Microcystis aeruginosa NIES 843 uid59101

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|166362839|ref|YP_001655112.1| hypothetical protein MAE_00980 [Microcystis aeruginosa NIES-843]
    MIELSPAAAREIERWSQSRRLTGSYLRLAVKNGGCSGLHYHLELTPIAAENDRFYQSQGINIVVDPDSDRYLQILKLDYS
    EDLMGGGFRFTNANTQNTCGCGLSFSA

    >gi|166363020|ref|YP_001655293.1| thioredoxin [Microcystis aeruginosa NIES-843]
    MSEVPAVTDANFKVEVLDSADLVLVDFWAPWCGPCRMVAPVVEEIAKQFEGQVKVVKLNTDENPIIASQYGIRSIPTLMI
    FKEGQKVDMVVGAVPRTTLANTLNKLLGVN

    >gi|166363424|ref|YP_001655697.1| thioredoxin M [Microcystis aeruginosa NIES-843]
    MAVKKEFSSFQELLQSTNLPVLVDFYATWCGPCQMMAPILEQTGMYFKNRLQIVKIDTDKYPNLATKYGIQALPTLVVFK
    NGQPIDRIEGVVQVNQLVQHLQTLL

    >gi|166363469|ref|YP_001655742.1| glutaredoxin [Microcystis aeruginosa NIES-843]
    MAANVEIYTWSSCPFCIRAKALLKKKGVEFTEYCIDGDERARAKMSDRANGRTSVPQIFINDQHIGGCDDIYALDRSGGL
    APLLQN

    >gi|166363554|ref|YP_001655827.1| hypothetical protein MAE_08130 [Microcystis aeruginosa NIES-843]
    MSIPEISVHELALRLADHDPNLQLIDVREPEEVAMASVANFTILPLSQYQEWSPTIASQFNPQAETLVICHHGMRSLQMC
    QWLQSQGFTNVKNINGGIDAYSLLVDPNIPRY

    >gi|166363752|ref|YP_001656025.1| putative methyltransferase [Microcystis aeruginosa NIES-843]
    MKMTYLEATAKFYSEVAQTPEVGLCCVHSSPLQLPGLKIPAIMQEMNYGCGTTVQANELGNSPRVLYVGVGGGLEALQFA
    YFSRRPGGVIAVDPVPEMRWAAQRNLSEALLENPWFSLDFVEIRDGSAFELPVEDASVDVVAQNCLFNIFKPADLQLALR
    EAFRVLKPGGRLLMSDPIATRPIPEHLQEDQRLRAM
    CLSGALTYDDYIKQLLDAGFGQVEIRARRPYRLLDCQSYNLADP
    LLLESLDSVAFKLAIPEDGACIFTGKTAIYTGTEAIFDDGAGHILAKGLPVAV
    CDKTAGNLARSSPQDILITESTWHYNG
    GGCC

    >gi|166363764|ref|YP_001656037.1| peptide methionine sulfoxide reductase [Microcystis aeruginosa NIES-843]
    MVEKVRKTEAEWQAQLTPEQFQVTRKKGTERAFTGKYHDNKEKGIYKCVCCGTELFTSDSKYDSGTGWPSFWTAANEANI
    KYERDVSFFMVRTEIVCAACDAHLGHVFNDGPPPTGKRY
    CLNSAALQFEKNP

    >gi|166364274|ref|YP_001656547.1| bacterioferritin comigratory protein [Microcystis aeruginosa NIES-843]
    MSRRQLLSFLIAVILAFFAFIPDANALGGPQPPLNQLAPDFTLPTNTGEGNISLSDYRGKWVVLYFYPKDFTPGCTLEAR
    RFQQDLPKYMAKNTQVLGVSADDVDSHAEFCDSEGLKFPLLADTTGDVSKAYGSWMGYVSLRHTYLIDPQGILKEIYLGV
    NPAIHSAEVLARLEELQASS

