Mycobacterium avium paratuberculosis K 10 uid57699

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|41406499|ref|NP_959335.1| hypothetical protein MAP0401 [Mycobacterium avium subsp. paratuberculosis K-10]
    MPIPRPTLTRKVRWHIAILTVVVALIVALLAQLRDDAATPGPPATGRAVADREHRDADTPAALAGPRQRADLPPCPAAGT
    GPGPAALRGVTAECAADGSVVDAGRAVAGRRVVLNFWAYW
    CAPCAAELPAMAEYQRRAGAEVTVLTVHQDENETAALLRL
    AELGVRLPTLQDGRRRVAAALRVVNVMPATVVLRPDGSVAQTLPRAFSTADEIAAAIGNDRG

    >gi|41406743|ref|NP_959579.1| CysA3 [Mycobacterium avium subsp. paratuberculosis K-10]
    MARSDVRVSTDWAESNLDTPGVVFVEVDEDTSAYHAGHIPGAIKLDWRSDLQDPVKRDFVDAQQFSKLLSERGIANDDTV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRTLSSDPVSRPATSYTAAAPDNSIRAFRDEVIAAINVKNL
    VDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSKAANEDGTFKSDEELAALYAAAGLDTGKETIAY
    CRIGERSS
    HTWFVLYELLGHRNVKNYNGSWTEYGSLVGAPIELGS

    >gi|41406745|ref|NP_959581.1| ThiX [Mycobacterium avium subsp. paratuberculosis K-10]
    MTTLVVIFAVLAAATLAGWLLTRRSRRIREIDAGPQRDTGDDVAALGLSRDGPTVVHFSAPWCGPCDRVRRVVDQVCADL
    GGVAHVEIDLDAHPDTARRYAVLSLPTTLIFDADGRQRYRSSGVPGAADLRSALKPLLA

    >gi|41407080|ref|NP_959916.1| ArsC [Mycobacterium avium subsp. paratuberculosis K-10]
    MAQGATIYHNPRCSTSRKTLELLRDNGFEPNIVEYLKTPPSRAELVKMIRDAGIDVRTAVRKRESLYDELNLAEASDEQL
    LDAMIEHPILIERPFVVTPKGTRLARPIDAVREIL

    >gi|41407294|ref|NP_960130.1| hypothetical protein MAP1196 [Mycobacterium avium subsp. paratuberculosis K-10]
    MTTVDLTAEKFNETIEGNDIVLVDFWASWCGPCRQFGPTFQASSEKHPDIVHAKVDTEAEQQLAAAAQIRSIPTLMAFKK
    GKLLFNQPGALPPAALEDLVQQVRAFDVDAAIAEQGE

    >gi|41407400|ref|NP_960236.1| BcpB [Mycobacterium avium subsp. paratuberculosis K-10]
    MARPARGCNATANSRPIFRRGVTTGGGARSVSPMKPGDTVADFELPDQTGTPRKLSDLLAAGPVVLFFYPAAMTPGCTKE
    ACHFRDLAAEFAAVGANRVGISADPVDKQAKFADLQKFDYPLLSDTDGAVAAQFGVKRGLLSKLLPVKRTTFVIDTDRTV
    LDVISSEFNMDTHADKALATLRARA

    >gi|41407686|ref|NP_960522.1| AhpD [Mycobacterium avium subsp. paratuberculosis K-10]
    MSVENLKEALPEYAKDLKLNLGSITRTTELNEEQLWGTLLASAAATRNTQVLTEIGAEAADTLSAEAYHAALGAASVMAM
    NNVFYRGRGFLDGKYDDLRAGLRMNIIGNPGVEKANFELWCFAVSAINGCPD
    CVASHEHTLREAGVSRETIQEALKAAAI
    ISGVAQAIVASQTLATAG

    >gi|41407687|ref|NP_960523.1| hypothetical protein MAP1589c [Mycobacterium avium subsp. paratuberculosis K-10]
    MPLLTIGDQFPAYELTALIAGDLSKVDAKQPGDYFTTVTSEDHAGKWRVVFFWPKDFTFVCPTEIATFGKLNDEFEDRDA
    QVLGVSIDSEFVHFNWRAQHEDLKNLPFPMLSDIKRELSLATGVLNADGVADRATFIVDPNNEIQFVSVTAGSVGRNVEE
    VLRVLDALQSDELCACNWRKGDPTLNATELLKASA

