Mycobacterium avium 104 uid57693

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|118463209|ref|YP_879577.1| glutaredoxin [Mycobacterium avium 104]
    MTITLYTQPGCGGCIFAAKDLTKAGVPFTERNVRADPDAADMVHRLYQEHRDPGVVPETPVIVIDDEVFFGAVELHAYLR
    ELGRESAA

    >gi|118465144|ref|YP_879704.1| selenide, water dikinase [Mycobacterium avium 104]
    MTYRLTQYAHGGGCACKIPPGELEDVVRGLGAASPRDPLGELLVGLDSGDDAAVVRIQQGTALIATTDFFTPVVDDAYDW
    GRIAATNALSDVYAMGGRPVVAVNLLGWPREVLPFELAAETLRGGLDVCGLAGCHLAGGHSVDDPEPKYGLAVTGIADPN
    RLLRNDSGKPGLPLSLTKPLGIGVLNNRHKATGERFEEAIAVMTTLNAEAAGAALAAGVECATDVTGFGLLGHLHKLARA
    SGVTAVLDAAAVPYLDGAREALAAGYLSGGTRRNLDWVAPHVDLSGVGEDEALLLADAQTSGGLLIAGEIPGAPVIGELV
    PRGEHTIVVR

    >gi|118463887|ref|YP_879738.1| hypothetical protein MAV_0456 [Mycobacterium avium 104]
    MPIPRPTLTRKVRWHIAILAVVVALIVALLAQLRDDAATPGPPATGRVVADREHRDADTPAALAGPRQRADLPPCPAAGT
    GPGPAALRGVTAECAADGSVVDAGRAVAGRRVVLNFWAYW
    CAPCAAELPAMAEYQRRAGAEVTVLTVHQDENETAALLRL
    AELGVRLPTLQDGRRRVAAALRVVNVMPATVVLRPDGSVAQTLPRAFSTADEIAAAIGNDRG

    >gi|118466798|ref|YP_880031.1| putative thiosulfate sulfurtransferase [Mycobacterium avium 104]
    MARSDVLVSTDWAESNLDTPGVVFVEVDEDTSAYHAGHIPGAIKLDWRSDLQDPVKRDFVDAQQFSKLLSERGIANDDTV
    ILYGGNNNWFAAYAYWYFKLYGHEKVKLLDGGRKKWELDGRTLSSDPVSRPATSYTAAAPDNSIRAFRDEVIAAINVKNL
    VDVRSPDEFSGKILAPAHLPQEQSQRPGHIPGAINVPWSKAANEDGTFKSDEELAALYAAAGLDTGKETIAY
    CRIGERSS
    HTWFVLYELLGHRNVKNYDGSWTEYGSLVGAPIELGS

    >gi|118462455|ref|YP_880033.1| thioredoxin [Mycobacterium avium 104]
    MTTLVVIFAVLAAATLAGWLLTRRSGRIREIDAGPQRDTGDDVAALGLSRDGPTVVHFSAPWCGPCDRVRRVVDQVCADL
    GGVAHVEIDLDAHPDTARRYAVLSLPTTLIFDADGRQRYRSSGVPGAADLRSALKPLLA

    >gi|118466804|ref|YP_880405.1| arsenate reductase [Mycobacterium avium 104]
    MAQGATIYHNPRCSTSRKTLELLRDNGFEPSIVEYLKTPPSRAELVKMIRDAGIDVRTAVRKRESLYDELNLAEASDEQL
    LDAMIEHPILIERPFVVTPKGTRLARPIDAVREIL