    >gi|166364472|ref|YP_001656745.1| methionine sulfoxide reductase A [Microcystis aeruginosa NIES-843]
    MVLFGFGKKLTLPTAREALPGRSEKMPVPSTHYVNGHPLQPPFPGGMESAMFGLGCFWGAERKFWQLEGVYTTAVGYAAG
    ITPNPTYQEVCTGMTGHNEVVLVVYDPSVISYEQLLKVFWESHNPTQGMRQGNDTGTQYRSGIYTYSPQQKQLAEKSRSI
    YQEALNKANYGQITTEILDAPEFYYAEVYHQQYLAKNPGGYCGLGGTKVECPLALDLKLN

    >gi|166365002|ref|YP_001657275.1| mercuric reductase [Microcystis aeruginosa NIES-843]
    MFENSSREVNVLPMDEHNQKLVNYVHPADWVNPQPQDCYDLVVIGAGTAGLVVAAGAAGLDIGLKVALVEKHLMGGDCLN
    FGCVPSKCLIRSSRIIGEIEKAKKLGINIGDTRVDFARVMTRMRQIRADISPNDSVQRFQKLGIDVFLGSARFLGQNAVE
    VTGKTLDYKKAVIATGAGAFHPDIPGLKEAGFYTNETIFSLTELPPRLAVIGGGPIGCELAQAFQRLGAQVILFHNHSHL
    LNKEDREATEIIENTFLREGMQLILCCQIERVTKNERGKTIEYTSNGQGATITVDEILVGAGREPNVSGLNLEAVAVEYD
    TRRGVKVNDYLQTTNPKIYAAGDICMDWKFTHAADAAARIVIKNTLFSPFGFGRYKLSNLVMPWVTYTDPEIAHVGMDET
    QAQARGLATNTIKIPLSIVDRAIADGETAGFLKIIHKQGSDQILGATIVAAHAGEMISQITTAMVAKIGLSKLSTVIHPY
    PTQAEAIKKAADAYRRTLLTPNSQKFLELLAKLSG

    >gi|166365023|ref|YP_001657296.1| six-hairpin glycosidase-like [Microcystis aeruginosa NIES-843]
    MANHLAASESLYLRKHAENPIDWWYWCDSALEIARREDKPIFLSIGYSSCHWCTVMEGEAFSDQAIADYLNQYFLPIKVD
    REERPDIDSIYMQALQMMVGQGGWPLNVFLTPDSLIPFYGGTYFPVQPRFNRPGFLQVLQSVRRYYDEEKEKLSKFTAEM
    LGALRQSAILPRSETNLAAPSLLATGIETNTAVIRVNPNNYGRPSFPMIPYSHLALQGSRFGDDFDDSLRQAAYQRGEDL
    ALGGIYDHVGGGFHRYTVDSTWTVPHFEKMLYDNGQIVEYLANLWSAGNREAAFERGIKGTVNWLKREMTAPEGYFYAAQ
    DADSFEKATDGEPEEGAFYVWSDLELRDYLSTEELGLLQANFTVTAEGNFEGRNVLQRRQGGELGKEIENMLDKLFIRRY
    GSSQAQLALFPPARDNQEAKTVSWPGRIPAVTDTKMIVAWNSLMISGLARAFAVFGEPLYWQMATVAAEFILKHQWLDGR
    FQRLNYQGQASVLAQSEDFAYFIKALLDLQTAKPQETGWLEAAIDLQGEFDRWFWAEDEGGYFNTASDHSLDLIVRERGY
    TDNATPSANGIAIANLLRLSRLTENLEYLDRAEKALQSFSTILEESPTACPSLFVALDHYRHGFCLRAPESSIESLLSRY
    LPTAVYRVDASLPSSTFGLICQGLCCLEPAENLEQLDRQIAGVMRGESILLG

    >gi|166365229|ref|YP_001657502.1| tocopherol O-methyltransferase [Microcystis aeruginosa NIES-843]
    MELEQRIADFYDSSSGLWERIWGEHMHHGYYGRGGKIKLDRRQAQIDLIEELLTWGGVTGANQILDVGCGIGGSSLYLAE
    KFHSQGVGITLSPVQAARASQRAQEFNLEEKVSFLVADALKTPFPDDNFDLVWSLESGEHMPDKRQFLRECYRVLQPGGT
    FLMATWCHRPTTSLAGNLTEGEIKLLNEIYQVY
    CLPYVISLPEYADIAREIGFQDLKTDDWSLSVAAFWDVVIDSALTTD
    AIAGLLASGYTTIQGALSLGLMRRGYESGLIRFGLLQGKK