    >gi|41407751|ref|NP_960587.1| thiol peroxidase [Mycobacterium avium subsp. paratuberculosis K-10]
    MAQITLRGNPINTVGELPSVGSKAPAFSLTGGDLSPVTSDQFSGKPLVLNIIPSIDTPVCATSVRTFNERAAGAGATVLN
    VSKDLPFAQARFCGAEGIENVKTASAFRDSFGDDYGVTIADGPMAGLLARAIVVVGADGNVAYTELVPEIAQEPNYDAAL
    AAAG

    >gi|41407857|ref|NP_960693.1| hypothetical protein MAP1759c [Mycobacterium avium subsp. paratuberculosis K-10]
    MTDALVIDAEGLDRLSCNAKANPETGKKTLKAKTVCEKGFRNMTYVRGLAPMLVGEPPALLGDDSAPNPSETALAALGSC
    VSVGLLANATHRGVTLTKIEVEMEADIDISAVWGVGDTPPGKRLGFSAVRCTVSLAGDADEATLKEIHDNAIAWSPVVNT
    FRNPVSVDSTLVTG

    >gi|41407942|ref|NP_960778.1| mercuric reductase [Mycobacterium avium subsp. paratuberculosis K-10]
    MTKHFDAIIVGAGQAGPPLAGRLTAAGQRVAIIERKLIGGTCVNTGCIPTKTLVASAHAAHLARRGADYGVGTGAVSVDM
    AKVKARKDEIMLGDRKGVEDWLAGMAGCTVVRGHARFRDPHTLQVGEDLLRAERIFLNVGGRAVVPDIPGLAEVDFLTNV
    SILELDTLPTHLVIVGGSYIALEFAQMYRRFGAAVTVVERGPRLASREDEDVSAAVQEILRAEGIDIVVNADDVRIAKTG
    NGFELTPRDGAPPIRGSHLLLAVGRRPNTDDLDLAAAGVRTDARGYILVDDQLKTNVEHIWAMGDCNGRGAFTHTSYNDF
    EIVAANLLDDDPRRVSDRITTYALYIDPPLGRAGMTVAQVRASGRRALVGKRPMTRVGRAVEKGETQGFMKVVVDADTRE
    ILGAAILGVGGDEAIHGILDVMSAKAPYTTLSRTMHIHPTVSELIPTMLQEMSPLA

    >gi|41408042|ref|NP_960878.1| hypothetical protein MAP1944c [Mycobacterium avium subsp. paratuberculosis K-10]
    MRHVGEAMTVQNESNAKTHGVILTEAAATKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRSLDGDLTAEFGGVT
    LTVDRMSAPYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|41408089|ref|NP_960925.1| AhpE [Mycobacterium avium subsp. paratuberculosis K-10]
    MLSVGTPAPDFTLRDQNQQRVTLSSYRGSKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAVLAISVGPPPTHRIW
    ALESGFTFPVLSDFWPHGAVSQSYGVFNDEAGYSNRGTFVVDRSGIIRFAEMKQPGESRDQRLWTDALAALKA

    >gi|41408144|ref|NP_960980.1| SseB [Mycobacterium avium subsp. paratuberculosis K-10]
    MGARDQVLITATELADVIEAGDPVSILDVRWRLDEPDGRAAYLQGHLPDAVYVSLEDELSDHTVSGRGRHPLPSGPSLQA
    AARRWGIRQDTPVVVYDDWNRAGSARAWWLLRAAGLDNVRILDGGLAAWRATGGRLVSGPVEPVPGNVTVPHGDLHSGNR
    PTVTTEQVAAGAATLIDARAPERYRGEMEPLDPVAGHIPGAENLPSGEVLAADGTFLGDDALARVFAEHRIERHGAVAAY
    CGSGVTATVTIAALAAVGRTAALYPGSWSEWCADPARPVERGGA

