Arcanobacterium haemolyticum DSM 20595 uid49489

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297570724|ref|YP_003696498.1| glutaredoxin-like protein NrdH [Arcanobacterium haemolyticum DSM 20595]
    MSITLYTKPACVQCTATKRALVKHGLDFTEVDLTQHPHALETVKALGYQQAPVVFADGDHWSGYRPDLIKRLAGASAPVA
    LRA

    >gi|297570741|ref|YP_003696515.1| heavy metal translocating P-type ATPase [Arcanobacterium haemolyticum DSM 20595]
    MNIDLKISGMTCASCSARVEKKLNKVPGVNAVVNLATERAHVEFPATLTEADLISVVEKAGYGASVVEEADHTDSAAARS
    ADMRRRFVVSAILSIPIIAISMIPAWQFAGWQWAITALGIPVAFWGGWPFHRAAFAAGRHGTSTMDTLVSLGVIASMGWS
    VWALIFGGAGHIGYTMSMSGMLSLDSHGHTHIYVESAAMIVTFLLLGRWLESRSRRKAGDALRLLLSTGAPVAHLITDSG
    ERQIPAEDLQVGDEFMVYAGQKIPTDGLVVSGSSAIDTSLVTGESIPVDIQPGGTVIGATLVTNGSIRVRATRVGKDTTL
    AHMGRLLEQAQVGKAPIQRLADQIAAVFVPGVLILAALTFIARIVFFNNSTDLALASAITVLVVACPCALGLATPTALLV
    GSGKLSQHGILISGPEALENAHSLTAIALDKTGTLTEGKLAITSVSPAPASFDLLPLLAGIERHSRHPLAQAIVAHARER
    NVTLADVSNVREEAGRGITATWNGTTVYVGNPSWLVRNGIPVPQNEPDGTVVAAGTPGTGETPGTYFGHVTLTDTPRAHA
    TESLDALRNRGITPIMVTGDNPASAAPIAAALGITEIHAGVLPEDKLALVHSLQASGHKVAMVGDGINDAAALAAADLSI
    AMGSGTDVAQASADVIIVESRITAIPTMLRIGEKTLRIIKENLAWAFGYNLIAIPLAMFGVIAPGLAAIAMASSSVIVVA
    NSLRLRNA

    >gi|297570817|ref|YP_003696591.1| methionine-R-sulfoxide reductase [Arcanobacterium haemolyticum DSM 20595]
    MAFADETPKYTEKIEYKLNKSPEEWRNLLSDMEFFVLREAGTERPGTGELLHENRAGMYHCRACDAELFSSETKFDSHCG
    WPSFYDPDEKGAVVYIEDRTLAPRIRNEVRCATCGSHLGHVFNDSPQTPTGLRY
    CMNSVSLRFEPGK

    >gi|297571278|ref|YP_003697052.1| Rhodanese domain protein [Arcanobacterium haemolyticum DSM 20595]
    MGFFDFIFPDGKSPQLTTAQAFAECQEGARLIDIRPLLDRNKGFAGGSEHIPQARLLRPDSGLSKDERLILLCADGETSL
    RVAASMKRAGFNAISVHGGLDSWRRSGLPYIDPRS

    >gi|297571313|ref|YP_003697087.1| dihydrolipoamide dehydrogenase [Arcanobacterium haemolyticum DSM 20595]
    MSDTQEYDIVILGAGSGGYATAMRAAQLGLSVALVEGDKVGGTCLHRGCIPTKALLHVAEVADEMREGAHIGIKGSFDGI
    DMDALNAYKDGVITKMYKGLTGLIDSRGIETINGWGRLVSQDTVEVNGRRLKGKNIVLASGSYSKTIGQTITDRVITSEQ
    ALKLDRVPKSVVVLGGGVIGVEFASVWASFGTEVTIIEGLDRLVPNEDPAISKLLERQFRKRKIAFKTKTMFDRVEEDEN
    GVHVFTQDGKQFDADMLLIAIGRGPATQNLGYAEQGIKLDRDFVITNERLHTGVGNIYAVGDIVPGVQLAHRGFLHGLFV
    AEEIAGMNPKVVDENLIPKVTFCDPEISSVGLTQPKAEEKYGKENVDVAEFNLAGNGKSQMLGTTGFVKLVREKNGPIVG
    FHAIGARMGEQVGEGELMVAWEAFPEDFDGLIHAHPSQNESLGEAVLALAGKPLHTHN

