Moorella thermoacetica ATCC 39073 uid58051

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|83589298|ref|YP_429307.1| DsrE-like protein [Moorella thermoacetica ATCC 39073]
    MAQLCLVVQTGPYTYQNLDTAYGLARAALAKGHGVSLFLYIDGVVAANKNIDAPGERNIAAMLQELAAAGVRIASCGACS
    KFRGITDEMYIDGAEMGSLVDMADMIQEADVLINFGF

    >gi|83589306|ref|YP_429315.1| 4Fe-4S ferredoxin, iron-sulfur binding [Moorella thermoacetica ATCC 39073]
    MSGKLDVLVVGGGPAGMAAALDLARAGLQVMIVEKEAVLGGRWLDYGCKAGEDCSRCNICLGFPLLEEVTSRENITLVTG
    MVVVGVTGTTGAFTASLRATGPRIDWQKCDHCGRCREACPAGAILPPHPRGLPRAYRLDHSCCLRAKEDCQACVAACPRA
    AIELEPASPESIRARAIVVATGFAPFDAAGLPEYGYGFYPRVTTAMELESALSQGDLDAPGWERLSFIQCAGSRSRKLGH
    DYCSRVCCGYSLRLARALKYRGLSREITIFYMDLQLNDARLQELYRELRATPGLKLVRGMPSEIRRGRDGRVSIHYEDLS
    TGTLATEEFDRVVLAVGITPVRGEILPGLSLERDPAGFLAAVDGPNGIQASTPGVFLAGTCQAPRDIQESITHGRLAAAG
    VRKLLEGSGEKAGMSDISSGAGRSAAADVLVSGRGASALLAARDLMRAGLRVLLLDDDGDFDPADPAGELAGPLWSELTD
    NSKVTYLPGREILGVNGDAGSFSVQVGDGRRVANLQVRAILLANRLAAGLPAGIATGAVPILTQQQLAAKLAAGGRIPAL
    TSQGVTGTADGDLLAGIRGGGEVVFWLDAAGDLSLAIHALAWQNIAALKERLEPDRTIYVLARQVRVAALPELEALYGRL
    REAGVIFIKPQEVPSWDGACLEVSDPTRLTPGMPEVTRLHPDLLVVGEELAATPVTRRLWQRLGLKAVQGEANGPAGMDS
    LYYRAVTTNRRGIFLVAAGREPVPAGEAGTAASLAAAAVVSFLKGEEPEAAPVTLAFRPLDGACAACLTCVRTCPHGAMV
    VQGKALVRTRSCQGCGICVAECPAHALELPEYTDVRLLQAAAGDKGGN

    >gi|83589314|ref|YP_429323.1| hypothetical protein Moth_0449 [Moorella thermoacetica ATCC 39073]
    MAPDTQLAHINLKPKSQEPYALILALAAAAIFWRLQGQGIGLGTMWLFGLALGYVLQRSRFCFVACFRDPFITGNTSLSR
    AVVLALAVATAGMALLVLAGGSPVEVYPAGWHNLAGGLLFGTGMVLAGG
    CASGTLMRAGEGHLLQWLALAAFIMGSLWGA
    HDFGWWQQVSLSCSPVLFLPRLVGWGPALVLQLLILGLIYHGLWRIEKQAFPDFSPPGKGRYAFKLRHLWSRPWPYWAGG
    VVLAVLDVALAWCTGRPWGITTAFSYWGAWLWQAFTGHPPGWYYYSLPEHTRALGLGFLAEPGTILNLGTIWGAGLSALA
    ASEFRLHLPRRWQVVPAALAGGIMMGYGARIAMG
    CNIGAFFNGIASLSLHGWLFGLGLAGGAYLGGKLLLRFLV