    >gi|41408263|ref|NP_961099.1| hypothetical protein MAP2165 [Mycobacterium avium subsp. paratuberculosis K-10]
    MSRLPGVSDRDAGLGARIAFFFTRRKLAQMTGLETAGMLEPLRMYAHIPRLLNAYGRLEQAESRLDILSPRHRALAELKA
    ATTVRCEY
    CIDLGSQIARRWGITDEELLAMADYRDAACFSDVDKLILEYATAISRTPVEVSDELFDALRAHFDTAQLVGL
    THVITLGNLRARFNIALGIGSSGFSGNRVCALPDTPRP

    >gi|41408384|ref|NP_961220.1| hypothetical protein MAP2286c [Mycobacterium avium subsp. paratuberculosis K-10]
    MAQQAPAKNKADFWFDPLCPWAWITSRWILEVEKVRDIEVNFHVMSLAVLNENREGLPDEYRERLAKAFGPVRVAIAAEQ
    AHGAKVLAPLYTAMGTRIHNEGNKDLTDVIKQSLAEVGLPAELAEAADTDAYDDALRKSHHAGMDPVGDDVGTPTIHVND
    VAFFGPVLSRIPRGEEAGKLWDASVTFASYPHFFELKRTRDEKPEFD

    >gi|41408427|ref|NP_961263.1| hypothetical protein MAP2329 [Mycobacterium avium subsp. paratuberculosis K-10]
    MNRKGLTLTETTRLAPGDKAPAFSLPDADGKTVKLSDFKGRKVIVYFYPAASTPGCTKQACDFRDSLAELNGAGLDVVGI
    SPDKPEKLAKFRDAEKLTFPLLSDPDRTVLTAYGAYGEKQMYGKTVTGVIRSTFVVDEKGRIAVAQYNVKATGHVAKLRR
    DLSV

    >gi|41408533|ref|NP_961369.1| hypothetical protein MAP2435c [Mycobacterium avium subsp. paratuberculosis K-10]
    MTRPRPSIGPALAGAVDLSGLKQRAQAASGPAGGPAPADGGPGISAVTEANFEAEVLIRSEEVPVVVLLWSPRSDACVQL
    LDTLSGLAAQDNGKWSLATVNVDVAPRVAQIFGVDAVPTVVALAAGQPISSFQGMQPADQLRGWLDQILSATAGKLKGAT
    GSAESEAVDPELAAARQQLEAGDFEAARTSYQAILDANPASTEAKGAIRQIDFLTRATAQRPDAVAVADAAPGDIDAAFA
    AADVQILNQDVGAAFDRLIALVRNTSGDDRARVRTRLVELFDLFDPADPEVVAGRRNLANALY

    >gi|41408543|ref|NP_961379.1| Ogt [Mycobacterium avium subsp. paratuberculosis K-10]
    MIEYRTVDSPIGLLTLAGRDPVLTNLRMVDQTYEPSRTGWTENPRAFAGAVEQLGAYFAGELTEFDIELDLRGSEFQRRV
    WRALQTIPYGETRSYGEIAEQIGAPGAARAVGLANGHNPIAIVVP
    CHRVIGASGKLTGYGGGLDRKQTLLALERRHSPAS
    LTLFD

    >gi|41408804|ref|NP_961640.1| hypothetical protein MAP2706c [Mycobacterium avium subsp. paratuberculosis K-10]
    MSPADPSATNTLGRATSPYLRQHADNPVHWQQWTPQALADAAARDVPILLSVGYAACHWCHVMAHESFEDPDVAAAMNSG
    FVCVKVDREERPDIDAVYMNATVALTGHGGWPMTCFLTPDGRPFFCGTYYPKDAFLQLLSAVSATWRERRGEVEEASDRI
    AGELRKMTSGLPAGGADLATALCDEAVAAILADRDTVHGGFGGAPKFPPSALLEALLRSYERTGSAAVLQAVAHTGAAMA
    RGGIYDQLGGGFARYSVDNAWVVPHFEKMLYDNALLLRLYAHWARRTCDPLAARVTAETARFLLDDLADGDMFTSSLDAD
    ADGREGSTYVWTPAQLTEVLGPDDGRWAAAVFGVTETGTFEHGSSVLRLPADPPDTPRFDRVRAALLAARRGRIQPGRDD
    KVVTSWNGLAITAFTEASVALDDPGLADAARRCARSVLDLHVVDGRLRRASLGGVVGDSAAILEDHAMLATGLLALYQLS
    AEDSWLTAATDLLDTALAHFADPQRPGRWFDTADDAERLMLRPADPLDGATPSGASSVTEALLTAAHLVGGERAERYLRA
    ATDALRAHAVLLERAPRTAGHWLAVAEAAVRGPLQIAVACDPARSALLADARRLAPGGAIVVGGPRDSSELLAGRDRVAG
    ADAAYVCRGRVCDLPVTRTPELAAALGAPSP