    >gi|118464036|ref|YP_880454.1| hypothetical protein MAV_1208 [Mycobacterium avium 104]
    MSPADPSATNTLGRATSPYLRQHADNPVHWQQWTPQALADAAARDVPILLSVGYAACHWCHVMAHESFEDPDVAAAMNSG
    FVCVKVDREERPDIDAVYMNATVALTGHGGWPMTCFLTPDGRPFFCGTYYPKDAFLQLLSAVSATWRERRGEVEEASDRI
    AGELRKMTSGLPAGGADLAAALCDEAVAAIIADRDTVHGGFGGAPKFPPSALLEALLRSYERTGSAAVLQAVAHTGAAMA
    RGGIYDQLGGGFARYSVDNAWVVPHFEKMLYDNALLLRVYAHWARRTGDPLAARVTAETARFLLDDLADGDMFTSSLDAD
    ADGREGSTYVWTPAQLTEVLGPDDGRWAAAVFGVTETGTFEHGSSVLRLPADPPDTPRFDRVRAALLAARRSRIQPGRDD
    KVVTSWNGLAITAFTEASVALDDLGLADAARRCARSVLDLHVVDGRLRRASLGGVVGDSAAILEDYAMLATGLLALYQLS
    AEDSWLTAATDLLDTALAHFADPQRPGRWFDTADDAERLMLRPADPLDGATPSGASSVTEALLTAAHLVGGERAERYLRA
    ATDALRAQAVLLERAPRTAGHWLAVAEAAVRGPLQIAVACDPARSALLADARRLAPGGAIVVGGPRDSSELLSGRDRVAG
    ADAAYVCRGRVCDLPVTRTPELAAALGAPAP

    >gi|118462974|ref|YP_880772.1| methylated-DNA--protein-cysteine methyltransferase [Mycobacterium avium 104]
    MIEYRTVDSPIGLLTLAGRDPVLTNLRMVDQTYEPSRTGWTENPRAFAGAVEQLGAYFAGELTEFDIELDLRGSEFQRRV
    WRALQTIPYGETRSYGEIAEQIGAPGAARAVGLANGHNPIAIVVP
    CHRVIGASGKLTGYGGGLDRKQTLLALERRHSPAS
    LTLFD

    >gi|118464751|ref|YP_880781.1| thioredoxin domain-containing protein [Mycobacterium avium 104]
    MTRPRPSIGPALAGAVDLSGLKQRAQAASGPAGGPAPADGGPGISAVTEANFEAEVLIRSEEVPVVVLLWSPRSDACVQL
    LDTLSGLAAQDNGKWSLATVNVDVAPRVAQIFGVDAVPTVVALAAGQPISSFQGMQPADQLRGWLDQILSATAGKLKGAT
    GSAESEAVDPELAAARQQLEAGDFEAARTSYQAILDANPASAEAKGAIRQIDFLTRATAQRPDAVAVADAAPGDIDAAFA
    AADVQILNQDVGAAFDRLIALVRNTSGDDRARVRTRLVELFDLFDPADPEVVAGRRNLANALY

    >gi|118467041|ref|YP_880887.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium avium 104]
    MTETTRLAPGDKAPAFSLPDADGNTVKLSDFKGRKVIVYFYPAASTPGCTKQACDFRDSLAELNGAGLDVVGISPDKPEK
    LAKFRDAEKLTFPLLSDPDRKVLTAYGAYGEKQMYGKTVTGVIRSTFVVDEKGRIAVAQYNVKATGHVAKLRRDLSV

    >gi|118467334|ref|YP_880935.1| hypothetical protein MAV_1706 [Mycobacterium avium 104]
    MAQQAPAKNKADFWFDPLCPWAWITSRWILEVEKVRDIEVNFHVMSLAVLNENREGLPDEYRERLAKAFGPVRVAIAAEQ
    AHGAEVLAPLYTAMGTRIHNEGNKDLTDVIKQSLAEVGLPAELAEAADTDAYDDALRKSHHAGMDPVGDDVGTPTIHVNN
    VAFFGPVLSRIPRGEEAGKLWDASVTFASYPHFFELKRTRDEKPEFD

    >gi|118465766|ref|YP_881239.1| hypothetical protein MAV_2020 [Mycobacterium avium 104]
    MSRLPGVSDRDAGLGARIAFFFTRRKLAQMTGLETAGMLEPLRMYAHIPRLLNAHGRLEQAESRLDILSPRHRALAELKA
    ATTVRCEY
    CIDLGSQIARRWGITDEELLAMADYRDAACFSDVDKLILEYATAISRTPVEVSDELFDALRAHFDTAQLVGL
    THVITLGNLRARFNIALGIGSSGFSGNRVCALPDTPRP