    >gi|166365592|ref|YP_001657865.1| rhodanese-like domain-containing protein [Microcystis aeruginosa NIES-843]
    MSYLVATFYQFVALSDYRQKQPEIQKYCQERGIKGTILLAAEGINATIAGNSLAIAEVISWLKTDTRLANLEVKESVCDY
    LPFQRLKIRLKKEIVTFGQPKANPLEKTGIHLKTEEWNQLLKEPDVVVIDTRNNYEVALGTFAGSLNPEIQHFRQFPEYI
    YDNFDRINNKKIALF
    CTGGIRCEKAAAFLLNQGFSQVYQLEGGILKYLEEVSPDQSLWQGECFVFDQRVALTANLEVGHY
    EMCPACGHPIDEKDKQSPNYQAGISCPYCS

    >gi|166365869|ref|YP_001658142.1| copper-transporting P-type ATPase [Microcystis aeruginosa NIES-843]
    MTHQTLKLAGMSCAGCANSIERIIKSIPGVIQCQVNFGMEQVDVDYDPKRTDLNTIQAKVRDAGFRATPITEINLESRPE
    KELLTKLSIAIVISIILFIGSLPMMTGLSLSFIPHWLHAPLFQLILATPVQFWCGQSFYKNAWKAFKNRTATMDTLVVLG
    TSAAYFYSLFLTFGSDFIEKQGFNSHVYYEASAIVITLILLGRFLEKRARKETAAAIKQLMRLQAKTARVIREEQTLDLP
    IEEVKVGDIILVRPGEKIPVDGIIIQGSSSIDESMVTGESLPVRKTVNQQVIGATINKTGSLQMQALRVGKDTVLAQIVR
    LVQTAQASKAPIQRLVDRVTAYFVPVVMIIAVITFLFWILRTGNLTLALITMVEVLIIACPCALGLATPTSIMVGTGQGA
    KQGILIKNAESLELAQGITTIVLDKTGTLTQGKPTVTDFLTREGVGDGRELSLLQLVVSVENHSEHPLGEAIVKYGRLNA
    IKTLEVSEFDSITGSGLQGKVGSDFVQIGTQQWLESQGIETKVLKKVAHDWEWQKKTVAWIAVNGGLEGVIAISDVLKPF
    SSSVVAKLKKMGLEVMMMTGDNLETAEAIASELGIRRFFAALRPQQKAEKIEYLQKKGKIVAMVGDGINDAIALAQADLG
    IAIGTGTDVAIAASDITLISGDLQGIVTAIELSRATMRNIKENLFFAFIYNLIAIPIAAGVLYPFLLNPIIAGAAMALSS
    LSVVTNALRLRRVHPRVEG

    >gi|166366007|ref|YP_001658280.1| hypothetical protein MAE_32660 [Microcystis aeruginosa NIES-843]
    MLNPNLAAIELSKEEVQRYSRHIILPEVGLEGQKKLKAASVLCIGTGGLGSPLLLYLAAAGIGRIGIVDFDIVDSSNLQR
    QIIHGTSWVGKPKIVSAKDRILEINPYCQVDLYETRISSENALDILAPYDVVIDGTDNFPTRYLTNDACVLLDKPNVYGS
    IFRFEGQATVFNYQGGPNYRDLYPEPPPPGMVPS
    CAEGGVLGVLPGVIGTIQATEAIKIILGAPDTLSGRLLLYNAWEMK
    FRELKLRPNPIRPVIEKLIDYEQFCGIPQAKAQEAAEQQKMTEMTVVELKALIDSNANDYILIDVRNPNEYQIANIPNSV
    LIPLPDIENGAAIPKIKELVNGYRLIAH
    CKMGGRSAKALAILKDAGIEGINVKGGISAWSREVDSTVPEY

