Methylotenera mobilis JLW8 uid59373

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|253995432|ref|YP_003047496.1| DSBA oxidoreductase [Methylotenera mobilis JLW8]
    MKRVNVEIWSDFACPWCWIAKRRFEKAVFRLAGEVDVIVTPKSYRLAKGAAPEDFKQAIIRKSVSITAAEKLLSMIDERG
    ALEGLKYNFDTMRFGDTSDAHALVKSISSIADKNTAVERIFQAYTTDGIDIFNRDVLISLVKDLGISESEIDFDSPQIAS
    EIAQDELKANRLSNGVPLFIFNNGYPLSGAREVDDFESALLRAAKDAPEFLDDVSGQSCGIDGCAV

    >gi|253995433|ref|YP_003047497.1| OsmC family protein [Methylotenera mobilis JLW8]
    MSNTLNGIDLVALQGIAQNVAGAENASKRSAKFNVKTKWENQTRTVATVSRYSFLGTEHQRHFEIAADEPTEFLGQNSAP
    NPQELLMSALNA
    CLSVGYAVNAAAMGITIHSLEIETDGELDLRGALGMDENVNPGYDEVSYVVRLHTDASKEKVEELHKI
    VTKTSANYANFSRAIRMVTKLEVQEG

    >gi|253995438|ref|YP_003047502.1| alkylhydroperoxidase like protein, AhpD family [Methylotenera mobilis JLW8]
    MMDWNNYRDELMSRVGDLAALTPDTVKGYQIATGAGAKTNHLDAKTRQLISLAVAVTTRCDGCIAVHAKEAVKEGATEAE
    IAEALGVAVAMNAGAALVYSARVLDAVKSLPHHE

    >gi|253995488|ref|YP_003047552.1| Thioredoxin domain protein [Methylotenera mobilis JLW8]
    MKFIMKSILRNILMLSVLFAGSAMADTVAFTQAAFAKLQLEGKPILVHIHANWCPTCRAQAPIISSLLKQKYFQTVTSLR
    VDFDQQKDIVKAFHASRQSTLIVFKGNKELGRSLGDTTPDGIEKLLRKTL

    >gi|253995531|ref|YP_003047595.1| Redoxin domain protein [Methylotenera mobilis JLW8]
    MLKKILKSIFFIALASCLALSLAFILRYIAEQNADNQPSGAALYVAKLPDIYGKMQDLGQYRHKVIIVNFWATWCPPCRE
    EMPELIALQQAYQDKNVVVLGIALDEPAQVAQYLKSTSVNYPIVANDVAGSMLGEQLGNDKGVLPYTVIINTDGNIVNAH
    FGRITQAMIEASIKPLIPASTR

    >gi|253995532|ref|YP_003047596.1| cytochrome c biogenesis protein transmembrane region [Methylotenera mobilis JLW8]
    MFKRFSYFLLVSFFVLSASIGHAGNASSSLKNLFTGESAEDEFLSPDAAFGVSIKQDGQNIRANFTVAPNYYLYKTRTKF
    EFTPAQTFDTQLPKADIKNDPNFGQMEVYHQDFTANLQLKEQISAPLQLKVTYQGCSEKGLCYAPQHKSFSITPGAIPNN
    NAAPSTAADSSNASASDSQAANLLKSGKWWLIILGFFTAGLLLAFTPCVFPMIPILSSIIIGKNAHVTRLHAFNLSLAYT
    LGMCLTYTLAGIAAGLSGQMLSSALQTPWALGFGALIFVLLALSMFGFYELKLPSGMENGLMNLSRRIKGGRFFSDFLMG
    VLSALIISPCVAAPLAGALLYISKTNDVVLGGVALFSLSVGMGTPLLLIGASAGTLLPKVGSWMNAVRNLFGVLMLGVAI
    WLISPVIPMQVQLALWAAILIVPAIFMHALDSLPTGAKAALKFWKGIGVMMVITGLALLIGALSNAKSPLQPLSGLIASS
    SKVQPHNNLNFQQIKSLAELESALKNAGGKPVMLDFYADW
    CVACKELEQFTFSDARVQTALKDTVLLQADVTNNTEDDKA
    LMQKFNIFGPPGIVFFDANAHEQSQLKVVGYKDADTFLQTLNQRGSCLPETIAC

