Micrococcus luteus NCTC 2665 uid59033

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|239916625|ref|YP_002956183.1| thioredoxin [Micrococcus luteus NCTC 2665]
    MSAIVTCPNCGKKNRVPAAASGYPRCGVCKSALPWIVDAGDADFAEVVEQAPQVVLVDLWATWCGPCRMVSPALEKVATE
    RAGKLKLVKVDVDAAPETARKFSVQAVPTLLILNQGNVLSRQSGAAPPDVLLRWVDEALQKMADSAGGDP

    >gi|239916673|ref|YP_002956231.1| Rhodanese-related sulfurtransferase [Micrococcus luteus NCTC 2665]
    MSAFETVDVNEIPADAAILDVREDDEWALGRAAGAQHIPLGQLPDRLEELDPDTDYYLICRTGGRSARAAEFMTGRGYSA
    INVAGGSGAWLEAGKPMEADGDAEPTVK

    >gi|239917148|ref|YP_002956706.1| mercuric reductase [Micrococcus luteus NCTC 2665]
    MPTKYDLAIIGSGGGAFAAAIRATTLGKSVVMIERGTLGGTCVNTGCVPSKALIAAADARHSAADAADRFPGIATTAGPV
    DMPALIAGKQALVESLRGEKYADVADSYGWAVRRGDAAFAGTPDAPVLQVAGDDGSTETIEAGHFLVATGSRPWAPPIDG
    LDETGYLTSTTAMELTELPESLLVLGGGYVALEQAQLFARLGSQVTVLVRSRLASKEEPEVSRTLEEVFADEGIRVVRRA
    LPTRVSRDAATGQAVVTADVAGGREEFRADQVLVALGRRPVTDGLGLDRVGVETGDLGEVVVSDRMQSSHPRIWAAGDVT
    GHPEFVYVAAHHGTLVAENAFADADRAVDYARLPRVTFTGPAIGAVGMTEKDVVAAGIRCDCRVLPLHHVPRALVNRDTR
    GFVKIVVDADTGKILGITAVAKDAGELAAAGVHVLGKTVAEVADAWAPYLTMAEGIRIAAKAFTTDPSLLSCCA

    >gi|239917308|ref|YP_002956866.1| rhodanese-related sulfurtransferase [Micrococcus luteus NCTC 2665]
    MHSESPDPSPVPDRDGAAPDRPDPLIVVDEGQGRVVPAPTAAPSSSHDAGGDPDADTDGVDPEAAEPPTLVTVDVLAGWL
    GLAPVEDLPPVPGGPAYAQPGRCRPNRVILLDVRFRATGGGPDHAAYLQGHLPGAVYVSLPSQLAGHAGPAAGRHPLPDA
    RQFAEAVRMWGIDEGDTIVVYDDDHGLSAARAWWLLRHAGLRDSVLLDGGLEAWRAAGLPLQPGEVIPVPGTARPSWGRM
    PVVDTAGAEAMASGGLLLDARAAERYRGEVEPFDPVAGHIPGARNVPTAESIAEDGRLRPAAELAERFDAVGVDDATPVA
    VY
    CGSGITAAHAVLTLAVAGRPGVALYPGSWSAWVQDPSNAVAVGPEPYGASGRD

    >gi|239917324|ref|YP_002956882.1| dinucleotide-utilizing enzyme possibly involved in molybdopterin or thiamin biosynthesis [Micrococcus luteus NCTC 2665]
    MTAALDPAAREPRDLTALSDTQLQRFARHLSLDGFGPEAQLALLRSRVLVVGAGGLGAPVLTYLAAAGVGEVHVIDDDVV
    DRSNLHRQVIHAEADLGRPKTASAAATMRGLHPEVRVVEHRERLTAANALERVGAVDLVLDGTDNYATRYLVADACEIAG
    VPVVWGAILRFAGQVSVFAPGGPLYRDVFPERPEPGEVPS
    CAQAGVLGVLPGIIGSLMAAEAIKLLSGVGEPLVGRLLSV
    DALTMRFRELRLVPDPERTPVTDLSAHADQAPRPDDAGAPGSAEACGAAGGEIAPAALAALLADPARAASLTLLDVREDW
    ERRLRRVEVSAAVADRHVPLEAVLAEPAAHTPGQDRVLVVYCAAGARSARARDAVVGADPSAGGRVLSLAGGLAAWPA