    >gi|297571323|ref|YP_003697097.1| iron-sulfur cluster assembly accessory protein [Arcanobacterium haemolyticum DSM 20595]
    MSEIATHAVNLTDVAAVKVKSLLEQEGRDDLRLRVAVQPGGCSGLMYQLYFDERLLDGDAVVNFDGVEVVVDRMSVPYLD
    GATIDFADTIERQGFTIDNPNAQGSCACGESFH

    >gi|297571626|ref|YP_003697400.1| thioredoxin [Arcanobacterium haemolyticum DSM 20595]
    MATVEITADNFKDHVNSGITVLDFWAEWCGPCRMFGPTFEAVSEQNPEVTFGKINTEEQTELAQAFQVMSIPTVMVFRDG
    IRLYEGAGALARDQLQALIQKAEELNMDDVRAQIEEASKDA

    >gi|297571664|ref|YP_003697438.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Arcanobacterium haemolyticum DSM 20595]
    MTQLSEGQKAPDFTLATLGGGSVTLSEELERADKGVIVYFYPKAMTPGCTKQACDFRDSENSLASAGYRVIGISPDKVES
    LEKFTAKENLNFPLASDPEKDVMIAWGAYGEKKNYGRLIKGVIRSTIVVAKDGTVAKALYNVKATGHVARLRRELGIDK

    >gi|297571870|ref|YP_003697644.1| alkyl hydroperoxide reductase, F subunit [Arcanobacterium haemolyticum DSM 20595]
    MFLDSNTIAQLKGLVTNVKMPIRFEASLDDTKRSEQMREMLTQVAELSPMIEFAEVANERTPSFAISRVDSDVSVRIAGL
    PMGEEFSSFVLALVQVGGHPVREDEDLIESIKNLSEPHEFVTYMSLT
    CQNCPTVVQALNAMSVINPLIKHTAVEGGAFQD
    EVNARGIKAVPAVYMDGELFGQGRMSLAEIVAKLDSNSGSKRAEKLNAAEPFDMLIVGGGPAGASAAVYAARKGLRVGVA
    THNVGGQVLDTASIENLTVLEKIGGTELGGELAQSMANYSVEVMSGLIATKLNDKAEDGLFTVEFDGDVRLKAKSVVLST
    GARYRTTGVPGEAEYRNNGVSF
    CPHCDGPLFKGKPVGVIGGGNSAIEAAIDLAGICSHVTVVELMPGLKADEVLLEKLSS
    LPNVTVHTSAALESVEGDGSEMTSLTFKDSDGELQRVEANGMFVQIGLIPNAEWLNGTLEMNRGAVVVDQRNATSMPGVF
    AAGDVTDIPYKQVLISLGAGANASLSAFDYLIRQ

    >gi|297571871|ref|YP_003697645.1| peroxiredoxin [Arcanobacterium haemolyticum DSM 20595]
    MSLINTKAAQWAGTAYHNGSFVDVSSEDHKGKWAILFFYPADFTFVCPTELEDMAENYAEFQEMGVEVYSFSTDKHFSHK
    AWHETSERIGKIKFPMVGDPTCEIAEAFETLRPGEGAADRSTIVIDPDGVIQYVETTSEGVGRNASELLRKVKAAQYIYN
    HPGEVCPAKWEEGEETLAPSFDLAGKL

    >gi|297572010|ref|YP_003697784.1| Rhodanese domain protein [Arcanobacterium haemolyticum DSM 20595]
    MKKIATVIALVAAAGGCTNAGSGQAETVPGDQTPAKESALATSDSQLDSKSEEKPMIIDVRTPEEFAGGHLVDAVNFDVN
    DPKFQEQVKDLDRDGHYILY
    CRSGNRASGAKGYMESIGFKNVKNVGSVDQASQELGVDVVAER

    >gi|297572016|ref|YP_003697790.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Arcanobacterium haemolyticum DSM 20595]
    MPEQDWRAKVRESRFGTVVVLAVTAACVLLGAWYLKGVPSDSGAGENGAASQLQIGGEGQAPSVGAQAPDFQLTTITGET
    VRLSELKGKPVWVNFVATW
    CQGCRAEMPDIQNAYAAHSSEELQVVSVFGGESVKDVASYAEKAGLEFSLAPDETGDVSRA
    YGTIGIPAHFFIDSDGIIRDHAVGVLSKKHIESHLAKIK

