Micromonospora aurantiaca ATCC 27029 uid42501

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302864552|ref|YP_003833189.1| DSBA oxidoreductase [Micromonospora aurantiaca ATCC 27029]
    MDIEIYADVVCPWCWIGKRRLEQALESYDGEVNVRFRPFQLDPTPVTEPKPLLEALGDKFGGRDKAEGMAAHVTGVAAGA
    GLDLRFDRAVAANTFDAHRLVRFATEHGRSAEMVERLYRAHFHDGVDVGSIDALVTLAGEAGLDETEARQYLESNLGRRE
    VAADLSTAHQLGVSSVPTFVLAGKYAVTGAQEPETLLAALREVAQREAAA

    >gi|302864574|ref|YP_003833211.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MPVPSDPHPHLQSYADPQRLVTTEWLAEHLGDEGLVVVESDEDVLLYDTGHIPGAVKVDWHTELNDQVTRDYLDAASFAE
    LCAAKGIGRDDTVVFYGDNFNWWAAYALWVFSLFGHQDVRLLDGGRQKWIAEGRELTRDKVSRPRASYPVPERNDAPIRA
    YREQVMAHVAAGRPLVDVRSPGEYTGEMLHMPDYPQEGALRGGHIPGAVSKPWKSAANDDGTFKSADELRAIYGDQLGLS
    PSDDVVAY
    CRIGERSSHTWFVLHHLLGFPQVRNYDGSWTEWGNLVRAPVVKGDQPGGLTR

    >gi|302864652|ref|YP_003833289.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Micromonospora aurantiaca ATCC 27029]
    MSARVRAPELRGRAWLNTGGKAVTLADLRGKIVLLDFWTFCCINCLHVLDELRPLEDKYGDVLVVIGVHSPKFEHEKDPA
    ALAAAVERYGVHHPVLDDAEMDMWQQYAAKAWPTLAVVDPEGYVVATMAGEGHAEGLARLIDELIAGHEAKGTLHRGEGP
    YVPPAEPDTVLRFPGKALPLDGGNLLVSDSARHSLVELAADGETVVRRIGAGSRGRTDGPASAATFAEPQGLCLLPPHVA
    EVAGYDVVVADTVNHLLRGVRLSSGEVVTVAGTGRQWRSTVDDHAHDARAVDLSSPWDVAWYDDRVVVAMAGIHQLWWFD
    PIKRTAGMYAGTTVEALRDGPLPDVWMAQPSGLSVSADGSRLWVADSETSAIRWVSDGEMHTAVGQGLFDFGHVDGPADQ
    ALLQHPLGVCALPDGSVLIADTYNGAVRRFDPETGQVGTVADGLAEPSDLVLTGEGDVLVVESAAHRLTRLAPGALTSAG
    ANTVDGPRHRLERKPTDVAAGELTLDVIFTPAPGQKLDDTYGPSTRLVVSASPPELLVEGAGTTTDLSRKLVVSGDVAQG
    VLQVTAQAATCDADIEHAACHLTRQDWGVPVRVVTGGATRVPLVLRGMDES

    >gi|302864755|ref|YP_003833392.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Micromonospora aurantiaca ATCC 27029]
    MAEPELVDVVVVGLGVGGEEVAGRLAEAGLTVVGIERDLVGGECPYWGCVPSKMMIRAANALAEAHRVNELAGSAQVRPD
    WAPVAKRIRAEATDTWDDKVAVDRFTGKGGRFVRGSGRLDGPNRVRVGDQVFQARYGVVLGTGTRPSVPPIDGLADTPYW
    TNHQAIEVEELPASLLVLGGGAIGLELAQVFARFGVRVTVVEAADRVLAVEEPEASALAADALRADGVEIHTGVKASRVS
    HDGTTFTVHADGAEFTGEKLLVVTGRKAHLEELGLDTVGVDAGQRYLPVNDRMHVTDGIWAVGDLTGEGAFTHIAMYQAG
    IVVPDVLDHMRRTKGGPDASGTASVVGGAAGVVSAVGGAMSAGGSTAAPGSVPVADYRALPRVTFTDPEVGAVGLTEQQA
    RERGVNVQVGYADLTSSARGWIHKTGNAGFIKLIADADQGVLVGATSAGPAGGEVLSALVVAVHAAVPISQLRHMIYAYP
    TFHRAIEDALRALK

    >gi|302864843|ref|YP_003833480.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Micromonospora aurantiaca ATCC 27029]
    MLTRRLAAALLAAVTAGTVLVGCSSGSQESRCAADGSTVTCAPDQRSKTPKVSGELLTGGSYDISRDRGQVVVVNFWGSW
    CAPCRAEADDLEATYQATKGSGVTFLGINVQDSKDKAIAFEEGRVTYPSIFDPASRQALNFDIPPNTTPATVVLDREGRI
    AVVIRRAVTRDELRPIVEDIAAEAPPPNGAR