    >gi|239917370|ref|YP_002956928.1| Peroxiredoxin [Micrococcus luteus NCTC 2665]
    MTDTTQHRLQPGDTAPAFTLQDQEGRPVSLRDSAGKHTIVYFYPAASTPGCTTQACDFRDSLASLTAAGYVVLGISPDPI
    GKIIRFAEQEGLTFPLLSDEDHAVAEAYGAWGEKKNYGRTFEGLIRSTIVVGPDGKVTHAQYNVKATGHVARLRRTLGLD
    EA

    >gi|239917462|ref|YP_002957020.1| methionine-S-sulfoxide reductase [Micrococcus luteus NCTC 2665]
    MTDSPRTEPLGASGAPADVRELTLAGGCFWCLDAVYRRVRGVLAVESGYTGGDDPAPSYESVCTGTTGHAEAVRVRFDAA
    VVPPEVIMDLFFTGHDPTSLNRQGADVGTQYRSAVFAHDEAEARFFADEIARAQANYDSPIVTRVEPASAWHPAEDIHQD
    FYARRRSNGYCRVVIDPKLAKVRRNYSAWLVDA

    >gi|239917472|ref|YP_002957030.1| copper chaperone [Micrococcus luteus NCTC 2665]
    MTATTHTLLRAEGFSCPSCVRKIEKALDALPGVTGAQVHFETQRIEVDHDPQTTTAQDLVEAVAKVGYTARPSAF

    >gi|239917502|ref|YP_002957060.1| DSBA-like thioredoxin [Micrococcus luteus NCTC 2665]
    MTDTTQQPTVDFYFDATCPFAWITSRWILEVQKVRDVRVVFKIMSLAVLNEGRDLDPDYLARLEKAWLPARAAVQVRERH
    GAEALGPWYTAVGTRIHEQGRTDFEAVVAEALEELGHDADILDAARTDVADEQLRASQKEAEDLVGNDVGTPVVAFNGTA
    FFGPVMTRIPRGEEAGRIFDGAVALADFPYFYEIKRARTTDPQFD

    >gi|239917555|ref|YP_002957113.1| ribonucleoside-diphosphate reductase class Ib glutaredoxin subunit [Micrococcus luteus NCTC 2665]
    MTVTVYTKPACVQCNATYRALDKKGIAYEVVDMSQDPAALERVRALGFMQAPVVITETDSWSGFRPDKIAELAESAAASV
    A

    >gi|239917580|ref|YP_002957138.1| rhodanese-related sulfurtransferase [Micrococcus luteus NCTC 2665]
    MTDTAAKFSEYAHPEKLVSTQWVADHVGDDDVVVLESNEDALLYSTGHIPGAQRVDWHTELNDPVSRDFVGPEAFAEFAA
    SKGISRDTTVVFYGDKSNWWAAYALWVFTLYGHEDLRLMDGGRDKWIAEGRETTREVPTVARAEYPVIERDDHTERAARE
    DVLQAIGTTPLIDVRSRPEYTGETTHMAGYPQEGTLRGGHIPTAASVPWASAANEDGTFKSRAELEQVYRTDAGLQEGDD
    VIAY
    CRIGERSSHTWFVLKYLLGHEDVRNYDGSWTEWGNAVRLPIAVGEEPGEAPAR

    >gi|239917724|ref|YP_002957282.1| Iron-sulfur cluster assembly accessory protein [Micrococcus luteus NCTC 2665]
    MALSAEETGVEIGATQDAEGLPPHEVELTDVAAGKVRSLLEQEGRTDLRLRVAVQPGGCSGLIYQLYFDERVLDGDTVRD
    YDGVEVIVDKMSVPYLMGATIDFEDTISKQGFTIDNPNAGGSCACGDSFH

    >gi|239917795|ref|YP_002957353.1| methionine-R-sulfoxide reductase [Micrococcus luteus NCTC 2665]
    MTETPPTPHDGPTPDPARDAPAPEQTLAAPGGTRLTDEEWARRLTPEEFQVLRRAGTERPFTGEYWDSHVKGVYACRACG
    SELFRSDEKFDAHCGWPSFFAPLAEDRVEYLKDTTLGMERIEVRCAACGSHMGHVFAGEGYDTPTDLRY
    CINSVSLRLAP
    ADDAAAPDGAR