    >gi|253995569|ref|YP_003047633.1| iron-sulfur cluster assembly accessory protein [Methylotenera mobilis JLW8]
    MSTVAEVQELDIPSPLVFTDNAAKKVKELIEEEGSPDLKLRVFVSGGGCSGFQYGFTFEEEVNDDDTQVQKDTVTLLIDP
    MSLQYLMGAEIDYQDSLQGSQFVIRNPNAQTTCGCGSSFSV

    >gi|253995624|ref|YP_003047688.1| UBA/THIF-type NAD/FAD binding protein [Methylotenera mobilis JLW8]
    MNDNQLLRYSRHILLPQIEYEGQDKIVHGHALIVGAGGLGSPAALYLGAAGVGTITICDFDQVDLSNLQRQIVHTTSSIG
    VNKALSAQKTLLALNPEVIVHAICERASEDELHALVAKADVVLDCSDNFATRYLLNKLCVQLRKPLVSGAGLGFEGQVTV
    YDMRSTQSPCYHCLFPDNGEGTDLR
    CATNGVFAPLVGMIGTTQAAEALKILMGIGESLQGRLLLLDALSMEWRAIKLSKD
    SACTVCSV

    >gi|253995632|ref|YP_003047696.1| Rhodanese domain protein [Methylotenera mobilis JLW8]
    MSTYNEIDAHDLSVMLSKKSLLLVDVRNDDEVARGVIENAVHIPLAMLPVQYESLTKAETIVFYCHSGVRSAHAAAFAAS
    KGCKHVYNLAGGVLAWARAGYQFVPLNSQSK

    >gi|253995681|ref|YP_003047745.1| glutaredoxin-like protein [Methylotenera mobilis JLW8]
    MDTQELIRSQVTGNPVVLYMKGSPKFPQCGFSNLATQILSACNVEYVAIDVLADQNIREGIKVYANWPTIPQLYVNGEFI
    GGSDIMRAMYESGELQTLLNATK

    >gi|253995810|ref|YP_003047874.1| OsmC family protein [Methylotenera mobilis JLW8]
    MKVTIKWIDGVSFVGESETGHAVVLDGAPENGGRNIGMRPMEMLLIGMGACTSFDVVAILKKARQPIIDCVAEIDAARAD
    EIPKVFTTIHVHFVVTGDNLNPTQVERAVKLSAEKYCSASIMLSKSVEITHSFEIKPLSVAAT

    >gi|253995815|ref|YP_003047879.1| hypothetical protein Mmol_0442 [Methylotenera mobilis JLW8]
    MSKYIVEITYCTQCRWLLRAAWLAQELLTTFEQDLYSVALRPGTGGIFEVRLNDALIFSRKEAGRFPESKEIKQLVRDRV
    DPDRHLGHSDKTTLED

    >gi|253995834|ref|YP_003047898.1| Thioredoxin domain protein [Methylotenera mobilis JLW8]
    MQQNQAINREFLDQRPGATLVEFGAEWCGHCQAAQANISAAMKAYPNIHHIKIEDGKGQRLGRSYAVKLWPTLIFLQDGV
    EIERLVRPLSEEYINAALSKLR

    >gi|253995868|ref|YP_003047932.1| Redoxin domain protein [Methylotenera mobilis JLW8]
    MKQLLKKSLLPIIIIALLALLGLQLTKKPQAPDVTFNTIDGRQISMASLKDKVVIVNFWATDCPGCIKEMPELIKTYNTY
    HPKGLEIIAVAMPHDEISQIQNYSKSNNLPFPVTYDQSAAITELFGKVRLTPTAFIYNKQGDLLQRTMGELDFAALQQLL
    NKELGA