    >gi|83589778|ref|YP_429787.1| thioredoxin [Moorella thermoacetica ATCC 39073]
    MAKPINVNQNDFEAEVLSAPLPVVVDFWAVWCGPCRMMAPVLEQLAADYDGNVKFAKVNVDENQELAARYGIMSIPTLVI
    FKDGAEAGRIVGYMPKEKLQEQLEAAIH

    >gi|83590024|ref|YP_430033.1| UbiE/COQ5 methyltransferase [Moorella thermoacetica ATCC 39073]
    MAEIFDRKAGDYDDWYTRPLGALVDRVEKEPIYAYLDPHAGEHILDVGCGTGNFSLELARRGVKVTGIDISDPMLAKARK
    KAADAGLAIEFLHADAMNLPFGDNTFDKIVSVTALEFAPDLKAVLEESYRVLKPGGRMVIGLIGGNSLWSRHYEARAARE
    PD
    CLFRYARFYTLDELLAAMPGKNVQGKAVLFFGPDFDGTKVDEALAIEAAAAREGRTNGGFITAVSYKD

    >gi|83590042|ref|YP_430051.1| 4Fe-4S ferredoxin, iron-sulfur binding [Moorella thermoacetica ATCC 39073]
    MSAKKETTPAVGAVLVLGGGIAGMQSALDLANAGYLVHMVTESSSIGGHMAQLDKTFPTNECAMCLLGPRMTDTSNHPNI
    RLHTCATLEKVEGEKGNFTVQIREKPRYVNIQECTACGDCEQACPVSIPNEYNQEMGTRKAIHKMFPQAVPNKYLITKRG
    TPPCRSTCPAGTNVQGYVALISQGKFAEALEVVHRRMPFAGICGRICHHPCETECNRGRYDDPIAIATLKRAAYDYGWEA
    EASREKERRPELPSRKEKVAIIGAGPAGLTAAQDLALAGYQVTIYDALNQPGGMLRGGIPRYRLPMEVVDRETQRILNLG
    IKFVPNTVVGKDINLKDLQKEYNAVIIAVGLQQSRMLKLDGSELEGILPGVNFLREAALGGRPEVGEKVVVIGGGNVAID
    VARTARRLGAREVHLACLESREEMPAHPWEVEEALEEGIILHPSWGPKRFLGAKGRVTGIELMQCTRVFDEEHRFNPQYN
    PEVTQTLTADTIIMAIGQAADLSLLGEKSPVATNRGLIKADPLTLATSVPGVFACGDIVRGPASVVEAVASGHEAAESVK
    RYLQGEDLATGRSLEKEPHLDPPPNVVPFPGRRQAQAMAPVEERVKDFREVYQGFTPEEAIAEAKRCLNCGICSECLQCE
    AVCKKKAIEHWQQEKVTKLKVGSIVLAPGFELFDATLAGEYGYGYYANVLTSLEFERLLSATGPTESHVLRPSDQRPPKK
    VAFIQCVGSRDCEREGSPYCSAICCMYSTKEALIAREHDANIEPTIFYLDIRAYGKNFDRYVESAKAGGVRYVRAMISRV
    EEDPQTKNLIIQYYTDGRVQREEFDLVVLAVGVKPPIDAEKIAAATGIELNPYGFAKTQPFEPVATTRDGIYVAGVFQGP
    RDIPETVVNASAAAACAGAAMAPGRNTMITPKEYPPERDVSREEPRVGVFICHCGINIAGVVDVKAVVEAAAKLPGVVHA
    EDNLYTCSQDTLKKIKDAIQEYRLNRVVVASCTIRTHQPLFREALREAGLNQFYFEMANIRDQCSWVHRNEPANATLKAI
    DLVRMAVAKVKRHEALHLQPVPVIQKALIIGGGVAGLTAALNVAEQGFEAYIVEREAELGGQVRNLRTTLEGEDLQALLR
    DLITRVQANPRIQVFTRARIEDFGGHQGHFTTTISLGEPGREHVRRTQTLEHGVVIVATGSQEIKTDAYLLGQDERVITN
    TRLEQALADGHWDQEKNKQVVFIQCVGSRDQEHPYCSRTCCAQTIKNALAIKRRNPEAQVYVLYRDIRTYAFMEDYYRQA
    REAGVLFIAYDPGDPPRVRQREIGLLEVMVKDPDSGKELVLWPDQLVLATGAVAPDGVEELASLLKLPLNEDRFYVETHA
    KLAPIDFPTAGIFLCGAGHAPKLAAEAIAQAEGAVARACTILARENLMVGGVVAVVDENKCAACLTCVRVCPFNVPRINE
    RNVAEINAVQCMGCGTCAGECPAKAIQLQFYKDDQLLAKVAGLFGEV