    >gi|302864850|ref|YP_003833487.1| AhpD family alkylhydroperoxidase [Micromonospora aurantiaca ATCC 27029]
    MSRFTAYEPDTAPAAARPVMAGVRRSLGHLPAAVSLMAGSPELLKGFLAANAAFEATDLDPVAREVVVLTVATRNGCHLC
    VAMHTATLVRHGAAPELIEALRTGATLPDPRLEALRRFTVAVLDHRGAVPDADLDALLAAGWQARHALDVVLGVGTYTIS
    TFANRLTEAPLDEPLAAYAWQPAA

    >gi|302865051|ref|YP_003833688.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
    MPQDTGTGRLNPVTDDTFAATVLAADRPVVVDFWAEWCPPCRVVSKHLAELAEEFGDALRFVTLNTDENPATARAHRIMS
    APTMLVFRGGEVVGSIVGSRPKDHLRRSFAQHVDG

    >gi|302865081|ref|YP_003833718.1| heavy metal transport/detoxification protein [Micromonospora aurantiaca ATCC 27029]
    METTYQVNGMTCGHCVNSVSTELSALPGVTDVQVDLAGGRVTVTSQNPLDVDTVRAAVDEAGYDLVGV

    >gi|302865083|ref|YP_003833720.1| copper-translocating P-type ATPase [Micromonospora aurantiaca ATCC 27029]
    MTATGKALPTAPNLIELAIGGMTCASCAARIEKKLNRMDGVEATVNYATEKATVRYADDIAPADLIATVEKTGYTAVVPP
    PPEQAEAAAAGEPVDELRTARTRLWVSAVLTLPVIVLAMVPAWQFDYWQWASLTLAAPVVVWGGLPFHRAALINLRHGAA
    TMDTLVSLGTLAAFGWSLWALFLGDAGMPGMKHPFSLDITRGDGAGNIYLEAAAGVTVFILAGRYFEARSKRTAGSALRA
    LLELGAKDVAVLRDGQETRIPVGRLAVGDRFVVRPGEKIATDGVVEEGTSAVDASMLTGESVPVEVGQGDAVVGATVNAG
    GRLVVRATRVGGDTQLAQMARLVEQAQTGKAAVQRLADRISGVFVPIVIALAAGTLGWWLGTGSGPTAAFTAAVAVLIIA
    CPCALGLATPTALLVGTGRGAQLGVLIKGPEVLESTRRVDTVVLDKTGTVTTGRMALAEVLPADGEDADELLRVAGALEA
    ASEHPIARAVAEAAAEAGPLPPVGEFANAEGLGVTGTVDGRTVVVGRARLLRERGLDVPEEVERAATGAEAAGRTAILAG
    WDGRARGVLAVADAVKPTSRAAVARLRELGLKPVLLTGDNTTVAKAVAAEVGIDEVIAEVLPADKVDVVERLQREGRVVA
    MVGDGVNDAAALARADLGLAMGTGTDAAIEAADLTLVRGDLMAAADAIRLSRRTLAIIKGNLFWAFAYNVAALPLAAAGL
    LNPMLAGAAMAFSSVFVVGNSLRLRSFRPIG

    >gi|302865193|ref|YP_003833830.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
    MATVELTTANFDEVTGRDGIVLLDFWADWCGPCKRFAPVYERSSEKHPDIAFGKVDTEAQQELAAKFNISSIPTIMAIRD
    GVIVFAQPGALPESALENLIEQVQALDMDDVRKKLAEHNH

    >gi|302865321|ref|YP_003833958.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Micromonospora aurantiaca ATCC 27029]
    MSQIVIIGGGPAGYEAALVAAQLDADVTVVEAEGAGGACVLSDCVPSKTFIASSEVVTGYRDTEEFGVHSDGLEAVTVDA
    RAVHERVKRLALAQSADIHTKLVKAGVEFVAGTARLGEDTLGHTHRVIVTPADGGAEYSIAASTVLVATGATPRQLPTAV
    PDGERILTWRQVYDLPELPEHLIVVGSGVTGAEFASAYLAMGVKVTLVSSRDRVMPHEDADAASAIERVFRNRGMSILNN
    SRAEAVRRVGDGVEVVLSDGRQVTGSHALIAVGSIPNTADLGLAEYGVELARGGYVTVDRVSRTNVPGIYAAGDCTGVLP
    LASVAAMQGRIAMWHALGEAVRPLRLRTVAANVFTDPELATVGVSQDEVDAGKTPARQVMLPLSGNARAKMDDLADGFVK
    LFCRPASGQVIGGVVVAPKASELILPITMAVENNLTVNELAHTITIYPSLSGSITEAARQLMLHELE

    >gi|302865427|ref|YP_003834064.1| peptide methionine sulfoxide reductase [Micromonospora aurantiaca ATCC 27029]
    MFLRRMKAEMISPDQALPGRPIAMPIADRHEVLPSSLKGPFPEGAQVAVFGMGCFWGAERLFWTLPGVITTSAGYAGGYT
    TNPTYEEVCSGMTGHAEVVQVVYDPSKIAYEDLLKVFWENHDPTQGMRQGNDVGTQYRSAVYTTTDEQLAAAKASRDAFA
    PIVARAGKGEITTEIAPLGDYYFAEDYHQQYLAPTKNPNGYCNHGPNGLSCPVGVARTSG