    >gi|166366324|ref|YP_001658597.1| thioredoxin peroxidase [Microcystis aeruginosa NIES-843]
    MTAEGCLRVGQPAPDFTATAVFDQEFKTIKLSDYRGKYVVLFFYPLDFTFVCPTEITAFSDRVSEFSSINTEILGVSVDS
    EFAHLAWIQTERKSGGVGDVAYPLVSDLKKEISTAYNVLDPDAGVSLRGLFIIDKEGVIQHATINNLSFGRSVDETLRTL
    KAIQYVQSHPDEVCPAGWQEGDATMVPDPVKSKVYFAAV

    >gi|166366392|ref|YP_001658665.1| peroxiredoxin [Microcystis aeruginosa NIES-843]
    MALQLGDIVPDFTQDSSEGPISFHQWVGDSWVVLFSHPADYTPVCTTELGTVASLKSEFERRNVKVIALSVDSAESHRGW
    INDINETQNTTVNYPIIADGDRKVSDLYGMIHPNSLNNLTVRSVFIIDPNKKLRLTITYPASTGRNFNEILRVIDSLQLT
    DNYQVATPANWTDGGDCVVVPSIPTEEARSKFPKGVEEIKPYLRMTPQPNK

    >gi|166367041|ref|YP_001659314.1| thioredoxin M [Microcystis aeruginosa NIES-843]
    MILSVNEKSFPKLVLESSRPVLVYFWAPWCGLCRLIQPTLLSWQNDCQGAIQLVAVNADDNFKLANSFRLRSLPTLILFD
    QGVPVHRLEEIHSREELQQTLRLIVKNQIPRSA

    >gi|166367233|ref|YP_001659506.1| bacterioferritin comigratory protein [Microcystis aeruginosa NIES-843]
    MTLEVGQKAPEFATPNQRGEISKLADFAGQWLVLYFYPKDNTPGCSAEAIDFTALSPQFQQLNAVILGVSPDSEKSHCRF
    IEKHNLTIQLLSDPEHQLAEIYQVWGLKKFMGKEYMGIRRSTFLIDPRGNIAYIWSNVKVKAHAEAVLKKLEELQ

    >gi|166367344|ref|YP_001659617.1| thioredoxin [Microcystis aeruginosa NIES-843]
    MGTATFIQDETEFDSLLKSESLLVVDCTATWCGPCKLVAPLIDRLADDYRDRAKVFKLDLDSNKPVAKRFGIRSIPAVMV
    FKQGKLIETLVGVKPYEEFTAAVERQL

    >gi|166367367|ref|YP_001659640.1| glutathione reductase [Microcystis aeruginosa NIES-843]
    MSYDFDLLVIGGGSGGIATARRAAEYGAKVGLAEYDRLGGTCVNRGCIPKKLMVYSSRFPQLFKDAEGYGWSPVESQLNW
    QKLISAVNQETIRLNGIYQKMLDNSQVTLFPNYAKFIDTHTLEVGDEKITADKILIAVGGHPVKPDIPGIEHTVVSDAMF
    QLPEQPKRIIVLGAGYIGVEFAGIMHGLGTEVVQLIRKDKILRGFDEDIRDEIQAEMIRQGIKIMPETFPTSIEKTAEGL
    KVHIQGQETSEILFVDALGLAATGRIPKLEKLGLENVNVEVKNGAIVVNEYSQTSEDNIYAVGDCTDKINLTPVAINQGR
    AFADTVFGNKPRLMSYENVPSAVFSTPEAATVGLTELQAKKQYGDTEIKVYRSKFRPGYNVLPGREDKTLMKLVVHQESG
    KILGAHMVGDHAAEIIQGVAIAVKMGATKADFDATVGIHPSAAEEFVTMR

    >gi|166367370|ref|YP_001659643.1| thioredoxin-related [Microcystis aeruginosa NIES-843]
    MGYSIEVDGTNFDSEVIEKSYLNTVILDFYALWCGPCKLVKPMLEKLASEYNFILAKIDIDKNPDLAEQYDVEGVPDVRI
    VSKGEVLPCFVGALPEEQIRDLFSRLDLKSELETGLAEIQEAIALDNLPAAKQLFDRLFPKYPNEPRLVIMAVKFLMRLE
    KWSDAYRLISAIKEENPLIKGWKTLLEFQQLKPENNPLDAIFFTGINSALKEDYAAALDKLISLVGESRKYRQDGARKAM
    LAIFQILGVSHPLTQEYQAKLTFLLY