    >gi|41408892|ref|NP_961728.1| hypothetical protein MAP2794 [Mycobacterium avium subsp. paratuberculosis K-10]
    MTSPKVQLTDDEWRQRLTPEEFHVLRQAGTERPFTGEYTDTKTEGVYQCRACGAELFRSTEKFESHCGWPSFYDPANSDA
    VILRPDHSLGTTRTEVLCANCHSHLGHVFTGEGYPTPTDQRY
    CINSICLRLAPS

    >gi|41408927|ref|NP_961763.1| soluble pyridine nucleotide transhydrogenase [Mycobacterium avium subsp. paratuberculosis K-10]
    MSSPQEYDMVVIGSGPGGQKAAIASAKLGKSVAVVERGQMLGGVCVNTGTIPSKTLREAVLYLTGMSQRELYGASYRVKE
    KITPADLLARTQHVIGKEIDVVRNQLMRNRIDLLIGHGRFVDPHTIEVEDPSRREKITISGKYVVIATGTRPARPSGVEF
    DEDRVLDSDGILDLKSLPTSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDDMLDFCDPEVVEALKFHLRDLAVTFRFGE
    EVTAVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAELEADNRGRIFVDDNFQTKVPHIYAVGDVIGFPAL
    AATSMEQGRLAAYHAFGEASDGITELQPIGIYSIPEVSYVGATEVELTKDAIPYEVGVARYRELARGQIAGDSYGMLKLL
    VSTQDLKVLGVHIFGTSATEMVHIGQAVMGCGGTVEYLVDAVFNYPTFSEAYKVAALDVMNKVRALNQFRR

    >gi|41409021|ref|NP_961857.1| mycothione/glutathione reductase [Mycobacterium avium subsp. paratuberculosis K-10]
    METYDLAIIGTGSGNSLLDARFAGKRTAICEHGTFGGTCLNVGCIPTKMFVYAADVATTIREAARYGVDTHLDGVRWPDI
    VSRVFGRIDPIALSGEEYRRSSVNIDLYRSHTRFGPVQFDGRYLLRTDAGEQFTAEQVVIAAGSRPVIPPAILESGVTYH
    TSDTIMRIPALPEHLVIVGSGFVAAEFAHIFSALGVHVTVVIRSGRMLRQYDDMICERFTRLAAAKWELRTQRNVVGGSN
    RGSGVTLRLDDGSTLDADVLLVATGRISNADLLDAGQAGVDVENGRVVVDEYQRTSARGVFALGDVSSPYQLKHVANHEA
    RVVRHNLLCDWDDTESMAVTDHRYVPSAVFTDPQLATVGLTENQAIARGFDISVAIQNYGDVAYGWAMEDTTGVVKLIAE
    RTSGRLLGAHIMGPQASSIIQPLIQAMSFGLTAAQMARGQYWIHPALPEVVENALLGLY

    >gi|41409040|ref|NP_961876.1| Mpt53 [Mycobacterium avium subsp. paratuberculosis K-10]
    MRLQGMSRLSFVCRLLAATAFAVALLLGLGDVPRAAATDDRLQFTATTLSGAPFNGASLQGKPAVLWFWTPWCPYCNAEA
    PGVSRVAAANPGVTFVGVAAHSEVGAMANFVSKYNLNFTTLNDADGAIWARYGVPWQPAYVFYRADGSSTFVNNPTSAMP
    QDELAARVAALR

    >gi|41409200|ref|NP_962036.1| NrdH [Mycobacterium avium subsp. paratuberculosis K-10]
    MTITVYTKPACVQCSATYKALDKHGIAYEKVDITLDPEARDYVMALGYLQAPVVVAGSDHWSGFRPDRIKALAGAELSA