    >gi|302865439|ref|YP_003834076.1| N-acylglucosamine 2-epimerase [Micromonospora aurantiaca ATCC 27029]
    MNRLAEATSPYLLQHADNPVDWWPWCDEAFAEAKRRDVPVLISVGYAACHWCHVMAHESFENEAVARLMNDDFVCVKVDR
    EERPDVDAVYMTATQAMTGQGGWPMTVFATPDGTPFFCGTYFPRANFIRLLGSVATAWRDQREAVLRQGTAVVEAIGGAQ
    AVGGVTAPLTAELLDAAASRLAGEYDETNGGFGGAPKFPPHMNLLFLLRHHQRTGSARSLEIVRHTCEAMARGGLNDQLA
    GGFARYSVDGHWTVPHFEKMLYDNALLLRVYTQLWRLTGDRLARRVARDTARFLADELHRAGEGFASALDADTEGVEGLT
    YVWTPDQLVEVLGEDDGRFAADLFEVTADGTFEHGTSVLRLARDVDDADPEVRARWQDVVGRLLAARDTRPQPARDDKVV
    AAWNGLAITAIAEFQQVASLLVSPDDEDANLMDGVLIVSDGAMRDAAEHLATVHLVDGRLRRVSRDKVVGQPAGVLEDYG
    CVAEAFCAMHQLTGEGRWLTLAGELLDVALARFAGPDGAFYDTADDAERLVTRPADPTDNATPSGRSAIVAALVAYAALT
    GETRYREAAEKTLTTVAPIVDRHARFTGYAATVGEALLSGPYEIAVATGDPEGDPLVAAARRHAPPGAVVVAGAPDQPGV
    PLLAGRPFVDGKPAAYVCRGFVCQRPVTGVEELIAQLG

    >gi|302865687|ref|YP_003834324.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Micromonospora aurantiaca ATCC 27029]
    MTDRLKPGDPAPEFTLPTDDGGTLSLSGLRGRKVILYAYPAAMTPGCTKQACDFRDSLVSLQAAGYEVVGISPDKPAKLA
    KFRDRDAITFPLVSDEDKAVLTAYGAFGEKQMYGRTVTGVIRSTFVVDEDGKIEQAFYNVRATGHVAKLRRDLGLD

    >gi|302865813|ref|YP_003834450.1| AhpD family alkylhydroperoxidase [Micromonospora aurantiaca ATCC 27029]
    MGLDAIKAGLPEYAKDIRLNLGSTITTSTLKPEQAWGTALACAVAARNPVVLREIAAEAAGHLTPEAVEAAKGAAAVMAM
    NNVYYRAKHLIGDEQYASLPARLRMQIIARPGVEKTDFELWCLAVSAITGCGV
    CLESHEKTLRAAGFSREQVHEGLRIAA
    VVHAAAVTLDAEAALA

    >gi|302865814|ref|YP_003834451.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Micromonospora aurantiaca ATCC 27029]
    MLTVGDHFPEYELTACVSLDADKAFETINHKSHEGQWRVVFFWPKDFTFVCPTEIAEFGRLNGEFADRDAQVLGVSVDNE
    FVHYAWRKDHPDLRVLPFPMLSDIKRELTSACGVLGADGVAQRATFIVDPNNEIQFVMVTAGSVGRNVSEVLRVLDALQT
    DELCPCNWNSGGATLDAKALLAGAGA

    >gi|302866039|ref|YP_003834676.1| selenide, water dikinase [Micromonospora aurantiaca ATCC 27029]
    MTDAIRLTDYARGGGCACKIPPGELEAMVAGLGATGGSADLLVGLENGDDAAVVRLDERTGLVSTADFFTPVVDDAYDWG
    RIAAANALSDVYAMGGTPLVALNLLCWPRGVLPPEMAREVLRGGLDVAREANCHLAGGHSVDDDGPKYGLAVTGVVRPEE
    LITLDAGRAGLPLSLTKPLGVGVLNTRHKQTGQRFPEAVESMARLNRDAARAAIAAGIRCGTDVTGFGLLGHASKLARAS
    RLTVAIDAAAMPYLPGAREALRDGYVSGGTRRNLEWVTPWTDFGGADEGEQLLLADAQTSGGLLVAGEVPGGTVIGELLP
    ASEHLIRVR

    >gi|302866066|ref|YP_003834703.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MAATTDLLVEPDRLAAELDHADPPTLLDVRWRLTGPPGRDDHTAGHLPGAVFVDLDTELCGPPGAAGRHPLPDPAALQAA
    LRAAGVRAGRPVVVYDGGDGMSAARAWWTLRWAGHRQVRVLHGGFPAWTAAGLPVDTSVPAPVPGDVTVAPGALPVLDAA
    AAARLAAAGPGVLIDVRAAPRYRGEHEPVDPVAGHVPGAVNLPAPEYVTQGRFPAAEALRERFAAAGVDADAPVGAY
    CGS
    GVTAAQAVLALHLAGRPDAALYVGSWSEWVADPDRPVATGGTSGR