    >gi|83590201|ref|YP_430210.1| methylated-DNA--protein-cysteine methyltransferase [Moorella thermoacetica ATCC 39073]
    MTRLHLTINHYNSPVGILTIVTSPAGLCRLAFAAEPAAVTSTYLTKVFPGVAITTGEQDSLARETMVQLDEYFAGRRRTF
    NLPLDLHGTPFQRSVWAALLEIPYGTTCSYSDLARAIGRPRATRATGQAIGSNPVGIIIP
    CHRVIGKNGRLVGFGGGLAV
    KEWLLGFEHRVNQTSGGK

    >gi|83590277|ref|YP_430286.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Moorella thermoacetica ATCC 39073]
    MKGTDVLVIGGSAAGLTAAITAKRYFKDKKVTVVRKEEKVLVPCGIPYIFGTVGSPDKNLIPDATLVNNGIELVIDEVIG
    IDRQSKAVSTVKSGSITYEKLVLATGSSPVVPPVKGADLEGVFVVKKDVAYLEQLKKALDKAKNLVIVGGGFIGVEFADE
    CRKGRELNITIVELLPHCLALAFDDEVCTMVEDKLRSQGINIITGTKVEEFLGNGKVEQVRLSNGETLPADIVIFGIGVA
    PNIELAQMAGLKVDHRFGIWVDDYMRTSDPSIFAIGDCAKKSSFFGHGPSLIKLASVATHEARVAGANLFGLRRSRVAAV
    GVFSTIVGDLALGSVGLTERAAREAGIEVVTGTAKAPDRHPGSMPGTRELGVKLIFTKDTGVILGGQVYGGTSVGELTNL
    LAAAVQHKMRADELETMQVGTHPALTASPVAYQVTNAAEDAVLKLRS

    >gi|83590297|ref|YP_430306.1| 4Fe-4S ferredoxin, iron-sulfur binding [Moorella thermoacetica ATCC 39073]
    MKKDALPVAVLGAGIAGVQAALDLSRLGYQVVLLERSSRPGGKLTALPKTFPTNDCSACVLSPPDSFFCIRSPHFIKQGS
    DNITLLTGVEVKKLTRNPGNFSLHFYREGREEELNAAALILCPGYEEYLPANLDARYGYGRYPGVLTGLELEQRLGAEGY
    LCRPGDNGPLQQVAFIQCAGSRDPAGGVAYCSAVCCMYALKEALMLYEGAAARKLPLPEITLFYMDLRTYGRAYESYLAK
    ARQEYGLKLVRSRIHSIIQLPGNPRLTIRYAPEEGPARVAEFDLAVLATGLRPPDGARDLAAALGIELDTHGFCQTSPLA
    PVSTPQPGIFVAGAFSGPCDVIDAVTQGSAAATACAAWLKENGAGPVKSPLLPPSSGAVDPSPRTGVFICGCDRLAANLD
    LKGLEEYCRSLPGVDTVRELSLCDPQAGEEFLRAINENGLGRVVVAACSARALEPVLKARLDQAGLPGVGLKIVNILDHA
    ARIYSGRVEMATRKAGDLVRMAIAGIKATAPYMNDAITVAPATLVIGGGAAGMTAALHLGDLGYEVHLVEKESQLGGNLL
    RMQRTLRGADVQAWLAGQIRRLMQHPRIHVHLDARILDTSGKPGSFQTEIEIAGERRESITHGVTILATGAGEKKTQQYL
    YGQHPAVVTALELEDLLKTRSPRPAGAQRVVFIQCVESRDAGHPYCSRTCCSETLKNALELKKINPAAAIYVLNRDIMAY
    GLQEQWYEAARSRGVVFLHYQPGEPPRVTPLAAGTGPEDKLLVRAYDAILEEEVTIEADLLVLATGMEPPAENRRLAALF
    RVPLDERGFFATSHPKLKPVETPVPGIYTCGLAAGPGNLEEALASAQAAAGKAAADLARERYELHRQVARVEGACAACLT
    CVRVCPHGAPAIKDHRSHIDPLLCQGCGACVAACPARAITLTGYSPTEIEAELQALSPEAGKVQSTVIFTCSY
    CAYANSE
    NVGSTSCPDDVSILQVPCLSRVGTLEVLRAIEAGARQIVLTG
    CVAGQCHFRPARAFGSQGPGPDPMLCQEQAWRRARKIL
    GELGFDEDTVKVLRLPPPTPGRGQPLI