    >gi|166367786|ref|YP_001660059.1| dihydrolipoamide dehydrogenase [Microcystis aeruginosa NIES-843]
    MLTLRVRETMSEFDYDLIIIGAGVGGHGAALHAVKCGLKTAIIEAKDMGGTCVNRGCIPSKALLAASGRVRELADSDHLK
    SLGIAIGGVNFDRPTIADHANNLVSKIRGDLTNSLKRLKVDTIHGWGKIAGPQKVSVIGDSGEKIYTAKDIMLCPGSVPF
    VPPGIEIDHKTVFTSDEAVRLETLPKWIAIIGSGYIGLEFSDIYTALGCEVTMIEALDSLMPGFDPEISKIAERVLIKPR
    DIETYVGVLAKSIKPGNPVAIELVDAKSKEAIEILEVDACLVATGRIPATKNLGLEFVGVELDKRGFIAVNDKMQVIQSG
    EPVPHLWAVGDATGKMMLAHAASGQGVIAIENICNRPKTIDYRSIPAAAFTHPEISYVGLTEPQAEALAQQEGYKVASVK
    TYFKGNSKALAEGETEGIAKVVYRQDTGELLGVHIIGIHASDLIQEAANAIAERQSVHELAFRIHTHPTLSEVLDEAYKR
    AEVAA

    >gi|166367885|ref|YP_001660158.1| cation-transporting P-type ATPase [Microcystis aeruginosa NIES-843]
    MILAAETGLKTATLDVKGMKCAGCVSAVERQLSQNQGVKSAQVNLITEIAVIEYQPDAIAPEQLAAKLTAIGFPTQPRSS
    STPLSQQNQRLQNQQKERQQQLYRLAIACCLLVFSLIGHLHHIGGPEIPIFQSIAFHWILATLAILFPGRDIFIDGWRGL
    RHGMPNMNTLVSLGTGSAYIASCLALIFPNLGLECFFDEPVMLLGFILLGRTLEAHSRHRAAADLEALTSLQPAVAHLIG
    STDDRVGVAIPVEQLRVGEWVRVLPGEKIPVDGEIIQGRTTVDEALLTGESLPVVKEMGDLVIAGSFNLSGAIAVQTRQV
    GTDTTLAKIIAAVESAQTRKAPVQKIADRVAGYFAYGVMIIALIVLLFWYFWGTRLFPEVLGSTTGHHEMIQPTSPLLLS
    LKLAISVLVVACPCALGLATPTALLVGTSLAAERGILIKGGDVLETVSQLQTVVFDKTGTLSQGHPEITDCLSFSILNSL
    EIQQLAAVVESGTNHPLARAILDAVTPPTNLTGEDFQTVAGLGVSARVQGSKIVLGNRQWLAQNGIKIDETIWGIQELLQ
    AGKTVIYLGMEEQLLGAIAFQDRLRPDAQTTVNQLQKLGLEVILLSGDRQEVVTAIANSLGISQFYAEVAPTEKSALIAD
    LQTKEGKIVAMVGDGINDAPALGQANIGIALAGGTEVAMETAGIVLISDRLEDVVQSLHLSLATWQKIRQNLFWALGYNT
    FAIPIAGGLLLPRWGLAFSPALAAALMAFSSVMVVSNSLLLRRQFPPLKSTQEGKN

    >gi|166367906|ref|YP_001660179.1| putative thiosulfate sulfurtransferase precursor [Microcystis aeruginosa NIES-843]
    MKPKLRQGKGLSLGRFHSRPLAFFTLVLLCILTFTLAPSSPLMATSKSETKIDFVSPAWVAQNLNDPKLKILDVRINPLE
    YITGHLPKAVNIADNNFRGPNGFLPVQYWQEDKIGSLFAAAGITNGDRVVVYSDGRDVLGATMVAYLLERSGFRNVAVLD
    GGFKGYKGSEQKVTKEFPKYQPGSFTVRDNPSIRVNLAEVEKLIGKPDVVFIDPRPEELFQGKQDIWLRNGHIPGAKNIP
    WPTFTEANNPDESLKNPHKLKSLDEIRKILAQRNIKPSDNIIVS
    CSTGREATLQYIVLKHLLGYPKVRIYEGSWTEYSTT
    DLPVATGPEKAV