    >gi|302866129|ref|YP_003834766.1| methionine-R-sulfoxide reductase [Micromonospora aurantiaca ATCC 27029]
    MSLSDNELPRTEDEWRVRLSPEEFRVLREAGTEAPWTGEYVDTKTPGVYHCRACGLELFRSQDKFDSHCGWPSFDDAIPG
    AVKEIPDNTLGMRRVEIRCARCDSHLGHVFEGEGFTPKDTRH
    CVNSISVRLEPSAG

    >gi|302866485|ref|YP_003835122.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MGAMSNVLRIPAARPADALAHFAARLTFEADVSDVHADLEAGVTGLVVIDSRSLPAWRQGHIPGAVHLPTAEIAGRAGEL
    VPADATVVTYCWGPG
    CNGATRAAREFARLGRPVKEMIGGYEYWVREGFPVRTEAGLVRRPADDLTAPAGATCGC

    >gi|302867078|ref|YP_003835715.1| redoxin domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MTGAAVATRLPPIDVHRWVNSAPLTPQELRGRVVLVDVWEYTCVNWIRTAPYVRAWHRDYRDLGLTVIGAHAPEFAFGRL
    PENIDRAIRDHGLTYPIAIDDDYTFWRALRNDAWPARYLFDADGRLADRWIGEGGYDRTEALIRRLVEAATPTPALPPVT
    AEVTAFVTSPQPTYAGITPETYLGADRGVPGTYALTGDWRAEGEYVETGGAGAELVLPFTAGEVNLVADPGPEGPAAVRV
    LLDGKPAGDARGADVDPDGTAVVDRAAMIRLVDGATPGEHRLTLRAERPGLRAYVFTFGP

    >gi|302867226|ref|YP_003835863.1| hypothetical protein Micau_2752 [Micromonospora aurantiaca ATCC 27029]
    MAQTARMNAAFLPEPPQSPAAKAAYEDDLASDGYVNNLTRVWCWRPDVLMSFQNTRTELLSESTLSSREVAVLVAATAAA
    RGDSY
    CSLAWGARLAGMSDEETAAAVLRGDEADLSERETALADWSRRVVTDPNATTEADTRRLREAGLSDREIFEATTLI
    AFRLAFSTVNDALGARPDAQLAEKAPRLVREAVTFGRPV

    >gi|302867240|ref|YP_003835877.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MTTTTPTTIDAATLRELIAAGRTPRMLDVRTPGEFEAAHIPGAYNVPLDLLREHRAELRSHLDEDVVLICRSGVRAGQAG
    QALGTVGLPNVKVLDGGMLAWQATNAPVNQGRPRWDLERQVRLVAGSIVLAAIVASVFVPGLKWVAAFIGAGLTFAALTN
    TCAMGMLLSKLPYNRGASCDLDTIVGQLRDGSRK

    >gi|302867243|ref|YP_003835880.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
    MASVALTTTDFAETVNRDGIVLVDFWAGWCGPCRAFAPVYEKASEQHPDIVFGKVDTEAEQALAAAAQIRSIPTLMAFRD
    GVLVFAQPGALPTAGLEELIRAVRDLDMDEVRAKTA

    >gi|302867357|ref|YP_003835994.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MAQTPTRTERCPVPPPGSRGIDEILAAARTRLRRLDPEQAHLACRGGALLVDIRPAAQRAAQGTVPGSLVVERNVLEWRF
    DPRCAARLPQASGYDVPVIVL
    CQEGYTSSLAAAALQDIGLHRATDVVGGFAAWQIAGLPTLGPTPPTRPSSAAPPVAAGG
    ALR

    >gi|302867424|ref|YP_003836061.1| carboxymuconolactone decarboxylase [Micromonospora aurantiaca ATCC 27029]
    MAHIDLGLDEKAHPGIRGPLRFRPETAKPLGELAEVLLRAPHPTLTPGERELIAAYVSGLNDCDFCCSSHAAFAAAQLPA
    GMPLVDQVRADVGTAPVDARLRALLHIAAAVRRSGREVTTELVEAARAEGATDLEIHDTVLIAAAFCMFNRYVDGLGTWT
    PRDPEAYARAADHLVANGYLAI

    >gi|302867432|ref|YP_003836069.1| periplasmic binding protein [Micromonospora aurantiaca ATCC 27029]
    MSAPDRPRGAAVRATGMMAGMRLVSLLPSATEIAYALGLGDDLVGVTFECEVPARHRSGTTVVVGGRDTRGMSPGDIDAY
    VRAQVAAGADLYTLHAGALAGLDPDLILTQDLCRV
    CALPSGRVADAVEHLGCRADVLSLDPYTLDDVLESIRAVGAAARV
    PDRAEALVDGLRARLAAVGAAVAGRPRPRVAVVEWVDPPFGAGHWIPDLVDVAGGEPVATHRGARSTPTTWEALRAARPE
    VVLVAPCGFRLDGAAEQAAAVAGHFPDAQVWALDADGLIVRAGPRLVDGAETIAAILHPDAVPPPHPEAARHIP

