Mobiluncus curtisii ATCC 43063 uid49695

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|298345186|ref|YP_003717873.1| NrdH family redoxin [Mobiluncus curtisii ATCC 43063]
    MTDTEVLTIYSAPNCMGCKMTARALQKAGVKFKLVDLTTLSPEAIEAFKAEGLMQAPIVRTGEGDQWSGFRPDKIKQTVE
    TMPADQVDEALAKIYEERFGKPMDTAKPTQEATQRERKPKPRRQ

    >gi|298345730|ref|YP_003718417.1| NrdH family redoxin [Mobiluncus curtisii ATCC 43063]
    MSITLYTKPNCVQCNATKRALDKQGLDYETVDLTEDVNALDHIKSLGFQQAPVVFAGDDAWSGFRPDKIKALAVTALAAA
    I

    >gi|298345775|ref|YP_003718462.1| thioredoxin [Mobiluncus curtisii ATCC 43063]
    MAVNIVTQENMAQAMSENDIVVLEFWAPWCSPCRLFTPVFEQASLRNQDVYFGTVNTEEQKPLVSAAGIVSIPTLMIFRQ
    SILVFREAGLLQGTQLDELLHQVRNLDMAQVAAGQGVAQ

    >gi|298345796|ref|YP_003718483.1| peptide-methionine (S)-S-oxide reductase [Mobiluncus curtisii ATCC 43063]
    MMVPHETKQETTHPVLHTSITGPWPEPHEVIYFAMGCFWGVERIFWSQPGVINTAVGYMAGQQPTPSYEEVCTGITGHAE
    TVRVVFDPTATTAGELLKVFWENHDPTQGDRQGNDRGSQYRSLVICTTPEQRELAEVSRRNFGATLAGAGRGAITTEILD
    ADAVGQFWLTEDYHQAYLFHHPHGYCNHGFKGFVCEVPVRL

    >gi|298345827|ref|YP_003718514.1| thioredoxin [Mobiluncus curtisii ATCC 43063]
    MSAAIEVTESNFAAEVLESDVPVLVDFWAVWCGPCRQMAPIVDQIAADFGDRLKVAKCDVDKNPSLQAQYGVSAIPTFNI
    FKGGKVVHQIIGGRPRSQFKEEIEAALA

    >gi|298345828|ref|YP_003718515.1| thioredoxin-disulfide reductase [Mobiluncus curtisii ATCC 43063]
    MNIGGMLMNTTLVENYPGFKDGIQGPDLMQEMLDQTERFGVEIIYEDAQKLDLRGDIKTVVTDEGTYQGRTVIIATGSGY
    RTLDVPGEEEHAGHGVSY
    CATCDGFFFRDQPIMVVGGGDSAMEEAVFLTHYGSSVTVVHRRDELRASAAMQAKAFKEEKI
    SFEFDTVVESINGTDKVESVTLKNAKTGDTKTVPVGGIFIAAGHLPRTELVRDQLELDALGNIWVDSPSTRTSMPGVFAA
    GDVTDGIYRQAVTSAASGCRAAIDADRYIKDHDAQVN