    >gi|41409252|ref|NP_962088.1| hypothetical protein MAP3154 [Mycobacterium avium subsp. paratuberculosis K-10]
    MSVAPETTVALQDRFFRELPELAVRWQAETFPELRLLVLNEPLATQLGLDTGWLRGPDGLRFLTGNLVPTGAAPVAQAYS
    GHQFGGFVPRLGDGRALLLGELVDNKGRLRDIHLKGSGATPFARGGDGLAAVGPMLREYVVSEAMHALGVPTTRSLAVVG
    TGRPVYREATLPGAVLARVASSHLRVGSFQYAAATGNRDLLRRLADHAIARHHPGAADAEQPYLALFEAVVAAQASLIAQ
    WMLIGFVHGVMNTDNMTISGETIDYGPCAFMEAYDPDTVFSSIDFWGRYAYGNQPVIAGWNLARFAETLLPLFSENTEEA
    IALAERSFGVFQTRYDAVWATGMRAKLGLPAQVDAEFAAALIDELLALLKANHVDYTSFFRQLGRAARGDDRSAAEPARE
    MFMDLPGFDAWLARWRALGPDADAMDRVNPIYIPRNHLVEEALAAATDGDLDPLDQLLAAVTAPYTERPGFERYASPAPE
    DFGKYQTF
    CGT

    >gi|41409396|ref|NP_962232.1| hypothetical protein MAP3298 [Mycobacterium avium subsp. paratuberculosis K-10]
    MTSAPLTVYTTSWCGYCHRLMTVLKSNGIPYEAVDIEHDPAAADFVSSVNGGNKTVPTVKFADGSTLTNPSAAQVKAKLA
    EAGN

    >gi|41409404|ref|NP_962240.1| molybdopterin biosynthesis-like protein MoeZ [Mycobacterium avium subsp. paratuberculosis K-10]
    MSTPLPPLVAPADQLTADEMARYSRQLIIPGLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVEFDAVEES
    NLQRQIIHGVADVGRSKAASARDSIAAINPLVDVRLHEFRLDASNAVELFGHYDLIVDGTDNFATRYLINDAAVLAGKPY
    VWGSIYRFEGQVSVCWEDAPDGRGLNYRDLYPEPPPPGAVPS
    CAEGGVLGVVCASIASVMSTEAIKLITGIGESLLGRLM
    IYDALEMSYRTIAIRRDPCDASRPAITTLVDYEQLCGAAPAASTDAATGGAEAAITPRQLRELLDSGAKLALIDVREPVE
    FDIVHLDGAQLIPQSSINSGEGLAKLPADRMPVLY
    CKTGVRSAQALAVVRQAGFSDAVHLQGGIVAWAQQMQPDMILY

    >gi|41409500|ref|NP_962336.1| hypothetical protein MAP3402 [Mycobacterium avium subsp. paratuberculosis K-10]
    MPLPPDPHPSLQEYAHPERLVTADWLSANLGAPGLVIVESDEDVLLYDVGHIPGAVKIDWHTDLNDPRVRDYIDGARFAE
    LMDRKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRETTLDVPTKTSTGYPVVTRNDAPIRA
    FKDDVLAILGSQPLIDVRSPDEYTGKRTHMPEYPEEGVLRGGHIPTARSIPWAKAVDESGRFRSRAELEELYGFLRPDDK
    TVVY
    CRIGERSSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRTPIVAGEEPGQAPAGV

    >gi|41409522|ref|NP_962358.1| flavoprotein disulfide reductase [Mycobacterium avium subsp. paratuberculosis K-10]
    MARLLLPPRCGGHRRRARLGVVVTRIVILGGGPAGYEAALVAASSHPDSTHVTVIDSEGIGGAAVLDDCVPSKTFIASTW
    LRTELRRAPRLGFEIDIDDAKISLPQIHARVKQLATEQSADITEQLLGVGVHVVAGRGELIDPTPGLARHRIKATAPDGS
    SSEYEADVVLIATGASPRILPSAQPDGERILTWRQLYNLDALPDHLIVVGSGVTGAEFVHAYTELGVPVTVVASRDRVLP
    YEDADAALVLEEAFSERGVQLVKNARAQSVTRTPDGVLVTLTDGRTVAGSHALMTIGSVPNTAGLGLERVGIELGRGGYL
    TVDRVSRTSVPGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRPEIAAVGVPQTMIDDGSVSA
    RTIMLPLRTNARAKMSGLRQGFVKVFCRKSTGVVIGGVVVAPIASELILPIAVAVQNRITVNELAQTLAVYPSLSGSITE
    AARRLMAHDDLD