    >gi|118464994|ref|YP_881352.1| thiosulfate sulfurtransferase [Mycobacterium avium 104]
    MGARDQVLITATELADVIEAGDPVSILDVRWRLDEPDGRAAYLQGHLPGAVYVSLEDELSDHTVSGRGRHPLPSGPSLQA
    AARRWGIRQDTPVVVYDDWNRAGSARAWWLLRAAGLDNVRILDGGLAAWRAAGGRLVSGPVEPAPGNVTVPHDDLHSGNR
    PTVTTEQVTAGAATLIDARAPERYRGEMEPLDPVAGHIPGAENLPSGDVLAADGTFLDDDALARVFAEHRIERHGAVAAY
    CGSGVTATVTIAALAAVGRTAALYPGSWSEWCADPARPVERGGA

    >gi|118462931|ref|YP_881408.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Mycobacterium avium 104]
    MLSVGTPAPDFTLRDQNQQRVTLSSFRGSKNVLLVFFPLAFTGICQGELDQLRDHLPEFENDDSAVLAISVGPPPTHRIW
    ALESGFTFPVLSDFWPHGAVSQSYGVFNDEAGYSNRGTFVVDRSGIIRFAEMKQPGESRDQRLWTDALAALKA

    >gi|118465196|ref|YP_881491.1| HesB/YadR/YfhF family protein [Mycobacterium avium 104]
    MTVQNESNAKTHGVILTEAAATKAKSLLDQEGRDDLALRIAVQPGGCAGLRYNLFFDDRSLDGDLTAEFGGVTLTVDRMS
    APYVEGASIDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|118466035|ref|YP_881595.1| mercuric reductase [Mycobacterium avium 104]
    MTKHFDAIIVGAGQAGPPLAGRLTAAGQRVAIIERKLIGGTCVNTGCIPTKTLVASAHAAHLARRGADYGVGTGAISVDM
    AKVKARKDEIMLGDRKGVEDWLAGMAGCTVVRGHARFRDPHTLQVGEDLLRAERIFLNVGGRAVVPDIPGLAEVDFLTNV
    SILELDRLPTHLVIVGGSYIALEFAQMYRRFGAAVTVVERGPRLASREDEDVSAAVQEILRAEGIDIVVNADDVRIAKTG
    NGFELTSRDGAPPIRGSHLLLAVGRRPNTDDLDLAVAGVRTDARGYILVDDQLKTNVEHIWAMGDCNGRGAFTHTSYNDF
    EIVAANLLDDDPRRVSDRITTYALYIDPPLGRAGMTVAQVRASGRRALVGKRPMTRVGRAVEKGETQGFMKVVVDADTRE
    ILGAAILGVGGDEAIHGILDVMSAKAPYTTLSRTMHIHPTVSELIPTMLQQMSPLA

    >gi|118463556|ref|YP_881678.1| hypothetical protein MAV_2486 [Mycobacterium avium 104]
    MTDALVIDAEGLDRLSCNAKANPETGKKTLKAKTVCEKGFRNMTYVRDLAPMLVGEPPALLGDDSAPNPSETALAALGSC
    VSVGLLANATHRGVTLTKIEVEMEADIDISAVWGVGDTPPGKRLGFSAVRCTVSLAGDADEATLKEIHDNAIAWSPVVNT
    FRNPVSVDSTLVTG

    >gi|118463413|ref|YP_881959.1| thiol peroxidase [Mycobacterium avium 104]
    MAQITLRGNPINTVGELPSVGSKAPAFSLTGGDLSPVTSDQFSGKPLVLNIFPSIDTPVCATSVRTFNERAAGAGATVLN
    VSKDLPFAQARFCGAEGIENVKTASAFRDSFGDDYGVTIADGPMAGLLARAIVVVGADGNVAYTELVPEIAQEPNYDAAL
    AAAG

    >gi|118467085|ref|YP_882026.1| alkylhydroperoxide reductase [Mycobacterium avium 104]
    MPLLTIGDQFPAYELTALIAGDLSKVDAKQPGDYFTTITSEDHAGKWRVVFFWPKDFTFVCPTEIATFGKLNDEFEDRDA
    QVLGVSIDSEFVHFNWRAQHEDLKNLPFPMLSDIKRELSLATGVLNADGVADRATFIVDPNNEIQFVSVTAGSVGRNVEE
    VLRVLDALQSDELCACNWRKGDPTLNATELLKASA