    >gi|83590298|ref|YP_430307.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Moorella thermoacetica ATCC 39073]
    MKRTDILVAGGGIAGCTAALAARRYYSDKKITLVRREVRALMPWGLAYACGAGSLNEYILGDSRLYKEGIELVIDEVTAI
    DPGGKRVTTAFGEKIAYDKLILAIGSSPVTSLLQGTELPGVFVLKKELPYLKSLKEHLARARNVVIVGGGLNGVELAAAC
    SANHQLHITLVEQLPHCLSGVFNDDTCILIEEKLRRKGVAIITGAAAEGLEGCHRVEGVRLTGGRTLPADVVVLATGIVP
    NTLLARQAGLATDENAGILVDEYMQTSATDVFAIGDCAAQKSLVPTGGSLTRQAGPAGHEARVAAANLFGLKRAREITVK
    KISVAIGDLVFGSVGLIKISLAETGTGMPTTALAHDVIAKDLAVKVVYVRETGATLGAEVYGKPLIRVRETMNNLASAIE
    RQTPFAGLALA

    >gi|83590329|ref|YP_430338.1| OsmC-like protein [Moorella thermoacetica ATCC 39073]
    MQVTVTWEGEKMRLKGVGASGQPVAMDAGTDHGGQNQGARPSEVLLMGMAGCTALDVLTILQKKRLSLTSFAIDVEADRA
    TTDPKVFTSATLIYRLEGPDLPESQVKQAIELSLSKYCGMVNTMKKAMPISYCYEINGSRSAVEPAP

    >gi|83590460|ref|YP_430469.1| redox-active disulfide protein 2 [Moorella thermoacetica ATCC 39073]
    MELKVLGGGCANCHKLEQLCRQVVDELGFQASVELVTDIKEIMKYGIMSTPALVVNGKVAVAGRVPDKARLTSILTSAAA
    E