    >gi|297572052|ref|YP_003697826.1| peptide methionine sulfoxide reductase [Arcanobacterium haemolyticum DSM 20595]
    MVTKDTALPDNTLPVLAHPQPHTVLGSDILAEPAEGQQVIYLAAGCYWGVEEIMWQLPGVVSTAVGFMGGFTAHPTYRQV
    CTGLTGHTETVRVVCEDSAVANVIKTFWELHDPTSLNRQGNDVGTQYRSAIFTTTDYQRVLVDDSVAAYTQVLRDAGKGH
    IVTEVRPASEAGPFYPAEDDHQQYLHKNPFGYRCHAATGMPCPMPGSGPLVAPKSRSFIDLD

    >gi|297572092|ref|YP_003697866.1| redox-active disulfide protein 2 [Arcanobacterium haemolyticum DSM 20595]
    MNIKILGPGCRNCVNLEKQTRKAIADLNLDADIEHVTDYADIMSYGIMSTPGLVINGEVVVSGRVPKANEIAQLLTNR

    >gi|297572147|ref|YP_003697921.1| Rhodanese domain protein [Arcanobacterium haemolyticum DSM 20595]
    MALSRVLLFYKFTPISDPVAMKLWQWDLCERLKLRGRILISKHGINATVGGSIDSCKAYVKRMKQYPGFEDIEWKISEGF
    GLDEQGNSKDFPRLSVKVRKEIVAFGAPDELEVNAQGVIGGGTHVRPEDVEKVIAENPDLVFFDGRNAIEAEVGRFDGAI
    VPPTNTTHDFISILESGAYDDLKDKPILAY
    CTGGIRCEVLTALMKNRGFDKVMQLDGGIVRYGEMFGNTGRWKGSLTVFD
    NREVMDFTGGDVDVIGRCHSCEEPTGKLHNCDEPSCRARLVTCDECGTKPVYCEKHEVALTH

    >gi|297572200|ref|YP_003697974.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Arcanobacterium haemolyticum DSM 20595]
    MSRTVIIGGVAGGMSTATRLRRNDEAMEIVVVESSGYVSFANCGLPYYIGGKIAERSALLLQTPQSLKARFNLDVRVGTT
    ATSINRAEKTVTLNGPEGEYTLSYDHLVLSPGARPFTPPIPGIETALSLRTIEDTDRIMERIDKSAAQSAAIIGGGFIGL
    ELAENLTRRGITTTVIERAPHIMGPLDAEMAAIVSRHLQENGVIIKVNTEVTAIGDGYVTANGENITADIVVAALGVQPA
    SELARDAGLDVNERGGIIVDAAQHTSDPAIFAVGDATTKRDAITGELILVPLAQTANRHGRLVADVIAGRDAESLPVLGT
    AIIGLFGLTAASTGWNERRARAAGKDLRILHIHPAHHAGYYPGATTIHLKLVIDAETDQILGAQAVGTDGIDKRIDVIAT
    AMRAGMAASDLADLELAYAPQFGSAKDPINMAGFVADNLFYGERNVQWHEIDQMLEDGWTLVDVRTAGEYSRGNIPGATN
    IPVDDLRSRVSELFGKKVLVH
    CQVGLRGHIACTLLTNLGIECANLDGGYLTWSHGQLT

    >gi|297572314|ref|YP_003698088.1| DSBA oxidoreductase [Arcanobacterium haemolyticum DSM 20595]
    MSQPANTPKNNRTIIIALIALLTVAVLVLSFVVSGTLSSKEGKAAAPSSSTSQPKENTETKKELTPEIKAIIEQQHRKES
    NDPRALGNVDAPVIIEMYSDYR
    CGHCRQWSLETLPKLQDFIDSGKIRIEYNSMPVLGDESVLIAQASHAAALQNQFWEYH
    HELFANAPEAKPEALTELAGKIGMDTEKFAADLKDPETVKAVDTERSRGTSLGITGTPAFLIGYSFVPGAYPADQFIGII
    NQELQRAENHK

    >gi|297572333|ref|YP_003698107.1| thioredoxin reductase [Arcanobacterium haemolyticum DSM 20595]
    MSTIHDVIIVGSGPAGWTAATYTGRAGLSPLVLAGTLEAGGALMNTTEVENFPGWPEPILGPELMMRMQQQAERFGAQVR
    YEDAISCDLASDIKTVTTADATYQAKTVILALGSEYRKLGLEGEATFSGKGVSY
    CATCDGFFFKGKEIAVVGGGDSAVTE
    AIFLSRFGSTVHVIHRRDELRASKVMANRIEEIENIKVHWNSKVAEIHGSGGLEALTLEDTVTGETSELPVSGLFVAIGH
    KPRSGMLDGQVDLDDHGYIVVDSPSAKTSLPGVFACGDVVDSTYQQAVTAAGTGCVAALDAEAYLIRMEAEAAAQ