    >gi|118465273|ref|YP_882027.1| alkylhydroperoxidase, AhpD family protein [Mycobacterium avium 104]
    MSVENLKEALPEYAKDLKLNLGSITRTTELNEEQLWGTLLASAAATRNTQVLTEIGAEAADTLSAEAYHAALGAASVMAM
    NNVFYRGRGFLDGKYDDLRAGLRMNIIGNPGVEKANFELWCFAVSAINGCPD
    CVASHEHTLREAGVSRETIQEALKAAAI
    ISGVAQAIVTSQTLATAG

    >gi|118462347|ref|YP_882361.1| antioxidant, AhpC/TSA family protein [Mycobacterium avium 104]
    MKPGDTVADFELPDQTGTPRKLSDLLAAGPVVLFFYPAAMTPGCTKEACHFRDLAAEFAAVGANRVGISADPVDKQAKFA
    ELQKFDYPLLSDTDGAVAAQFGVKRGLLSKLLPVKRTTFVIDTDRTVLDVISSEFNMDTHADKALATLRARA

    >gi|118464906|ref|YP_882490.1| thioredoxin [Mycobacterium avium 104]
    MTTVDLTAEKFNETIEGNDIVLVDFWASWCGPCRQFGPTFQASSEKHPDIVHAKVDTEAEQQLAAAAQIRSIPTLMAFKK
    GKLLFNQPGALPPAALEDLVQQVRAFDVDAAIAEQGE

    >gi|118466366|ref|YP_882744.1| methionine-R-sulfoxide reductase [Mycobacterium avium 104]
    MTSPKVQLTDDEWRQRLTPEEFHVLRQAGTERPFTGEYTDTKTEGVYQCRACGAELFRSTEKFESHCGWPSFYDPANSDA
    VILLPDHSLGTTRTEVLCANCHSHLGHVFTGEGYPTPTDQRY
    CINSICLRLVPS

    >gi|118465723|ref|YP_882783.1| soluble pyridine nucleotide transhydrogenase [Mycobacterium avium 104]
    MSSPQEYDMVVIGSGPGGQKAAIASAKLGKSVAVVERGQMLGGVCVNTGTIPSKTLREAVLYLTGMSQRELYGASYRVKE
    KITPADLLARTQHVIGKEIDVVRNQLMRNRIDLLIGHGRFVDPHTIEVEDPSRREKITISGKYVVIATGTRPARPSGVEF
    DEDRVLDSDGILDLKSLPTSMVVVGAGVIGIEYASMFAALGTKVTVVEKRDDMLDFCDPEVVEALKFHLRDLAVTFRFGE
    EVTAVDVGSAGTVTTLASGKQIPAETVMYSAGRQGQTDHLDLHNAELEADNRGRIFVDDNFQTKVPHIYAVGDVIGFPAL
    AATSMEQGRLAAYHAFGEASDGITELQPIGIYSIPEVSYVGATEVELTKDAIPYEVGVARYRELARGQIAGDSYGMLKLL
    VSTQDLKVLGVHIFGTSATEMVHIGQAVMGCGGTVEYLVDAVFNYPTFSEAYKVAALDVMNKVRALNQFRR

    >gi|118463129|ref|YP_882887.1| mycothione/glutathione reductase [Mycobacterium avium 104]
    METYDLAIIGTGSGNSLLDARFAGKRTAICEHGTFGGTCLNVGCIPTKMFVYAADVATTIREAARYGVDAHLDGVRWPDI
    VSRVFGRIDPIALSGEEYRRSSVNIDLYRSHTRFGPVQSDGRYLLRTDAGEQFTAEQVVIAAGSRPVIPPAILESGVTYH
    TSDTIMRIPALPEHLVIVGSGFVAAEFAHIFSALGVHVTVVIRSGRMLRQYDDMICERFTRLAAAKWELRTQRNVVGGNN
    RGSGVTLRLDDGSTLDADVLLVATGRISNADLLDAGQAGVDVENGRVVVDEYQRTSARGVFALGDVSSPYQLKHVANHEA
    RVVRHNLLCDWDDTESMAVTDHRYVPSAVFTDPQLATVGLTENQAIARGFDISVAIQNYGDVAYGWAMEDTTGVVKLIAE
    RTSGRLLGAHIMGPQASSIIQPLIQAMSFGLTAAQMARGQYWIHPALPEVVENALLGLY