    >gi|166367945|ref|YP_001660218.1| HesB/YadR/YfhF family protein [Microcystis aeruginosa NIES-843]
    MTQATQIQGKGILLSEAALKHLTMLKEQQGKDLCLRVGVRQGGCSGMSYMMDFEHPSNIGPQDEVFDYDGFKIVSDKKSL
    LYLYGLMLDYSNAMIGGGFQFTNPNASQTCGCGKSFGV

    >gi|166368021|ref|YP_001660294.1| thioredoxin reductase [Microcystis aeruginosa NIES-843]
    MTVENLVIIGSGPAGYTAAIYAARANLKPLMFEGFQAGGIPGGQLMTTTEVENFPGFPEGITGPKLMERMKEQAERWGTQ
    CYTEDVISVDLSQRPFTIRSTDREVKANSIIIATGATAKRLGLPSEAQFWSNGISA
    CAICDGATPIFREENLAVIGGGDS
    AAEEAVYLTKYGSHVHLLIRGEAMRASKAMQDRVLNNPKVTVHFHTQAVDVFGTGSKMAGLRIKNSQTGEISELAVRGLF
    YAVGHTPNTSLFQGQLELDEVGYVKVKPGTVATSVEGVFAAGDVQDHEYRQAITAAGTGCMAALLAERWLSEHNLIQEYR
    QSATSEHYETKTVSETPADTEETFDIHKTRHVGGYALRKLFHDGDRLLMVKYVSPT
    CGPCKTLKPILDKVVDEYDGKIYF
    VEIDIEADPEIAKMGQVTGTPTVQFFKDRELVKEMRGVKQKSDFRQVIESYQ

    >gi|166368133|ref|YP_001660406.1| uncharacterized monothiol glutaredoxin ycf64-like [Microcystis aeruginosa NIES-843]
    MTPETKARIDQLVQNNKVLVFMKGNKLMPQCGFSNNVIQILNILGVSYETVDILQDQELRQGVKEYSNWPTIPQVYINGQ
    FIGGSDIMIELYQNGELQQIVEVALAS

    >gi|166368282|ref|YP_001660555.1| methionine sulfoxide reductase A [Microcystis aeruginosa NIES-843]
    MNSGEKATFGAGCFWKTEDAFRRLPGVLATSVGYMGGNFPNPSYLDVLSRITGHAEVAQIAHNPQEISYEALLAVFWSIH
    DPTQLNRQGPDRGEQYRSIIFYHTPEQKLIATASKRQLQLSAKFQQDIVTLIEPAGDYYLADQSHQQYLEKKQARSVGDF
    QKKI

    >gi|166368429|ref|YP_001660702.1| thioredoxin [Microcystis aeruginosa NIES-843]
    MSSVTVISDQKFDKEVFEVEKPVLVYFWASWCGPCRLVSPSIDWVAKTYGERLKVVKLEIDPNPNSVAKCDVKGVPALRI
    FKDKKLIATHEGAIGKQQLQSFIDTYVS

    >gi|166368571|ref|YP_001660844.1| glutaredoxin [Microcystis aeruginosa NIES-843]
    MLNLFNSLFGRYNENIKANVEIYTWATCPYCIRAKWLLGWKGVKYTEYKIDGDESARQAMAERSNGKRSVPQIFINNEHI
    GGCDDLYALDGQKKLDNLLAKCGTI