    >gi|302867560|ref|YP_003836197.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Micromonospora aurantiaca ATCC 27029]
    MYDYDLLVLGSGPSGQKAAIAAAKLGRRVAIVDRRDMLGGVCINTGTVPSKTLREAVLYLTGLSQRDLYGSSYRVKEDIT
    VADLAARTQHVITRQTDVIRNQLARNKVSLITGTGRFADAHSVWVDAGSGRETRVSFDKAVIAAGTRPARPDSVDFDDRT
    IVDSDGVINLQAVPRSMVVVGAGVIGMEYASLFAALGTKVTVVERRPRMLDFCDEEIVESLKYHLRDLSVTFRFGEEVAA
    VEKHRSAALCVLRSGKKIAADTVMYSAGRQGQTDDLALEAAGLTADHRGRITVDADYRTTVENIYAVGDVIGFPALASTS
    MEQGRLAAQHACGEPARGMSDLQPIGIYTIPEISFVGKTEEELTDASVPFEVGIARYRELARGQIVGDSYGMLKLLVSPE
    DGRLLGVHVFGTGATEIVHIGQAVMGCGGTVDYLLDAVFNYPTLAEAYKVAALDAANKIRNITRIDT

    >gi|302867652|ref|YP_003836289.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Micromonospora aurantiaca ATCC 27029]
    MSTYPRVMSDAVGVGDLVEDFTLPDETGTPRRLSEFLAAGPVVLFFYPAAMTRGCTAESCHFRDLAAEFAAVGASRVGIS
    RDPVQRQAEFSRRHGFDYPLLSDVDGEVARAFGVRRRLPLGALSTRRMTFVIGTDRRVLAVVHSELSMNEHADAALRALG
    G

    >gi|302867772|ref|YP_003836409.1| thioredoxin domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MAFRDPPWQPGPVQSPSPTGIVVLVAVLAAATAFGWWRRRHDGRLRAVRKRPPGADAPHRATLTALGVRPGEVTLVQFSA
    PV
    CAPCRAARRVLADVAARLDGIAVLEVGVDEHLDAARELDVWRTPTVLVVDAAGRVVRRAAGVPDRDDLIAALTAGAAR


    >gi|302868126|ref|YP_003836763.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MHEVDVTTFATAHADGATVIDVRETAEYLGGHVPGARCVPLGHLATQMAQVPRTGPVYVICEAGGRSRVGAELLERAGIT
    ALSVAGGTSAWVRSGRPVTAGSRP

    >gi|302868128|ref|YP_003836765.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MLFTQYYLDCLSQASYLIADDRTGRAVLVDPRRDIDEYLTDAKAHGLTIEGVVNTHFHADFLAGHLEVAAATGAWIGYGS
    RAETEYPSRKLADGERISLGDVTLEIMETPGHTPESISILVYERADDPVPYGVLTGDALFIGDVGRPDLLASFGVTAEEL
    GRMLYDSVQHKLMGLPDEVRVFPAHGAGSACGKNLSTERQSTIGEQRRTNYACAPMSEERFLALVTGGQPAAPGYFAFDA
    VLNRKARELFDHARPARPLTPAEFLAARADGAVVVDARDPQEYATGHLRGALNVPADGRFAETAGSVVAPDRPVLVVAPQ
    DREEEIVVRLARIGFDRVIGYLREPEGAFLEMVAEMTRASRVTATELRAALDGPDAPVVLDVRNAGEREQGAVDGSRHIP
    LAELTHRLGEVPTDRPVVVH
    CAGGYRSSVAASLLRNAGHADVSDLLGGYGAWQGLHAAA

    >gi|302868211|ref|YP_003836848.1| peroxiredoxin, Ohr subfamily [Micromonospora aurantiaca ATCC 27029]
    MSAGTPVTEAKVVPANTVYTATVEVSGGRGGSARSLTGSLRVDLTRPAQRGPDAPGTDPEELFAAGYAACFDSALAVAAR
    QAGVRPGPTTVTASVSLGQTDDGRYAIAVVLDVSAPQCPQADLERAVELADRM
    CPYSNALRGNTAVAIRVDGHR

    >gi|302868898|ref|YP_003837535.1| peroxiredoxin, Ohr subfamily [Micromonospora aurantiaca ATCC 27029]
    MQVLYTASARATGDGRDGHVRTSDGTVELDLAVPKEMGGAGGAANPEQLFAAGYAACFHSALRVVARQAKADVSGSVVEA
    EVGIGPNGSGGYGLAVTLVVDLPAVERAAAEQLVDAAHQV
    CPYSNATRGNVEVTRTVREAL