    >gi|118465076|ref|YP_882904.1| 15 kDa antigen [Mycobacterium avium 104]
    MAATAFAVALLLGLGDAPRAAATDDRLQFTATTLSGAPFNGASLQGKPAVLWFWTPWCPYCNAEAPGVSRVAAANPGVTF
    VGVAAHSDVGAMANFVSKYNLNFTTLNDADGAIWARYGVPWQPAYVFYRADGSSTFVNNPTSAMPQDELAARVAALR

    >gi|118465156|ref|YP_883083.1| glutaredoxin [Mycobacterium avium 104]
    MTITVYTKPACVQCSATYKALDKHGIAYEKVDITLDPEARDYVMALGYLQAPVVVAGSDHWSGFRPDRIKALAGAELSA

    >gi|118466965|ref|YP_883139.1| hypothetical protein MAV_3983 [Mycobacterium avium 104]
    MSVAPETTVALQDRFFRELPELAVRWQAETFPELRLLALNEPLATQLGLDTGWLRGPDGLRFLTGNLVPTGAAPVAQAYA
    GHQFGGFVPRLGDGRALLLGELVDDEGRLRDIHLKGSGATPFARGGDGLAAVGPMLREYVVSEAMHALGVPTTRSLAVVG
    TGRPVYREATLPGAVLARVAGSHLRVGSFQYAAATGNRDLLRRLADHAIARHHPGAADAEQPYLALFEAVVAAQASLIAQ
    WMLIGFVHGVMNTDNMTISGETIDYGPCAFMEAYDPDTVFSSIDFWGRYAYGNQPVIAGWNLARFAETLLPLFSENTEEA
    IALAERSFGVFQTRYDAVWAAGMRAKLGLPAQVDAEFAAALIDELLALLKANHVDYTSFFRQLGRAARGDDRSAAEPARE
    MFMDLPGFDAWLARWRALGPDADAMDRVNPIYIPRNHLVEEALAAATDGDLDPLDQLLAAVTAPYTERPGFERYASPAPE
    DFGKYQTF
    CGT

    >gi|118462968|ref|YP_883278.1| glutathione peroxidase family protein [Mycobacterium avium 104]
    MTVKNIPLTTLDGRPTTLAELSDGATLVVNVASKCGLTPQYTALEKLAEDYAARGLTVVGVPCNQFMGQEPGTPEEIREF
    CSTNYGVTFPLLAKTDVNGDDRHPLYAELTKAADADGHAGDIQWNFEKFLISPDGEVVRRFRPRTEPDAPEVISAIEAVL
    PR

    >gi|118465851|ref|YP_883292.1| hypothetical protein MAV_4144 [Mycobacterium avium 104]
    MTSAPLTVYTTSWCGYCHRLMTVLKSNGIPYEAVDIEHDPAAAEFVSSVNGGNKTVPTVKFADGSTLTNPSAAQVKAKLA
    EVGN

    >gi|118462493|ref|YP_883301.1| molybdopterin biosynthesis-like protein MoeZ [Mycobacterium avium 104]
    MSTPLPPLVAPADQLTADEMARYSRQLIIPGLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVEFDAVEES
    NLQRQIIHGVADVGRSKAASARDSIAAINPLVDVRLHEFRLDASNAVELFGHYDLIVDGTDNFATRYLINDAAVLAGKPY
    VWGSIYRFEGQASVCWEDAPDGRGLNYRDLYPEPPPPGAVPS
    CAEGGVLGVVCAAIASVMSTEVIKLITGIGESLLGRLM
    IYDALEMSYRTIAIRRDPCDASRPAITTLVDYEQLCGAAPAASTDAATGGAEAAITPRQLRELLDSGAKLALIDVREPVE
    FDIVHLDGAQLIPQSSINSGEGLAKLPADRMPVLY
    CKTGVRSAQALAVVRQAGFSDAVHLQGGIVAWAQQMQPDMILY

    >gi|118466173|ref|YP_883394.1| putative thiosulfate sulfurtransferase [Mycobacterium avium 104]
    MPLPPDPHPSLQEYAHPERLVTADWLSANLGAPGLVIVESDEDVLLYDVGHIPGAVKIDWHTDLNDPRVRDYIDGARFAE
    LMDRKGISRDDTVVIYGDKSNWWAAYALWVFTLFGHPDVRLLNGGRDLWLAERRETTLDVPTKTSTGYPVVTRNDAPIRA
    FKDDVLAILGSQPLIDVRSPDEYTGKRTHMPEYPEEGVLRGGHIPTARSIPWAKAVDESGRFRSRAELEELYGFLRPDDK
    TVVY
    CRIGERSSHTWFVLTHLLGKPGVRNYDGSWTEWGNTVRTPIVAGEEPGQAPAGV