    >gi|41409652|ref|NP_962488.1| methionine sulfoxide reductase A [Mycobacterium avium subsp. paratuberculosis K-10]
    MTNTQKAILAGGCFWGMQELIRKQPGVVSTRVGYTGGDVPNATYRNHGTHAEAVEIIYDPAVTDYRQILEFFFQIHDPTT
    KDRQGNDRGPSYRSAIFYTDDEQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHYIRPG
    WKLPRRATSGS

    >gi|41410042|ref|NP_962878.1| hypothetical protein MAP3944c [Mycobacterium avium subsp. paratuberculosis K-10]
    MYNARGVICRGPLSPAATRQAGRVQTIALIGFLGGLITGISPCILPVLPVILLSSMDGDRRGVGSAARPYLVIAGLVCSF
    SVATLIGSALLTALHLPQDAIRWTALVVLTVIGLGLIFPPLQQLIERPFAYLPQRQSRPGADGFGLGLTLGALYVPCAGP
    VLAAIVVAGGTSSIGPGALVLTATFAAGNALPLLAFALAGRRVAQRVAAFRRRQRAIQVAGGIAMIVLAVALVFNLPAML
    QRAVPDYTTAMQNRLGANDIQRSLSPAGPPPTQGGALQLSPDDVTGGGALSDCSDGSAELQRCGPAPALTGITGWLNTPD
    GKPLDPAVVRGKVILIDFWAYS
    CINCQRAIPHVIDWYDRYHDSGFLVIGVHTPEYAFERVPGNVASGAADLHIGYPIALD
    NDYATWNNYQNLYWPAEYLIDATGQVRHTKFGEGDYDGTERLIRELLTAAHPGARLPAPANTADTTPQSRLTPETYLGVG
    KAGNYGGTGDYRSGTATLSYPATLGEDRFALRGRWTLDDQGATAAGDDCAVRLNYTAKDVYAVVGGTGTLTVTRDGTTTT
    TPIGGAPTLHRIVADDSAHRDQLDMRVSPGLQVFSFTFG

    >gi|41410054|ref|NP_962890.1| dihydrolipoamide dehydrogenase [Mycobacterium avium subsp. paratuberculosis K-10]
    MTSHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELAHIFTKEAKTFGINGEATFDY
    GAAFDRSRKVAEGRVAGVHFLMKKNKITEIHGYGRFTDPHTLAVELNDGGTETVTFDNAIIATGSSTRLVPGTSLSANVV
    TYEEQILSRELPESIIIAGAGAIGMEFGYVLHNYGVEVTIVEFLPRALPNEDADVSKEIEKQFKKLGVKILTGTKVESIS
    DDGSQVTVVVSKDGNSQELKAAKVLQAIGFAPNVEGYGLEAAGVALTDRKAIGITDYMRTNIEHIYAIGDVTGKLQLAHV
    AEAQGVVAAETIAGAETLALGDYRMMPRATFCQPNVASFGLTEQQARDEGHDVVVAKFPFTANGKAHGVGDPSGFVKLIA
    DANTVSCWAGTWSATTSPSCCRSSPWRRSGT

    >gi|41410099|ref|NP_962935.1| hypothetical protein MAP4001 [Mycobacterium avium subsp. paratuberculosis K-10]
    MTSATPRPQVELLTRDGCTICERIHARLVELAAELGFELSTTDVDAAAAAGNPGLRTEFGDRLPVILLDGREHSYWDIDE
    PRLRADLAR

    >gi|41410120|ref|NP_962956.1| hypothetical protein MAP4022 [Mycobacterium avium subsp. paratuberculosis K-10]
    MSARVLAMAGAVLAGLLTGCSSGHDAVAQGGTFEFVSPGGKTDIYYDPPSSRGRPGPLSGPDLADPAHTLSLDDPIFAGR
    VVVINIWGQW
    CGPCRSEVSQLQQVYDATRGAGASFLGIDVRDNNRQAALDFVNDRHVTFPSIYDPAMRTLIAFGGKYPTT
    VIPSTLVLDRQHRVAAVFLRELLATDLQPVVQRVAQQ