    >gi|239917833|ref|YP_002957391.1| dihydrolipoamide dehydrogenase [Micrococcus luteus NCTC 2665]
    MADKATAQEFDVLVLGGGSAGYAAALRSVQYGKSVALVEKSKVGGTCLHWGCIPTKAYLHAAEVADETRNAAKFGVNATL
    ESVDMAKVRDYKDGIVAGKHKGLAGLLKMRKVQVIEGEGKLVSKNEVEVDGTRYTAENIVLASGSVAKTMGLPISKKIMT
    STEALELDYTPKSAIVLGGGVIGSEFASLWNSFGVDVTIIEGLKTLVPNEDPAIIKVLEREFKKKGIKTNLGTFFDKVEE
    TDSGVKVTLADGKVFEAEVCLVAVGRGPNTEGLGYEEQGVKMDRGFVLTDERLHTGVGNIYAVGDIVPGLQLAHRGFQQG
    IFVAEEIAGNKPMVVEDINIPKVTFTEPEIMSVGYTQPKAEEKFGKDNVEVAEYNLAGNGKSSILGTGGIIKMIRQKNGP
    IVGVHGIGKRIGEQIGEAQLIVNWEAYPEDVAQFLHAHPTQNEALGEAAMALFGHPLHS

    >gi|239917881|ref|YP_002957439.1| pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase component [Micrococcus luteus NCTC 2665]
    MATTAEHHDLLIIGSGSGNSLVSEHWKGRSVVIADSGTFGGTCLNVGCIPTKMYAYPASLAALPPEARSLGVGLEFTGAD
    FPAIRDRIFTRIDGISRDGLRYRRDDLDYTSVIQEEVRFVGPRRVRTASGREITADQVVVAAGSRPTLPEIPGLDLPSVH
    TSDTVMRLDRLPRRLLVVGGGFIACEFASVFAGLGTEVVQVNRGHRLLKQHDMSVSTTFTRIAARRWDLRTGWTPAGIEP
    VEDAERAADGWVRVRLDRAEGQEQTGIVEEAIEADAVLIAVGRTPNTDRLDPAAAGLDVTDDGVLASDEHQRALSDGAPV
    EGVYVLGDVANTWQLKHVANHEARVVAHNLEHPDDLRANTLGPVPAAVFTHPQAASVGLTVEQALADYGADAITVKTQSF
    GDVAYGWAMEDTEGVCTVVAEKATGRILGGHILGHEAANLIQPLVTGMAFGIDAHRLARGQYWPHPALTEVVENALLGLD
    VPDSGLL

    >gi|239918049|ref|YP_002957607.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Micrococcus luteus NCTC 2665]
    MKSTPVHTVGELPPVGAPAPDFTLTGADLSPVTLQELRGRRVILNIFPSLDTGVCAASVREFNSRVADLEDTTVVAVSAD
    LPFAAARFCSVEGIDHVRSGSVFRSSFGDDYGVRMTDGPLEGLLARAVVVVDADGVVRHAQLVPEISEEPDYEAALAAAR
    G

    >gi|239918077|ref|YP_002957635.1| predicted redox protein, regulator of disulfide bond formation [Micrococcus luteus NCTC 2665]
    METIYTAEALSTGAGRDGHVRTTDGRVDLDLAVPTEMGGSGQGSNPEQLFAAGYAACFHSALQMVARASRADITDSSVGA
    RVGIGRQGEGFGLEVTLEVVLPHVPAEQARALMEQAHQV
    CPYSNATRGNIDVVLELGEA

    >gi|239918276|ref|YP_002957834.1| thiol-disulfide isomerase-like thioredoxin [Micrococcus luteus NCTC 2665]
    MQTPRPSRRTVLTGLSLAGLAPVLAACSGDDSLTRQAGNADGKNYIAGDGSVLEIAPEERGAPVEFAAELFDGSPVTGAS
    LRGAPALLNFWYAA
    CAPCRVEAPHLVALHEQFEPQGVRFLGVNVRDTATTAQAFERTFEIPYPSVEDARGEVLLNMTDHV
    PPQAVPSTLVLDAQGRVAARVLGAVEESTLRALLTTVVDEAAA

    >gi|239918290|ref|YP_002957848.1| predicted sulfurtransferase [Micrococcus luteus NCTC 2665]
    MSTAPLSRIALYYRFTPLADPEAVRLWQRTLAASLGLTGRIIVSPQGINGTVGGPVDAVKRYVRGTREHPAFRDLEVKWS
    DGSAADFPRLSVKVKPELVAFGAPERVTVDADGVVGTGERLTPVQVDALVAERAGTANPVRFLDGRNTVEAAIGCFDGAV
    VPDAHTTRDLLAAVDSGALDHLKDAPLITY
    CTGGVRCEVLSALLKDRGFAEVYQLDGGIVRYGEARGDAGLWRGELAVFD
    RRLSTRFTADAETIGRCVTCEAPTSALRNCADPACTTLEVRCAACAADDPERRCPVCVHRPHPAERTEA