    >gi|118462701|ref|YP_883439.1| transposase [Mycobacterium avium 104]
    MTQKTRIEPLPPQRAGLLTRAMYRIAKRRYGQVPEPFTVAAHHRKLMVASAVHETLVDRASKTLPASVRELAVYWTARQI
    GCSW
    CVDFGSMLQRLDGLDIQRLTEIDDYATSPAFTDDERAAIAYAVAITTDPHTVTDEQVDDLRARFGDAGTFELTYQI
    GLENMRARVNAALGITEQGFNSGDACRIPWATGDTETSDPAANR

    >gi|118465689|ref|YP_883748.1| hypothetical protein MAV_4619 [Mycobacterium avium 104]
    MSARVLAMAGAVLAGLLTGCSSGHDAVAQGGTFEFVSPGGKTDIYYDPPSSRGRPGPLSGPDLADPAHTLSLDDPIFAGR
    VVVINIWGQW
    CGPCRSEVSQLQQVYDATRGAGASFLGIDVRDNNRQAALDFVNDRHVTFPSIYDPAMRTLIAFGGKYPTT
    VIPSTLVLDRQHRVAAVFLRELLATDLQPVVQRVAQQ

    >gi|118463078|ref|YP_883770.1| hypothetical protein MAV_4641 [Mycobacterium avium 104]
    MTSATPRPQVELLTRDGCTICERIHARLVELAAELGFELSTTDVDAAAAADNPGLRAEFGDRLPVILLDGREHSYWDIDE
    PRLRADLAR

    >gi|118466092|ref|YP_883815.1| dihydrolipoamide dehydrogenase [Mycobacterium avium 104]
    MTSHYDVVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELAHIFTKEAKTFGINGEATFDY
    GAAFDRSRKVAEGRVAGVHFLMKKNKITEIHGYGRFTDPHTLAVELNDGGTETVTFDNAIIATGSSTRLVPGTSLSANVV
    TYEEQILSRELPESIIIAGAGAIGMEFGYVLHNYGVEVTIVEFLPRALPNEDADVSKEIEKQFKKLGVKILTGTKVESIS
    DDGSQVTVVVSKDGNSQELKAAKVLQAIGFAPNVEGYGLEAAGVALTDRKAIGITDYMRTNIEHIYAIGDVTGKLQLAHV
    AEAQGVVAAETIAGAETLALGDYRMMPRATFCQPNVASFGLTEQQARDEGHDVVVAKFPFTANGKAHGVGDPSGFVKLIA
    DAKYGELLGGHLVGHDVSELLPELTLAQKWDLTATELARNVHTHPTMSEALQECFHGLTGHMINF

    >gi|118465931|ref|YP_883826.1| DipZ protein [Mycobacterium avium 104]
    MQTIALIGFLGGLITGISPCILPVLPVILLSGMDGDRRGVGSAARPYLVIAGLVCSFSVATLIGSALLTALHLPQDAIRW
    TALVVLTAIGLGLIFPPLQQLIERPFAYLPQRQSRPGADGFGLGLTLGALYVPCAGPVLAAIVVAGGTSSIGPGALVLTA
    TFAAGNALPLLAFALAGRRVAQRVAAFRRRQRAIQVAGGIAMIVLAVALVFNLPAMLQRAVPDYTTAMQNRLGANDLQRS
    LSPPGPPPTQGGALQLSPGDVTGGGALSDCSDGLAELQRCGPAPALTGITGWLNTPDGKPLDPAAVRGKVILIDFWAYS
    C
    INCQRAIPHVIDWYDRYHDSGFLVIGVHTPEYAFERVPGNVASGAADLHIGYPIALDNDYATWNNYQNLYWPAEYLIDAT
    GQVRHTKFGEGDYDGTERLIRELLAAAHPGARLPAPANTADTTPQSRLTPETYLGVGKAGNYGGTGDYRSGTATLSYPAT
    LGEDRFALRGRWTLDDQGATAAGDDCAVRLNYTAKDVYAVVGGTGTLTVTRDGTTTTTPIGGAPTLHRIVADDSAHRDQL
    DMRVSPGLQVFSFTFG