    >gi|302868967|ref|YP_003837604.1| Peroxiredoxin [Micromonospora aurantiaca ATCC 27029]
    MTVFDVQIDALTGGPADLGRYRGRALLVVNVASRCGLTPQYAGLQELADTYAGRGLTVLGVPCNQFAGQEPGSAAEIEEF
    CQVNYGVTFPLTEKVDVNGPDRHPLYAELVSTPDAEGHTGDVRWNFEKFLVAPDGTVAARFGPQVTPEDPELRAAIEKVL
    PA

    >gi|302869028|ref|YP_003837665.1| iron-sulfur cluster assembly accessory protein [Micromonospora aurantiaca ATCC 27029]
    MTTPAQTESTEAKAPSTVVLTDVAAQKVKALIEQEGRDDLRLRVAVQPGGCSGLRYQLFFDERSLDGDVVTDFDGVEVVV
    DRMSAPYLAGATIDFADRIDAQGFTIDNPNAGNSCACGDSFS

    >gi|302869053|ref|YP_003837690.1| dihydrolipoamide dehydrogenase [Micromonospora aurantiaca ATCC 27029]
    MSEPNDTTFDIVILGGGSGGYAAALRAAQLDLSVALIEKSKLGGTCLHNGCIPTKALLHAAEIADQTRESEQFGVKAELV
    GIDMKAVNSYKDGVISRLYKGLQGLVGGNKKITFVAGAGKLVGKNVVEVDGKRYTGRNIVLASGSYAKSLPGLDVDGERI
    ITSDHALTLDRIPSSAIVLGGGVIGVEFASVWKSFGVDVTIVEALPRLVAAEDEESSKALERAFRKRKINFKVGKPFEKV
    EKTDKGVKLTIQGGDTVEAELLLVAVGRGPNTAGLGYEEQGVKMDRGYVLTDERLRTSVPNVYAVGDIVPGLQLAHRGFQ
    QGIFVAEEIAGKNPAVIDEAGIPRVTYCDPELASVGLTEAKAKEQYGADKIKTYNYNLGGNGKSQILKTAGHVKLVRVDD
    GPVVGVHMVGARVGELIGEAQLIYNWEAYPAEVAQLVHAHPTQNEALGEAHLALAGKPLHAHA

    >gi|302869137|ref|YP_003837774.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Micromonospora aurantiaca ATCC 27029]
    MTENYEVLVIGGGAAGLNGGLMLARARRSVLVVDGGEPRNAPADGVHALLGHDGVPPAELLARGRDEVRRYGGHLTEGRV
    ETVDRDGDGFAVALADGRRVRAGHVLVATGLVDELPDVPGLRERWGRDVVH
    CPYCHGWEVRERPIGVIGSGPMSVHQTLL
    FRQWSDDVVYLRHTAPPLTDEQAEQLAARGVPVVEGEIAAVETAGDRLTGVRLRDGRTVDREVLTVAPRMVARAGFLAGL
    GLRPQPHPSGMGEYLPADESGRTDVPGVWVAGNVTNLSAQVGAAAAAGAWTAAMINADLVQAETQRAVEAHRGARAGG

    >gi|302869146|ref|YP_003837783.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Micromonospora aurantiaca ATCC 27029]
    MPIEVGAEAPDFLLKDQNNQEVRLSDLRGSKTVLLVFYPLAFTGICQGELCEVRDNLNEYVNDDVQVLTVSVDSVYAHKI
    WADREGYQFPLLSDFWPHGAVAQAYGVFNDVAGIANRGTFVIDKAGVVRFAEMNMPGEARDQQGWRKALAEAVAA

    >gi|302869177|ref|YP_003837814.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Micromonospora aurantiaca ATCC 27029]
    MSDPNGLITPGQAAPGFTLPAAPDGREVGPGQFRGRPVVLAFYPADWSPVCGEQMALYQAALPELERYDAVLLGISVDSV
    DSHRAFAESRGIRIPLLADFEPKGEVPRRYGAYAPHGQSERALVVVGPDGRVAWSHLSPPEVNPGVDGILDALESLDSDR
    RVSAA

    >gi|302869186|ref|YP_003837823.1| redoxin domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MRTAARVTAAAVLAATLAAATACAAGPEPGDRAGAVAPAPPAAASPSGPASGPASASPAVVPAALSFTGKTLDGTAFDAA
    ALAGRPVVLWFWAPW
    CATCASQAWTVAEIAPTYRDTVPIVGVAGLGEQKAMKSFVTEFDLGGTTQIDDRAGALWRRFKVA
    EQSTFVVLDRTGRVVHQGFLDGEALTRQVETLARG

    >gi|302869347|ref|YP_003837984.1| AhpD family alkylhydroperoxidase [Micromonospora aurantiaca ATCC 27029]
    MSRMDMAAVAPEAYQAVLGLEKYVRANVDHTVLELVKLRASMRNGCAFCVDMHSREALAAGEDSRRLFAVAAWREAPFFD
    ERERAALALTDAVTRLGEHGVPDDVWDAAAKVWSEKELADLVMAIATINVWNRVAVTCRTQPPAQV