    >gi|41410381|ref|NP_963217.1| hypothetical protein MAP4283 [Mycobacterium avium subsp. paratuberculosis K-10]
    MPTSEYQVSGMSCGHCEAAVHSEVARIPGVDGVSVSADTGRLVVTSAVPIDTDAVLGAVDEAGFQAVLVA

    >gi|41410382|ref|NP_963218.1| CtpA [Mycobacterium avium subsp. paratuberculosis K-10]
    MSTPPRHVDEGTFPDHTASTARIELEITGMTCASCAARIEKKLNKLDGVTATVNYATEKAAVSAPASYDPQTLITEIENA
    GYAAAVAKPSPPRDDPELASLRRRLVTATALAGPVIAVAMIPALQFQHWHWAALALTAPVVGWCGRPFHAAAWANLKHGV
    ATMDTLISIGTLAAFLWSLYALVLGAADRPGMRHDFELTVGHGAHVSHVAAPCHVYFEVAAGVTLFVLAGRYFERRSKRT
    AGAALRALLALGAKDVAVLRAGAETRIPIERLAVGDEFVVRPGERIATDGIVVAGSSAVDAAMLTGESVPVEVGVGDGVT
    GGTVNAGGRLVVRATGIGDDTQLARMAQLVERAQSGKADAQRLADRVSGVFVPVVLLLAVATLAGWLTAGGTLATALTAA
    VAVLIIACPCALGLATPTALLVGTGRAAQLGVLIKGPEVLETTRAVDTVVLDKTGTVTTGAMTVLDVVAADGTDRATLLR
    YAGALEAASEHPIAHAIARDAKAELGPLPTPTGFRAVGGGGVHGRVDGHAVAVGRPRWLAERGLRPDAALAAAAARAEHD
    GKTVVAVGWDGRARGILALADTVKPCSAAAVRQFTRLGLTPILLTGDNHTVARRIAGELGIGEVISGALPADKVEAVKRL
    QSAGRVVAMGTGTDVAIEAADVTVVRGDLRAAVDAIRLSRRTLATIKTNLVWAFGYNLAAIPLAALGMLNPMLAGAAMAL
    SSVLVVGNSLRLRSFASIIPGA

    >gi|41410437|ref|NP_963273.1| hypothetical protein MAP4339 [Mycobacterium avium subsp. paratuberculosis K-10]
    MTADTVHDVIIIGSGPAGYTAALYTARAQLAPVVFEGTSFGGALMTTTEVENYPGFRDGITGPELMDQMREQALRFGADL
    RMEDVESVSLAGPVKSVTTAEGETVRARAVILAMGAAARYLGVPGEQDLLGRGVSS
    CATCDGFFFKDQDIAVIGGGDSAM
    EEATFLTRFARSVTLVHRREEFRASRIMLERARANDKITIVTNKAVEAVEGSETVTGLRLRDTVTGETSTLAVTGVFVAI
    GHDPRSELVRDVLDTDPDGYVLVQGRTTATSIPGVFAAGDLVDRTYRQAVTAAGSGCAAAIDAERWLAEHAESSAAAQGD
    ATEFPGSTDTLIGAPQ

    >gi|41410438|ref|NP_963274.1| TrxC [Mycobacterium avium subsp. paratuberculosis K-10]
    MTDAEKASATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPETAQNFQVVS
    IPTLILFKDGQPVKRIVGAKGKAALLRELSDAVPNLG

    >gi|41409543|ref|NP_962379.1| hypothetical protein MAP3445 [Mycobacterium avium subsp. paratuberculosis K-10]
    MPASVSFCPRASRQRGSRRRASRQRDARAAARRFQAPSHIAGLPRLIGMTQKTRIEPLPPQRAGLLTRAMYRIAKRRYGQ
    VPEPFAVAAHHRRLMVASAVHETLVDRASKTLPASVRELAVYWTARQIGCSW
    CVDFGSMLQRLDGLDIQRLTEIDDYATS
    PAFTDDERAAIAYAAAITTDPHTVTDEQVDDLRARFGDAGTFELTYQIGLENMRARVNAALGITEQGFNSGDACRIPWAT
    GDTETSDPAANR