    >gi|83590501|ref|YP_430510.1| hypothetical protein Moth_1665 [Moorella thermoacetica ATCC 39073]
    MPDLRRPNRLIHEKSPYLLQHAYNPVDWYPWGEEAFARAKREDKPVFLSIGYSTCHWCHVMARESFNDEEVAALLNDSFI
    AIKVDREERPDIDQVYMAACQALTGSGGWPLTVFLTPEKRPFYAGTYFPKHNRYGRPGLVELLKLIREKWATHREELEES
    GAELIQHVAGQFAPTPPGEPGAQVLEKGWQQLRAGFDPLYGGFSEAPKFPSPHQLLFLLRYWKRYDEAGALAMVEKTLQA
    MYCGGIYDHIGFGFARYSTDRRWLVPHFEKMLYDNALLALAYLETRQATGKAVYSHVAREIFTWVLRDMTSPEGGFYSAL
    DADSEGEEGRFYLWTPDQVREVLGAKEGEFFCRYFDITAGGNFEGRSIPNLIGRGEALFAAGTSGNESNDTAGDQRQPRE
    QGGRAGGISGGGGCAKGSPEEDRLPGRGPTTLAGFGPATAARLAAAREKLFAAREKRVHPHRDDKILTAWNGLMIAALAR
    GAWVLDEPAYAAAAARAARFILTHLRDAEGRLQARYREGQAAFPAYLDDYAFLTWGLIELYQATFETGYLREALALTRQM
    QELFRDEGGGYFFTPHGAGELPVRPREVYDGAIPSGNSVAALNLLRLARITGDSRLEEEAAAQVRALAGTVAEYPRGYSF
    YLCALDFYLGPVTEIVLAGERETEDTRALLRVLRAAYLPSAVLVLRPGGREGEEVTRLIPYTAGQKPVNGKATLYLCRNF
    ACRAPVTTAGELEQWLASAGREAHGAGDTFNE

    >gi|83590509|ref|YP_430518.1| thioredoxin [Moorella thermoacetica ATCC 39073]
    MAASNIITLTDANFEEEVLSATTPVLVDFWAAWCGPCRMIAPIVDELAQEYAGKVKVAKLNVDEYPKIPADYGIMSIPTL
    ILFKNGEVIARTVGYQSKEKLAQVLENNL

    >gi|83590598|ref|YP_430607.1| dihydrolipoamide dehydrogenase [Moorella thermoacetica ATCC 39073]
    MSYQIAIIGGGPGGYVAAIRAAQLGAKVVVIEQDALGGTCLNRGCIPTKALLAGAAMVRGIKGAAAFGIDVEDYRVDYAR
    LAARKDAVVKQLTGGIAYLFKKNKVDLIKGRGFLKGPGQIEVATADGTIENLQAENIILATGSEPALIKALGYNGRTVVT
    STEALAWTEVPAELLIIGGGVIGCEFATLFATLGSKVTIVEMMPAILPMIDSEISRRFSMLLKKTGVEIKTKAQITEVKE
    AGGRVQATLADGQTINADKVLISIGRQFNTRGLGLEDAGITLGPKGEIVVDEYLRTSVPGIYAIGDVTNKIQLAHVASAQ
    GLAAVTTIMGRPTKVNYDAVPSCIYTLPEIAGVGLTKEAAEGRGMKVRVGKFPFQASGKALCSGETDGMVKIIAEAESDR
    VVGVFIMGPHATELIAEGALAVNKGITAGELAATIHAHPTLSEAVMEAAEAVHGLSIHS

    >gi|83590663|ref|YP_430672.1| peroxiredoxin-like [Moorella thermoacetica ATCC 39073]
    MQPKWRVPLLIILLMVAVLALAFFLPHRGDQVRAPDFTLPALDGNQVDLKRLQGQVVVLNFWATWCPYCVAEMEELDAAA
    GRLAPRGVKVLAVNIMQRETIQGIRAFLGEKRHNYLVLLDRGSKVADAYGVSGIHTTFIIDRQGRLRRVKKGPLGPGELD
    RLLQDII

    >gi|83590726|ref|YP_430735.1| OsmC-like protein [Moorella thermoacetica ATCC 39073]
    MAKTTFTATVRWTGEGLYCQGQARGFQVAVDEPQELGGTDKAMNPVELLLCALGGCMSICAAAFAPACHVELKDFRVELE
    GDLDPDGFLGKNRDVRKGYQQIRYRIHIDSPSPERNIKRLLDLIEERCPVSDTLKGVEVVKQVTGDDK