    >gi|302869376|ref|YP_003838013.1| hypothetical protein Micau_4928 [Micromonospora aurantiaca ATCC 27029]
    MTERVTADMWFDPLCPWAWITSRWLLEVEQVRDVDIRFHVMSLSVLNDGRELPEEYRDLMRDGWGPVRVCIAVEQAHGAE
    ALAKLYTAMGNRIHLGKEGLGRDMLVGALTEVGLDPALADAAESTQYDEALRASHEAGMRPVGTDVGTPVIHAPGPDGGQ
    VAFFGPVITPAPKGEAAGRLWDGVLLVAGTPGFYELKRTREQGPIFD

    >gi|302869636|ref|YP_003838273.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Micromonospora aurantiaca ATCC 27029]
    MAERMIVIGGDAAGMSAASQARRRRDRSELEIVAFERGHFTSYSACGIPYWVSGLVEERDELIARDPKTFRDDFGIEVRT
    RHEVTAIDLDRREILARDLDGGGEVRAGFDTLVYATGASPVQPDWARDDVSGVFGVQTLDDGAALIGWLEREPRPRRAVV
    VGGGYVGVEMAEALVQRGLSVQLVEQADQPMSTVDPDMGELVADAMRATGIGVRTGLQVTGLQERDGRISAVVTNEGPIP
    ADVVVLGLGVRPNTALAEAAGLPIGPSGAVRTDRRMRVPGVPGVWAAGDCVESLHRVSGMPVHIPLGTHANKQGRIAGIN
    IGGGYATFPGVIGTAVTKVCELEVGRTGLRERDAREAGFEFVTVLAQSTNRAGYYPGSRPMTVKLIAERPSGRLLGAQIV
    GWSEAAKRIDALAVALWNGMTVDEMTALDLGYAPPYAPVWDPVLIAARKAVDALAAV

    >gi|302869735|ref|YP_003838372.1| glutaredoxin-like protein [Micromonospora aurantiaca ATCC 27029]
    MLTMYSTPWCGYCHRLKSQLDREGIAYEVVDIEQDPTAADFVMGVNGGNQTVPTLRFADGSALTNPSITQVKQHLAALPG


    >gi|302869814|ref|YP_003838451.1| methylated-DNA/protein-cysteine methyltransferase [Micromonospora aurantiaca ATCC 27029]
    MSTVDSTVIDTPAGPLSVLAGPTGAVRAAGFTADPAALLPLIHPSLRGELRERADLGPVTAAVRAYLDGELTAIDAVAVE
    QHTGGAFLTHAWQVLRDVKPGDPVTYTGFAALAGRPAAIRAAAAACARNAAALFVP
    CHRVLRTDGSLGGYRWGLDVKKWL
    LGHEGRVTAS

    >gi|302870026|ref|YP_003838663.1| UBA/THIF-type NAD/FAD binding protein [Micromonospora aurantiaca ATCC 27029]
    MSLPPLVEPAAELTVDEIRRYSRHLIIPDVGVEGQKRLKNARVLCVGAGGLGSPALLYLAAAGVGTLGIIDFDTVDESNL
    QRQVIHGVSDVGRSKAESAAASIREINPLVNVEIHNTALDRENVRDIFSRYDLIVDGTDNFATRYMVNDAAVLLGKPYVW
    GSIYRFDGQASVFWAEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQVNEAIKLLAGIGEPLVGRLMVYDALE
    MSYRKIKVRKDPNCVLCGENPTLTDLMEDYEDFCGAVSDEAQEAVVDSTITALELKDWQDSGKDIFLVDVREPAEYEIVR
    IPGATLIPKGEILSGEALAKFPQDRQIVLH
    CKSGVRSAEALAALKAAGFSDAVHLQGGVLSWVKQVDPSLPAY

    >gi|302870039|ref|YP_003838676.1| heavy metal transport/detoxification protein [Micromonospora aurantiaca ATCC 27029]
    MTEQRPVVQTYTVTGMTCGHCVKAVTEELSALPGVDEVRIDLTSGTATVTSAAPLPVESVRAAVDEAGYELVGGGA

    >gi|302870092|ref|YP_003838729.1| glutaredoxin 2 [Micromonospora aurantiaca ATCC 27029]
    MSSDPRLILITRPGCHLCDDAKAALDRVVAVTGDRWVERDVTGDLEMERDYGDRLPVVLLDGKEHGYWRVEEDRLLRDLT
    TPQL

    >gi|302870155|ref|YP_003838792.1| DsrE family protein [Micromonospora aurantiaca ATCC 27029]
    MARTLVVKATAGADSPERCAQAFTVASTAAAAGVDVSLWLTGESTWFALPGRAETFELPHSAPLGELLHVVLTTGRVTAC
    TQCAARRDIGPGDVIPGVRIAGAAVFVEEAMTEGAQALVY