    >gi|166368643|ref|YP_001660916.1| thiosulfate sulfurtransferase [Microcystis aeruginosa NIES-843]
    MNPIAPLVSPSWLVTNLDRPDLMVIDCRFQLNDPDLGYQEYLANHIENAFYLHLDRDLSAPVARHGGRHPLPNPPTIAAK
    LSSLGVISGQTHVIAYDASRFAFASRLWWLLRYLGHEKVSILDGGWQNWLNAGYPVSNQIPVPKTGAFLPQVQEDWVVTI
    EQVKRHKEQAGVVLIDARESDRYRGEREPIDPIAGHIEGALNYPWLEVTDSQGFSQPQDLQTQRWQERQGDREIILY
    CGS
    GVTACVNILSLTLAGYDNVKLYSGGWSDWCSYLI

    >gi|166368714|ref|YP_001660987.1| hypothetical protein MAE_59730 [Microcystis aeruginosa NIES-843]
    MARTESTMLDLGTKAPSFALPDVVSGETISLDSFAAKTALLVIFLCEHCPFVKHIQEELTRLGRDYANTNLGILAISSND
    VEKYPDDSPENLKKMAITLDFKFNLCYDESQEVAKAYTAACTPDFFLFDSQRILVYRGQLDDSRPSNGIPVTGKDLRAAI
    DKVLTGQPVPTDQKPSLGCNIKWKLGNEPPYYG

    >gi|166368718|ref|YP_001660991.1| hypothetical protein MAE_59770 [Microcystis aeruginosa NIES-843]
    MAIGVATNMLKKGHSTTIFLNITGVHLAATTIPQHTNGITGKTLQAMLVDFISQGGKVLICPSCMKQAAIKPEDLIAGVV
    TSSPDSLEANLFKETVKVISW

    >gi|166368834|ref|YP_001661107.1| bacterioferritin comigratory protein [Microcystis aeruginosa NIES-843]
    MALTVGTIAPNFTTTDDTGKTVSLSDFQGKVVVLYFYPKDDTPGCTKQAQSFRDNYEQYQDKEIVVFGVSRDDQGSHAQF
    KEKYGLPFQLLVDTDGAITKAYDVDGGGYSKRVTYIIDGEGKISHVDDKVNTASHASDILCVVG

    >gi|166369019|ref|YP_001661292.1| putative peroxiredoxin [Microcystis aeruginosa NIES-843]
    MLPNREGQRVPDVTFPVRQNNQWVNITSEELFKGKTVVLFALPGAFTPTCSTSHLPGYNELAPVFRENGVDSIVCLSVND
    TFVMNEWAKDQECDNVVLIPDGNGEFSAGMGMLVDKADLGFGQRSWRYSMLVKDGVIEKMFIEPEEPGDPFKVSDAETML
    NYINPEAKKPPLVSLFSKVG
    CPYCLRAKKMLEEKGLQYEEIILGRDATSRSLRAMSGNTTTPQVFINGQLIGGSEELAAY
    LGA

    >gi|166368278|ref|YP_001660551.1| uroporphyrinogen-III C-methyltransferase and uroporphyrinogen-III synthase fusion protein [Microcystis aeruginosa NIES-843]
    MSGVVYPRGKVYLLGAGIGQSSFLTLQARAILATAEVLLYDALVDSQIFSLVPKTCVLVDVGKRGGQPGAEQNQINRILV
    NYCQEGKRVIRLKSGDPGVFGRVYPEMLALKRAGCDFELITGISSALAAPLLAGIPLTEKDISRCFAVLSAHDPESLDWS
    ALAKIDTLVLLMAGQSLGQIIEKLCQNGRNIHDSIAIIRQAGRKDQQIWRGTLENILAQTAGVSLSPSIMVIGQVVDLAI
    MSSPPPLGGKTIVITRAAEQTSQFSEILQNQGAEVLEMPALEIRPPDRWQGLDDAIAQLQEFDWLILTSANAVNFFFDRL
    TFWGKDARALATVKIAVVGKKTSQVLHSRGLKADFIPGDFVADALVNEFPDPIRGQKFLFPRVETGGREVLVKELTAKAG
    QVTEVAAYYSG
    CPARMDSQIWEAFRDEKVDIVTFASSKTVQNFYQLLLQETAELSVNSLLEKVCLASIGPQTSKTCQELF
    GRVDIEAREYTLEGLTSALIESSKT