    >gi|83590802|ref|YP_430811.1| UBA/THIF-type NAD/FAD binding fold [Moorella thermoacetica ATCC 39073]
    MALSNEEIERYSRQIILKNIGGRGQERLKQGKVLIVGAGGLGSPVAYYLAAAGVGTLGIIDSDNVDLSNLQRQILHTTGR
    LGQPKAESARETLLALNPALTINTYPLRLGKENILDIIRDYDVIVDGVDNFPTRYLLNDACVMTGKTLVEAGVLQWDGLV
    MTIKPGQGPCYRCIFPDPPPPGAVPS
    CQEAGVVGPVPGVIGCIQATEVLKILLATGETLTGRLLIYNALEMRFREIKAER
    NPDCPVCGDNPSIRELEEYTFVCETQCGR

    >gi|83590824|ref|YP_430833.1| heavy metal translocating P-type ATPase [Moorella thermoacetica ATCC 39073]
    MTVNVTSNLAQVNLPVQGMSCAACVAKVEKALKNMPGVEEARVNLLTGRAAVKYHPDRVSIPQIARTIQEIGYEVPEEEM
    LLTVRGMS
    CAACVAKVEKVVKGIPGVTSVAVSLPAESARIRYYQGTVDRARIKKEINALGYEATEKISGQAALDREKEAR
    EREIRYQRRNMWIAWPLATLVMIGMFRDMWIFPYFVPKWLGNVYVLWALTTPVAFIPGWQFFVHSWNGLKRGATDMNLLY
    ATGIGAAYIIATINTLWPEAGFGGRGATFFESAALLTAFIVLGRYLEAITRGRTSEAIRKLMSLQAKTARVIRDGQEMEI
    AADEVEVGDIVVVRPGESIPVDGEVVEGYSAVDESMITGESIPVEKRPGAQVVGATINKTGSFKFRATRVGSETALAQII
    KMVEEAQASKAPIQRLADFVAGHFIAGVHVLALIVFFFWFFIGYDAFFRPDSHFILSPYSLAQVGVFGFALLLSVTTLVI
    SCPCALGLATPSAVMAGTGKGAENGILFKGADAVEASSKLNAIVFDKTGTLTRGEPSVTDVIVAPGFEQKEILRLAAMAE
    KTSEHPLGEAIVRNAVEKGLELEEVEDFEAIPGHGVRAIYQGREILLGNRRLMQQRNIAISDLAGHMEKLEEEGKTAMLM
    AVDGRAAGIIAVADTLKEHVKVAIERLHKMGIQVAMITGDNRRTAAAIARQVGIETVLAEVLPQDKAEEVKKLQEKGLKV
    AMVGDGINDAPALAQADVGIAIGSGTDVAKETGDIILIKDDIRDVVGAIEIGRATMRKIKENLIWAFLYNSLGIPIAAGI
    LYPITGLIVSPELASFFMAMSSISVTLNTLTLKRFRPSLRAEREEAVPRHRPAPQAG

    >gi|83591026|ref|YP_431035.1| heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase [Moorella thermoacetica ATCC 39073]
    MRYKLAGLDCAGCAARLEQELRRVKGLEKATINFAARSLDLPPEMLPAAREVIARVEPEVRLIETDGDETREENEKARRN
    LYRIIIATLLLVPGLIFNERLHRTPYFWAEYAVLLAAYFLVGWPVIRTALRNLARGQFFDETFLMTVATAGAIAIHQLPE
    AVGVMLFYAVGEYFQERAVNRSRCSIAALLDIRPQYANLKLNGETKRVRPEEVEVGQAIVIKPGERVPLDGEVVDGVSFV
    DTSALTGEAVPRKVEKGEPILAGMINGHGLLTVRVTRPFEESSVARILELVENAATRKAPTEQFITAFSRYYTPAVVLGA
    LALAVIPPLVLPEAAFSTWIYRALVLLVISCPCALVVSIPLGYFGGIGSASRRGILVKGASFLDALPALHTVVFDKTGTL
    TRGVFRVSRVVPYNGFTPEELLYTAAAAELYSNHPIAQSIREAWGSEISPDQVKDYHEIPGHGIRAVVKGRQVLAGNDRL
    LHREGIVHEVCSVEGTGVHVVIDGTFAGYIVIADEVKPDAGEAVARLKELGVKRIVMLTGDEEAVARRVARDLGIDAYFA
    ELLPEDKVAKVEELEASLPDRRRQKLAFVGDGINDAPVITRADVGVAMGGLGSDAAIEAADVVLMEDAPSRLADAIEIAR
    YTGLIVRQNVVLALSIKAFFLILGVLGVATIWEAVFADVGVALAAIFNASRTLRYRPSTL