    >gi|302870161|ref|YP_003838798.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MSRDTALVSAEWAEKNLGAPGVVFVEVDEDTSAYDTGHIAGAVKLDWRTDLQDQVRRDFVNKSQFEALLSDRGIANDDTV
    ILYGGNNNWFAAYAYWYFKLYGHGDVKLLDGGRKKWELDARPLVTDVVERPKTQYVAQEPDTSIRAFRDEVVAAIGTKNL
    VDVRSPDEFAGRLLAPAHLPQEQAQRAGHIPTAISVPWSKAANEDGTFKSDDELRKIYADAGLDDGKETIAY
    CRIGERSS
    HSWFVLQELLGHRNVKNYDGSWTEYGSLVGVPVALGDEPGEA

    >gi|302870343|ref|YP_003838980.1| redoxin domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MRRLAYLLVPLLLATAGCTATAEEPERPAPATRAERPSPFADCAPLTVAPAAASPTSAGKAGDQLPDLTLNCFTGGAPVN
    LRDVKGPAVINVWASW
    CPPCRKELPAFQRLSERADGRFQVIGVNSRDSRGGAQSIGEDYGVDFPMLLDQGDAFQRALERN
    AFPLTVLVDADGRIRHTDATGALDDARLAALLERHLGVRV

    >gi|302870473|ref|YP_003839110.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
    MADVAACPNCGQRNRVQPAASGTPVCGRCRAALPWIADAGDDTFTEVVERSPLPVIVDLWAPWCGPCRMVGPALEQVARD
    LAGRVKLVKVNVDTAPRLSQRFAVQAVPTLMVVAGGQVKARQSGAAPAPALRRWVE

    >gi|302870645|ref|YP_003839282.1| rhodanese domain-containing protein [Micromonospora aurantiaca ATCC 27029]
    MFGASLPSVPASAVPDDVYLLDVREDDEWAAGHAPAAHHLPMTELPARIAEIPQDRDVAVICRSGGRSAQVVGYLMRNGW
    DQVRNVDGGMGDWAAAGRPVVTDDGQPGRVA

    >gi|302870657|ref|YP_003839294.1| peroxiredoxin, OsmC subfamily [Micromonospora aurantiaca ATCC 27029]
    MPIRTASARWQGNLTEGSGTVRTGKGGLSGNYSFKSRFEEGEGTNPEELIGAAHAGCFSMALSKQLADAGAQETAVETTA
    KVHFDKTDAGMTVTRIDLETVGQVPGIDQAEFTKLAEAAKEN
    CPISRLLSPGAQITLNARLA

    >gi|302870707|ref|YP_003839344.1| methylated-DNA/protein-cysteine methyltransferase [Micromonospora aurantiaca ATCC 27029]
    MGATMGGMRWTVLDSPIGEFSVGTDDDAVRGAHFGRVDGASGEPGDAVARLAVAELRAYFAGELTEFTVPVSAPRGSEFE
    RAVWREMTRIPYGETKTYGEVAKAVGDPGGARAVGVACNRNPVPVIVP
    CHRIVGAGGKLVGFGGGLPRKVTLLELEASVA
    LRRAWS

    >gi|302870716|ref|YP_003839353.1| thioredoxin reductase [Micromonospora aurantiaca ATCC 27029]
    MTFCKSGAGAPEPSALGIDIGATGDEHTHRETAVDEVRNLIIIGSGPAGYTAAVYAARANLKPLVIEGVQSGGALMTTTE
    VENFPGFADGILGPELMDNMRKQAERFGAEFLTDDVTRVELKDTGEIGSDAVSTVWVGETAYRAHAVILSTGSAWRPLGV
    PGEQEYLGHGVSS
    CATCDGFFFRNQHIVVVGGGDSAMEEASFLTRFAESVTIIHRRDSFRASKIMADRALGNEKIKVEWN
    SVVEEILGDDGKVNGVRVRNVHTGESKVLDVTGVFVAIGHDPRSELFRGQVEMDDEGYVKVQAPSTRTSVPGVFAAGDVV
    DHTYRQAITAAGTGCAAALDAERFIATIQG

    >gi|302870717|ref|YP_003839354.1| thioredoxin [Micromonospora aurantiaca ATCC 27029]
    MGATKAVTDASFVSDVLQSDKPVLVDFWAEWCGPCRKVSPLLEEIAGEMKDQVTIVKLNIDENPETARAYRVMSVPTLTI
    FKNGQPVQSIAGAKPKGELVKLIESAL

    >gi|302869178|ref|YP_003837815.1| DSBA oxidoreductase [Micromonospora aurantiaca ATCC 27029]
    MTTPLQVTTARLRIPVTERDHVRGPVDAPVTIVEYGDFQCRFCGAAYPNLTEVLRQRADTVRLAYRHFPITNVHPYAESA
    AETAEAAAARGRFWEMYDWLYQHQDQLDQVHLSLGVEQIGLSPEEIAAEVGRQEYADRVRQDFVGGIRSGVNGTPTLFVN
    DVRHDGGYDLAELLAVVDAATDDG