    >gi|161579556|ref|YP_884276.2| methionine sulfoxide reductase A [Mycobacterium avium 104]
    MTNTQKAILAGGCFWGMQELIRKQPGVVSTRVGYTGGDVPNATYRNHGTHAEAVEIIYDPAVTDYRQILEFFFQIHDPTT
    KDRQGNDRGPSYRSAIFYTDDEQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNGYTCHYIRPG
    WKLPRRATSGS

    >gi|118463247|ref|YP_884359.1| hypothetical protein MAV_5245 [Mycobacterium avium 104]
    MPTSEYQVSGMSCGHCEAAVHSEVARIPGVDGVSVSADTGRLVVTSAVPIDADAVLGAVDEAGFQAVLVA

    >gi|118463890|ref|YP_884360.1| copper-translocating P-type ATPase [Mycobacterium avium 104]
    MSTPPRHIDEGTFPDHTASTARIELEITGMTCASCAARIEKKLNKLDGVTATVNYATEKAAVSAPASYDPQTLITEIENA
    GYAAAVATPSPPRDDPELASLRRRLVTAIALAGPVIAVAMIPALQFQHWHWAALALTAPVVGWCGRPFHAAAWANLKHGV
    TTMDTLISIGTLAAFLWSLYALVLGAADRPGMRHDFELTVGHGAHVSHVAAPCHVYFEVAAGVTLFVLAGRYFERRSKRT
    AGAALRALLALGAKDVAVLRAGAETRIPIERLAVGDEFVVRPGERIATDGIVVAGSSAVDAAMLTGESVPVEVGVGDGVT
    GGTVNAGGRLVVRATGIGDDTQLARMAQLVERAQSGKADAQRLADRVSGVFVPVVLLLAVATLAGWLAAGGTLATALTAA
    VAVLIIACPCALGLATPTALLVGTGRAAQLGVLIKGPEVLETTRAVDTVVLDKTGTVTTGAMTVLDVVAADGTDRATLLR
    YAGALEAASEHPIAHAIARDAKAELGPLPTPTGFRAVGGGGVHGRVDGHAVAIGRPSWLAERGLRPDAALAAAAARAEHD
    GKTVVAVGWDGRARGILALADTVKPSSAAAVRQFTRLGLTPILLTGDNHTVARRTAGELGIGEVISGALPADKVEAVKRL
    QSAGRVVAMVGDGVNDAAALAAADLGLAMGTGTDVAIEAADVTVVRGDLRAAVDAIRLSRRTLATIKTNLVWAFGYNLAA
    IPLAALGMLNPMLAGAAMALSSVLVVGNSLRLRSFASIIPGA

    >gi|118465167|ref|YP_884411.1| thioredoxin-disulfide reductase [Mycobacterium avium 104]
    MPAVLFATAGNSHPYPGVYTDPETIARKVFMTADTVHDVIIIGSGPAGYTAALYTARAQLAPVVFEGTSFGGALMTTTEV
    ENYPGFRDGITGPELMDQMREQALRFGADLRMEDVESVSLAGPVKSVTTAEGETVRARAVILAMGAAARYLGVPGEQDLL
    GRGVSS
    CATCDGFFFKDQDIAVIGGGDSAMEEATFLTRFARSVTLLHRREEFRASRIMLERARANDKITIVTNKAVEAVE
    GSETVTGLRLRDTVTGETSTLAVTGVFVAIGHDPRSELVRDVLDTDPDGYVLVQGRTTATSIPGVFAAGDLVDRTYRQAV
    TAAGSGCAAAIDAERWLAEHAESSAAAQGDATEFPGSTDTLIGAPQ

    >gi|118465727|ref|YP_884412.1| thioredoxin [Mycobacterium avium 104]
    MTDAEKAIATIEVSDASFSTDVLASNKPVLVDFWATWCGPCKMVAPVLEEIASERGDHLTVAKLDVDANPETAQNFQVVS
    IPTLILFKDGQPVKRIVGAKGKAALLRELSDAVPNLG