    >gi|83591135|ref|YP_431144.1| respiratory-chain NADH dehydrogenase, 51 kDa subunit [Moorella thermoacetica ATCC 39073]
    MGEVVFSTWGGKVVDHRGGPSGGGPSWAGEFGGRQLKAFIGWDGLVVTDPAVDLLAALQAYYQAVQGESCGRCVPCRVGT
    RVIYNVLVRIAGGEGLPSDLDLLRRVAWIVRDGSLCELGQAGAKAVLDFLDYYSEALRPFLEDSGRVAGGQRRPGPGGRV
    QVLASGRVLVGNDRGKGAAAASPAAGLTYKPFVTAPCLKRCPAHLDIPAYIDAIKDGRYEESLAIIRQRTALAGVLGRVC
    VHPCEENCRRGNVDEPLAIRGLKRFVADYEVKRGRRPVAVCGGNLFTGPWRPAGQAGGEETTAVTSGKKVAIIGAGPAGL
    SAAYQLAGRGYKVTIFEALPVAGGMLAVGIPSYRLPRDILAGEIEAIKALGVTINLNTRVGVDVTMDQLQRDYDAVFIAT
    GLHASSRMGVAGEDEGYGGFIPGVKFLRDLNLDR
    CPSLEGKVVAVVGGGNVAMDCARSALRRGAREVHLIYRRSRAEMPA
    HATEVRDAEAEGVIYHFLVNPTALVAEKGNIKGMQCVRMKLGEPDDSGRRRPVPVPGTEFFLPCDIVVPAIGQAADLSFL
    DGRIEVGKRGTISVDPVTLATSVPGVFAGGDIVLGARTVVEAVAQGNRAAVSIDQYLRQGTTSPTVEDELDAWLEKVGVY
    DPEEDVGIYGGRPRQAERVAPLAERVKDFREVEGGFDFYAGRAEAERCLRCYRVGMMVLAGEGESNG

    >gi|83591235|ref|YP_431244.1| copper ion-binding [Moorella thermoacetica ATCC 39073]
    MKKVAEVTLQVEGMSCNHCKMSVERALKNLDGVTAATVDLGARTAHVTYDSSRVDIEAMKKAISDAGYEVK

    >gi|83591236|ref|YP_431245.1| thioredoxin reductase [Moorella thermoacetica ATCC 39073]
    MVYDLMIIGGGPAGLTAALYGARGGLNTILLEMGAPGGQAGQTDRIENYPGFPDGITGIDLAMKFAEQAQRFGARLEMTT
    VREVDFSGANKKVITSNGEYEARAVIIASGAHPRPLGVPGEAELRGRGVSY
    CATCDGAFFRDKKVAVVGGGDSAVEEALF
    LTRFASQVTIIHRRDALRATRVIQDRARDNPKISFQWNTVVNAIQGKDKVSSLQLKDVRTGALREEPFDGVFIFIGLEPN
    TDFLGGALTLDPDGYIVTREDLATSIPGVFAAGDVRAKNFRQVSTAVGDGAVAAMAAERYLANL