    >gi|298345863|ref|YP_003718550.1| copper-exporting ATPase [Mobiluncus curtisii ATCC 43063]
    MTHNETTASPSADPAVDSALDPAGLRRQDLGRRLVVALIFCLPVMAISMLEVLQFPAWQWVVGVCSLPVVGWSAAPFHRG
    ALRAARGGSTTMDTLVALGVSVATLYSWGALILTPAGRIGMTMNMSLNPLAAAHETGSGGEIFFETAVMITVFLLTGRYL
    EARAKSSATSALRALLSLGAKQAVRVTRPGDPRDPATPWETETIDVAALQPGDYFLVPAGEKIATDGIVFEGHSTVDESM
    LTGEPIPVEKSVGDSVTGATINVQGLLVVEATKVGAETKLAQITRLVTRAQAEKSPVSRLADRVSTVFVPVVIALAVLTF
    ALWLGRGHPFPTAFTAGVSVLVIACPCALGLATPMALLVGSTRASRAGILLKGPQILEETRRINTLVMDKTGTLTTGEMS
    LEDVTVSAPRSAGMASLGNTQALALAAALETGSPHPIGKALVAAAKARDGGGGSGALTGFATFIGRGAGGFVDGVAYAIG
    KPEWLTAMGADIPPDLGAAIGSAQSQGRTVAVLATGADWSSQVSGDACPVLSSEPAGNGQLAAERAGREMTLKVTGMT
    CA
    SCVARVEKRLNKLDGVSAVVNLPLEIATVTLTADVPAETLIAQVEKAGYGASLLDSAGTADKPDRLSENNVAAVAGDLLQ
    ARALAVFTFSDPVKPEAAHTVASLKAAGIETVLLTGDQPEPAHRAANQAGIETVVAGVSPEGKVATIRELQDAGKIVAMV
    GDGVNDAAALAAADLGIALATGTDAAIGAADITLVNPSLEAITQAINVSRATLRNIKQNLAWAFGYNIVAIPLAAAGMLN
    PGLAGAFMASSSVLVVLNSLRLNRVHL

    >gi|298345931|ref|YP_003718618.1| peroxiredoxin [Mobiluncus curtisii ATCC 43063]
    MEQKLSVGDAAPDFTIETTEGAFHLVEALQSAKAGVVVYFYPRAMTPGCTTEACDFRDSLNSLKSAGYTVIGISPDEIPA
    LEKFRDKQTLNFALGSDPEHTVLSDYGVWQVKPLTKKLGVVRSTFVVSPDGTLTSAKYNVRATGHVARLRKELGLD

    >gi|298345954|ref|YP_003718641.1| putative DSBA oxidoreductase [Mobiluncus curtisii ATCC 43063]
    MSDKNKSVERSAANVWALKIIGVLAVLVLLAIAFFLGRTTAPGANTPAASPSSPQKTTAGGATAGDAQKAVADFVAQTGL
    VPGQDFASSVTNEGGLKAMKILRDGADEPERTLGKPDAPVTLTVLSDFS
    CPMCTSWGNDTLPKLQKYVDDGTLKIQWHNM
    VIFADQYQSDIAAKASIAAMKQGKLWDFVRAAYHTAPEGEHPTYDENKVIQIAQSIGITDLGRFKTDMNSPEAQATVSEE
    TDSGHSVGVNGTPFFVLGDSTISGAYPIEYFEHSIEYQKFLATK

    >gi|298346025|ref|YP_003718712.1| peroxiredoxin [Mobiluncus curtisii ATCC 43063]
    MAILTIGDEFPEYDFQAVVGGVLSELPVNKEEDYFTRVRSADVPEGQWRLFIMWPKDFTFVCPTELAGIAGVYEDLQERH
    CDVVAVNTDSEYVHLAWRSRDELLKNVPFPLASDLTHDFLKAVGVLNRDGVCDRASFLVDPDNRVRFVSVDDGSVGRNAE
    ELVRQLNALQSGGLTSCGWHPGEPTLDVFKAATNMVSLSI

    >gi|298346086|ref|YP_003718773.1| CoA-disulfide reductase [Mobiluncus curtisii ATCC 43063]
    MKLVVVGGVAGGLSFAARMRRLDESAEIVVFEKGPYPSFSNCGLPFYVGQEIPARESLLLNTPQSLQAKLNLDVRVNHEV
    IGLDAEAKTVRVCGADGREFTEGYDKLILSPGAKAARPPIAGLDSLRVRTLRTVNDAQRIVDLAESARSALVIGGGFIGI
    EAAEALARRGINTTIVEGGAHVMPPLDLEMAHLVTGALQSLNITVIANTRVTQIRDFPAHVLAELSDGQCLETELIVLAA
    GAIPATEPFVAAGVRADERGYLEIDQHGRTSLPDVFACGDAVTQQTGVTGMARPVALAGPTNRAARLIADFIADPKSARP
    LPKPISTSIFRVGPMTVAQTGANRAELDAQGIAYRTIHTHPTDHGTFLPGAQPMQLMLHFAAADGKLLGAQGIGGNGVDK
    RIDVIATAIKAGLTAPDLIDLDLAYAPPYSAAKDPVNFLGYVAENVLRGRLKLWYAEEVAHLDPGTPVLDVRPIPEFNAG
    HLKGARCIPLTELRSRLDEVRTWVDGKTVYLSDDTGANAWTAQRILESAGINAKVLSGGVNTVFAYYFDNPGAVLEM