    >gi|239918317|ref|YP_002957875.1| copper chaperone [Micrococcus luteus NCTC 2665]
    MTESARTPLPGATNGCSCCAPAADATAPAGHQSADPTGTSAGDATYQVEGMTCGHCVGSVAEAVSALDGVDDVRVELVAG
    GASPVTVTGPASADSVRTAIEAAGYRVRI

    >gi|239918387|ref|YP_002957945.1| thiol-disulfide isomerase-like thioredoxin [Micrococcus luteus NCTC 2665]
    MTAPQTPNPAPSADAPAAVPRGATRVRASELVGRGWLNTGGEQVTLEDLRGKVVLLDFWTFCCINCLHVLDELRPLEEEF
    ADVLVTVGVHSPKFEHEADPDALAAAVERYAIEHPVLDDPELTTWQAYSARAWPTLVVVDPEGYIAAHLSGEGHVAGLYG
    LVRELVAEHEAKGTLHRGSGPYVPPAPVARDLSFPGKAVSLGGRGSRPGSFLVSDTGHHRLLEVAEDLTTVLRAFGGGDP
    ATADAGQAELAFPTPGEKGHADGGPDEALFHEPQGLALLPEDVAERVGYDVVVADSVNHRLRGLRLSDGYVSTLAGNGVQ
    KLIDSERAKEAAAVDDEGDVAVDLADLPGEPTAISLSSPWDVVWHPALGRVVIAMAGTHQLFDFDPVTGALAVHAGTALE
    GLLDGDAGRAWFAQPSGLSVGADGALWVADSETSAVRWVRTGEDGRREVGTAVGAGLFDFGHVDGEADRARLQHALGVTA
    LPDGSVLIADTYNGAIRRYAPAGEDAAGRAVPATVSTVARGLLEPSDVLVEHDADGNDTAIVVVESNAHRLTRLAVPEEF
    LTVDEGARQTQRPRTPVVAGDLDLTIGFAAPTGQKLDDRWGDPTQLKISSSPEELLLEGAGTSTGLHRTLRLNPEVEEGV
    LHITARAAACDGEKGQPIPDHAACHLYQQDWGIPVTVHTPDRAPEGAETHLDLDLRGIH

    >gi|239918405|ref|YP_002957963.1| predicted glutathione S-transferase [Micrococcus luteus NCTC 2665]
    MENQQTGQAADRGTIDTREGLTGNYVQSGAEFTRDTNYIADRIVADPEAVRALPVAEPSTVGRVGGGLTEGAEAWPVEAG
    RYRLVAARA
    CPWANRTIIVRRLLGLEDAISLGTPGPTHDERSWTFDLDEGGKDPVLGTERIQENYFTRFPDYPRGITVPA
    IVDVPTGGVVTNDYPQITLDLSTEWTTFHRDGAPQLIPDAGPERDEMFEVIERVFTEVNNGVYRCGFAGSQEAYDAAYER
    LWAAMDWLEERLTTRRFLMGERITEADVRLFTTLVRFDPVYHGHFKCNRNKLTEMPALWGYARDLFQTPGFGDTIDFAQI
    KEHYYVVHEDINPTRIVPAGPELASWLSEHGREEFGGDPWGGGTAPGPVREGERVDPEHTPLR

    >gi|239918475|ref|YP_002958033.1| hypothetical protein Mlut_20050 [Micrococcus luteus NCTC 2665]
    MTASAPTLSSHFADTFPELALPWQAQATDGPQLVLLNAGLATELGLDAEWLATDDGVRFLTGEQPGPDARPVAQAYAGHQ
    FGHYSPRLGDGRALLLGELTAPDGRLHDLHLKGSGRTPFARGTADGQAVLGPMLREYVVSEAMHALGVPTTRALAVVATG
    HPVRRETVLPGAVLARTAASHLRVGTAQYAAALPEQAHPTEVLRRIVDEAIARHHPHAADAEHPALALDEAVIAAQAELV
    SRWMLVGFVHGVMNTDNMTLSGETIDYGPCAFIDAFDPAASFSSIDTQGRYAYGNQGPIAAWNLARLGEALVPVLDDDPD
    RAVALAQEALGRFHGAHLAAWRGGLRDKLGLPASVAEDDVAALTDRLFPWLAAARADWTSFWVRLAEHTAAPVDDDAART
    EAARLVPGAPDPAGLAAWLADWRAMGPDPARMRAVNPVYIPRNHLLDEARTAAEGGDLAPVHRLLEAVTDPFTPRPGFER
    YAEPGPADGAPFVTY
    CGT

