NLQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPY
    VWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPEPPPGMVPS
    CAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLV
    YDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDSGRKLALIDVRDPVEWDIVHID
    GAQLIPKSLINSGEGLAKLPQDRTAVLY
    CKTGVRSAEALAAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY

    >gi|31794463|ref|NP_856956.1| thiosulfate sulfurtransferase SseA [Mycobacterium bovis AF2122/97]
    MPLPADPSPTLSAYAHPERLVTADWLSAHMGAPGLAIVESDEDVLLYDVGHIPGAVKIDWHTDLNDPRVRDYINGEQFAE
    LMDRKGIARDDTVVIYGDKSNWWAAYALWVFTLFGHADVRLLNGGRDLWLAERRETTLDVPTKTCTGYPVVQRNDAPIRA
    FRDDVLAILDAQPLIDVRSPEEYTGKRTHMPDYPEEGALRAGHIPTAVHIPWGKAADESGRFRSREELERLYDFINPDDQ
    TVVY
    CRIGERSSHTWFVLTHLLGKADVRNYDGSWTEWGNAVRVPIVAGEEPGVVPVV

    >gi|31794512|ref|NP_857005.1| transposase [Mycobacterium bovis AF2122/97]
    MVVVGTDAHKYSHTFVATDEVGRQLGEKTVKATTAGHATAIMWAREQFGLELIWGIEDCRNMSARLERDLLAAGQQVVRV
    PTKLMAQTRKSARSRGKSDPIDALAVARAVLRETDLPLATHDETSRELKLLTDRRDVLVAQRTSAINRLRWLVHELDPER
    APAARSLDAAKHQQALRTWLDTQPGLVAELARAELTDIIRLTGEINTLAQRISARVHQVAPALLEIPGCAELTAAKIVGE
    AAGVTRFKSEAAFACHAAVAPIPVWSGNTAGQMRLSRSGNRQLNAALHRIALTQIRMTDSRGQAYYQRLQDAGKTKRAAL
    RCLKRRLARTVFQALRTVHQPSSEHTQPAAACHRSYCSSHLGEPPRLTDMTQKTRIQPLPPKRAGLLIRALYRIAKRRFG
    EVPEPFTVTAHHRRLLIANVVHEALLQRASRKLPPSVRELAVFWTARSIGCSW
    CVDFGAMLQRLDGLDVDRLTDIDNYAT
    SSKFSDDERAAIAYAEAMTADPHSVTDEQVADLRARFGEAGVIELTYQIGVENMRARMNSALGITEQGFNSGDACRVPWA
    APDVPSAESR

    >gi|31794843|ref|NP_857336.1| membrane-anchored thioredoxin-like protein [Mycobacterium bovis AF2122/97]
    MPSLPTTPAETAMTTLTGKTRWTIAILAVVAALMAALVAQLHDYSASSTISQRPAPREHRDGDTPEALAWSRQRANLPPC
    PAAGNGPGAAALRGVVVVCAGDGSAVDVARALAGRRVVINLWAHW
    CAPCMTELPVMAEYQRRVGPAVLVVTVHQGQNEAA
    ALSRLADLGVRLPTLQDDRRRVAAALRVANVMPATVVLRPDGSVAQTLPRAFGSADEIVAAVGNDAG

    >gi|31794901|ref|NP_857394.1| transferase [Mycobacterium bovis AF2122/97]
    MFVEYTKSICPVCKVVVDAQVNIRHDKVYLRKRCREHGSFEALVYGDAQMYLESARFNKPGTFPLRFQTEVRDGCPSDCG
    LCPDHKQHACLGLIEVNTHCNLDCPICFADSGHQPDGYAITAAQCERMLDTLVAAEGEPEVVMFSGGEPTIHKQLLEFVD
    AAQARPVKTIIINTNGIRLASDRRFVDQLATRNRPGHPVHIYLQFDGLDEATHRRIRGHDLRDVKQRALDNCAAAGLTVS
    LVAAVERGLNEHELGAVIRHGMAQPGVQSVVFQPVTHAGRHVQFDPLTRLTNSDIIACITAQLPEWFRPGDFFPVPCCFP
    SCRSITYLLTDGEHVVPIPRLLNVEDYLDYVSNRVIPDLAIREALENLWSASAVPGTDTMTAQLQRATAALNCAEGCGIN
    LPEALTHLTDRVFAIVIQDFQDPYTLNVKQLMKCCVQQITPDGRLIPFCAYNSVGYREQVREQLTGVPVPDIVPNAIPLA
    GLLADAPHGSKQANTGGSIARLAGPTRGAPMALPPQQIKACCADAYSRDIVALLLGDSFHPGGATLTRRLADQLGLRSTG
    DPRRVADIAAGPGASARLLASDYGVAVDGVDISEINVKRAQAAVAQTGLTERVRFHLGDAESVPLPDDTFDALVCECAFC
    TFPDKNAAAQQFARILRPGGLAGITDVTVGDGGLPAELTPLAAWVA
    CIADARTVTDYTDILEGAGLRTRHIESHDESLLD
    MIDRIDARITALHVAAPEILADNGIRHDSVRDFTALARAAVQTGRIGYTLMIAEKP

    >gi|31795086|ref|NP_857579.1| thioredoxin reductase TRXB2 [Mycobacterium bovis AF2122/97]
    MTAPPVHDRAHHPVRDVIVIGSGPAGYTAALYAARAQLAPLVFEGTSFGGALMTTTGVENYPGFRNGITGPELMDEMREQ
    ALRFGADLRMEDVESVSLHGPLKSVVTADGQTHRARAVILAMGAAARYLQVPGEQELLGRGVSS
    CATCDGFFFRDQDIAV
    IGGGDSAMEEATFLTRFARSVTLVHRRDEFRASKIMLDRARNNDKIRFLTNHTVVAVDGDTTVTGLRVRDTNTGAETTLP
    VTGVFVAIGHEPRSGLVREAIDVDPDGYVLVQGRTTSTSLPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAA
    TGEADSTDALIGAQR

    >gi|31795087|ref|NP_857580.1| thioredoxin trxC (TRX) (MPT46) [Mycobacterium bovis AF2122/97]
    MTDSEKSATIKVTDASFATDVLSSNKPVLVDFWATWCGPCKMVAPVLEEIATERATDLTVAKLDVDTNPETARNFQVVSI
    PTLILFKDGQPVKRIVGAKGKAALLRELSDVVPNLN