    >gi|298346241|ref|YP_003718928.1| thioredoxin [Mobiluncus curtisii ATCC 43063]
    MNVPAELHDIPAGQDGEAGSGGSGTPQTIPGPLVRDVTDETFSQLLELSKTVPFLLDMWAPWCAPCRQLGPILEKAVAQA
    GGRVALAKVNVDESPAIGQAFRVQSIPAVFLLMNGQPAPLFNGALPASSVQEVINKVIALAQKEGVTGRVETDGAETAGQ
    AGANGVTGTATPAPDAPSAMPEEIETALKLQAQGDYDQAIETLETYLKANPGESSKVNPLLAKVRLQARSAEAKPATETA
    GSTATGEVAAQLEAADAQMNAGDAAGALSRLLAVVAETSGEDRDAARARLVEYFAILGDNPLVPQIRSKLATLLY

    >gi|298346732|ref|YP_003719419.1| putative dihydrolipoyl dehydrogenase [Mobiluncus curtisii ATCC 43063]
    MGEEQYDVVILGGGNGGYACALRATSLGMSVALVEADKVGGTCLHRGCIPTKALLRAAEVADTVHESGEWGVVSAYGGVD
    MAKVREFQSGIINKMHRGLSGLIKSHKVEFVNSRGVLSGIDTVTAGDRVLKGQNIVLASGSVTKTLGMNLGGHIIGSEHA
    LFLDRVPNSVVILGGGVIGVEFASVWKSFGADVTIVEALPHLVPNEDEDVSKGLEKAFRSRGINFMTGTRFQNAIEDEYG
    VTVNTEDGQTLRADYLLVAIGRGPNTANMGYEAQGIPMDRGFVLANERLHTGVGNIYAVGDIVPGLQLAHRATMQGVFVA
    EEVAGLQPRVVPNDNIPRVTFCEPEIASVGLTEAKAKEVYGADNVITKQSNMLGNAKSQMLKAAGFVKLIQVKDGPIVGF
    HALGQRIGEQIGEGQLIVNWEADAEDLAYLMHTHPTQNEMIGEAAMALAGKPLHG

    >gi|298346811|ref|YP_003719498.1| peptide-methionine (R)-S-oxide reductase [Mobiluncus curtisii ATCC 43063]
    MTVNLSDEEWKERLSPRAYAVLRQAATERPGTGELLFESRDGLYSCGACGATLFDADTKFDSGCGWPSFFEAKPGAVREV
    TDTSHGMTRTEVRCANCGSHLGHVFPDAPQTPTGNRF
    CMNSVALSFQPQE

    >gi|298346931|ref|YP_003719618.1| HesB family protein [Mobiluncus curtisii ATCC 43063]
    METSPLTHEVTLTDAAVAKIKSLLEQEGRDDLRLRVGVAPGGCSGLIYQLEFDDELSEDDAVRDFDGVELVVDKMSVPYL
    AGATVDFQDTLAQTGFVIDNPNAANTCSCGGSFH

    >gi|298346966|ref|YP_003719653.1| thioredoxin peroxidase [Mobiluncus curtisii ATCC 43063]
    MATTHLQGNPVNTVGSLPAVGSPAPDFVTVKQDLSEVKLSDLRGKTVLLNIFPSIDTGVCAASVRRFNAETAQLEGVEVI
    CVSRDLPFALGRFCAAEGIDHVTTTSAFRSSFGEDYGVQIADSPMAGLFARSIVIVDPNGVVKYTQLVDEITTDPNFEDA
    LKALN