    >gi|239918572|ref|YP_002958130.1| predicted redox protein, regulator of disulfide bond formation [Micrococcus luteus NCTC 2665]
    MIEIEPLYTTEAIATGGGRNGHVRTADGRVDMDLAIPAEMGGSGDGANPEQLFAAGYAACFHSALQSVARQAKKKLGDSS
    VGARVSIGKAGEGFGLAVTLEVVIPDLPQDEAQQLADAAHQV
    CPYSNATRGTIRVDVQVVDD

    >gi|239918591|ref|YP_002958149.1| thioredoxin [Micrococcus luteus NCTC 2665]
    MATKDLTLEEFGSTVAENDTVLVDFWAGWCGPCRQFAPVFEAASEKHDDVVFAKVDTEDQQQLAAMAGITSIPTLMAFRG
    GVLVFSQAGALPGTALEQLLEQVKGLDIAEVHRLAEEQQGQQDEAEPGQDEAVQSTADDVNGR

    >gi|239918631|ref|YP_002958189.1| Rhodanese-related sulfurtransferase [Micrococcus luteus NCTC 2665]
    MTQATLAPLSPEVLRERTESGAAVVIDVRTPAEFAVEHIAGSYNVPLDTLKEHTGDVAARLPGDVVLVCASGMRATDARE
    RLAAAGFTQADVLAGGVSSYAKAGGDVVRRAGGWAMERQVRMTAGSLVLVGALAAQVGSRRLALLSAGVGGGLVFSALSN
    TCAMGSVLDRMPWNRRGRERPAAEVLRGIPSRDARRA

    >gi|239918632|ref|YP_002958190.1| Zn-dependent hydrolase, glyoxylase [Micrococcus luteus NCTC 2665]
    MLLERIYDEDLAQASYLIGCQANNEAMVVDPRRDIQVYLDLAAQRGMTITHVTETHIHADYLSGTRELAHATGARIHLSG
    EGGEDWAYGFEGDLLTDGDIMELGNITVEAVHTPGHTPEHLSFLVTDGAFADAPGYMLTGDFVFSGDLGRPDLLDEAAGG
    VDTRFEGAKQLFASLKAKFLTLPDHVQVFPAHGAGSACGKALGALPSTTVGYEREYAWWSDYLKNDDEQGFIDELLDGQP
    DAHAYFARMKRQNKQGPAILGELPELEELDAGGVQAKLADGAVFVDTRAVDEILAGTVPGALAFPSRGKVATHAGWAYDP
    ESDDAALVLLAEDREDAHTMRDHMIRVGVDAAAAFTTSVDGLTLEPVPTVQADELQSRIEAGEVGAEQDTVLVDVRNKTE
    FSHGTVADARQLNAGKVLFHQEELPKDKTLVTF
    CQSGLRNIVAAQALRRAGFDVVELDGSYLGWLGLDRA

    >gi|239918715|ref|YP_002958273.1| glutaredoxin-like protein [Micrococcus luteus NCTC 2665]
    MSQNAPALTVYGADWCRDCLRTKRQLDELGVAYDYVDLVADPAQADAAERISGRTNIPVVVFPDGEHQVEPTNEETAAKL
    TALGLI

    >gi|239918718|ref|YP_002958276.1| predicted dithiol-disulfide isomerase involved in polyketide biosynthesis [Micrococcus luteus NCTC 2665]
    MSLFETADDRVSVDVWSDVMCPFCLIGDRLLDQAAARADHPVQVRYHSYQLQPDLPADRTRPVLDMLVDAKRMPREQVEE
    MDRQITARGAEVGVEFRQDIALAVNTRDAHRLSHVAGDQGLQHAMMQRLFRAYFTQGRNVADHEVLADLAAEVGLGRQAA
    LDALASDAHADTVDADVAAARRLGIGGVPFFVVDGKYAISGAQPLEVFERALAAAWADKDDAGPPAG

    >gi|239918739|ref|YP_002958297.1| YeeE/YedE family protein (DUF395) [Micrococcus luteus NCTC 2665]
    MIITGLLLGLVLGFVFQRGRFCVTGAFRDLFTIRSTRWLTAFMVIVAVQSVGVFALDALGVITLEAETFPWLGTIIGGLI
    FGFSIVLAGG
    CATGTYYRAGEGLVGSWFALIFYIVGATAFRKGPLAGTTEAVRSVETQTGSFQQLTGLSPWVFVALLVAG
    VALAVRHHLRREAAMTRFRLPAAKTGLAHVLTEKAWHPFVTAAVIGVLAVIAWPLSWATGRESGLGITGPSANIGAFLGT
    GDMELVDWGVLMVTGLLIGSFVAAKASGEFRVRVPDARTTLRSIVGGVGMGWGAAWAGG
    CTIGNAMVNTATFSFQGWTAL
    VFMVLGTGLAAKVFILNHRGKGTTPVPASASGLTSAEGAAADAGAARPVKLTPIG

    >gi|239918797|ref|YP_002958355.1| thioredoxin-disulfide reductase [Micrococcus luteus NCTC 2665]
    MAPTAQDQSVHNVVIVGSGPAGYTAAIYTARADLSPVLVAGAVTAGGELMNTTEVENFPGFPEGVQGPELMANLEAQARR
    FNTEVVYDDVVQADLTSNPKVLTLGDGTQLRTHAVILTTGSAYRKLGVPGEERLSGHGVSW
    CATCDGFFFREQEIAVVGG
    GDSAMEEALFLTKFASKVTVLVRKDELRASKVMAHRAMENEKIEFRWNTEVTEVTGDDKVNTLRLRDTRTGEASTLDVTG
    LFVAIGQDPRTDLVQGQVELTEHGTIRIDHPSSRTSQPGVFAAGDVTDHTYRQAVTAAGSGCVAAQDVEHYLATVADVEE
    AAPAGPESDANPA

    >gi|239918798|ref|YP_002958356.1| thioredoxin [Micrococcus luteus NCTC 2665]
    MSTITVTDADFDQKVLQSELPVLVDFWAEWCGPCRMLGPVLEDMAVEHEGKAVIAKLNVDENPAIAARYGVTSIPLVVGF
    QNGEKVAESVGAKPKAALEKEFSALLG

    >gi|239918601|ref|YP_002958159.1| copper/silver-translocating P-type ATPase [Micrococcus luteus NCTC 2665]
    MTHPASSTPAGPPAGTTRRVDLDVTGMTCASCVGRVERKLGKLEGVTASVNLPLEQATVTAPAGVSDEELVAAVEKAGYG
    ATVRRPAPPAGHAGHAGHAHTSEHGEEHAADHDGVDHHDHMAHGPSEDMLKPRLIGAAVLTVPLVLISMVPALQFPHWGW
    VAFALAAPVALWAAWPFHSAAFRAARHGSSTMDTLVSLGVLVSFSFSAVELILAPDMTAHVGGTMAEMAHHSLYFEAAAV
    ITTFLLLGRWLEARAKREAGAALRALLDLGAAQATLYDPETHDERTVPAESLAPGDVVLIRPGEKVPTDAEVLEGTSAVD
    ASLLTGESVPVEVGPGDALTGATLNTSGRLVARATRVGSDTTLAQMGRLVSEAQTGKARVARLADRISAVFVPIVLGIAV
    LTFAVWMLVTGDLPSALRAGVAVLVIACPCALGLATPVGLLAGTGRAAQLGILIRGPEVLEDSRTVDTIVLDKTGTVTEG
    RMALADVLVLDPAFVAETGASRSAFVDETAPDQAADVLLTLAAAVERGSEHPIARAIVAGAEERGLTVPGVADFASTAGG
    GVSGLVALPHDDGALGSGAHGAAGPDPVRVAVGRGSVLETALDGGILAEHRAAFEAAEQAGATAVWVAVGGRVAGVLSVR
    DTVKDTSADAIARLRQMGLRPLLVTGDNAAVAAQVAEAVGIPAADVVSGVRPEDKVDVVTRLQSEGAVVAMVGDGVNDAP
    ALAAADMGIAMGSGTDVAREAAQITVMGDDLHQVVQALDLSRRTLGIIRMNLFWAFLYNVLGIPVAALGLLNPMIAGGAM
    AASSVLVVLNSLRLTRYAR