    >gi|253995930|ref|YP_003047994.1| heavy metal translocating P-type ATPase [Methylotenera mobilis JLW8]
    MLTNTFSTEDTPSNAAWTILDTEDQWQAFSKPVASQDLQSTQQLVQSDLLLDGLRCAACSGIIEEGLKSTPGIVSARVSM
    SKRRAVVVWAPDATLPSKILTAIHNLGYSAFPATQHEDDLASLQKQRAAFWRWMVSGFCMMQVMMYASPTYFTTPGEISS
    DILHLLNWASWLLSLPVLLFSSSAFFSNALRDLKQKQISMDLPVALGIIITFIVSSAATFDPSNWWGHTVYFDSLTMFVF
    FLLSARLVEVKLHRKTLGALDNLASRIPENTERQNPDGTFARVLNSKLKVGDVVRVQIGEAFPADGTIISGNTSVDESLL
    TGESTPIQKNLHDDVIAGSYNLRQPVCITLNTIGESTKYGQIVNLINNAAVEKPRLSKLADRVARPFLLFVMLSAAGAAA
    LLWHIDHGRALMTAAAVLIVTCPCALSLATPAAMLASASAFVKRGILIKRIQAIENIADIDTIIFDKTGTLTEDHIQIKA
    ISAKVGLSEAAALTLAAAVAQHSMHPISRALVNAHKAGNLQAPAMELDDIQETSGAGISAKINSSATDASTAEHCAVGDE
    LKLGSAMFCGIAIADTNTQQVYLANQQGWLATFTLQEAIKHNAALAIAALKEAKLAIELLSGDRSNAVENTATQIGITQF
    QAACSPEDKLLRLQALKREGKKVLMVGDGLNDGPILASAHVSIAMGKGVPLTLAHADYVFLNGDISQIPNLIRHAKQTMK
    IIKENIAWAIVYNLISIPLAFFGILSAWLAGLGMAVSSLIVVANALRLTKFASSKTDTQGIDALETNNHETNTISDSLRS


    >gi|253995938|ref|YP_003048002.1| Rhodanese domain protein [Methylotenera mobilis JLW8]
    MEFIKDNVLLIGLALGSGIMLLFPGFGNKASGVPNLNATEAVALINRNHALVVDVRDDAEFASGHIVDAKHIPLNQLESR
    LKELAKYKDKPLLVN
    CQRGARAAKACEILRKAEFKQVHNLQGGLSAWIEAKLPVVKA

    >gi|253995939|ref|YP_003048003.1| glutaredoxin 3 [Methylotenera mobilis JLW8]
    MANILMYTSAVCPYCINAERLLASKGVTEINKVRIDLQPERREEMMQKTGRRTVPQIYIDDRHIGGFDDLRALDLAGGLD
    PLLA

    >gi|253995966|ref|YP_003048030.1| putative thiol:disulphide interchange protein [Methylotenera mobilis JLW8]
    MLKKFASIALLSAFATAAVADEASVKKAVEAAYPKFKVEKVTKTPYTGLYEVFMGGQIIYTDEKMSFLIAEGHLVDPKTK
    KDLTSERLEELTRVDFSSLPLNQAIKVVKGNGSRKLVVFSDVD
    CPFCKRLERNELANVTDVTVYTFLFPIEQLHPDAASK
    SKLIWCAKDRVKAWEDWILRDQLPSAAGSCEVPLDKVGELARKVGVTSTPTLIFADGKRMLGAQPYKEIERMLSASKK

    >gi|253995982|ref|YP_003048046.1| cyclic nucleotide-binding protein [Methylotenera mobilis JLW8]
    MSHNPKLLDTSAQMTTAVLALLNTFEPLAKLSAGRKRELAGLCFVEKVSKGINPLRMNVSNAKQSVYLIKGELELRFVDG
    SKQMLRAKDTVARHPIVCDSTLVDCIAYTDVEILRIDNDLLDIMMTWDQLSTGDDVLKSVHKADDEKSSRTPVEWMRDTS
    VFSVSKLQSGVFSKVPVANIEAMFQRMERINTVAGQVIIQQGAAGDYYYLIESGTVLVTRADGVNAHPLLVAELQSGDAF
    GEEALVSDNKRNATVAMKTDGQLLRLNKHDFVALLKEPMLLHVSREVAEVKIADGAIWVDARLPSEYQYDHIDGAINLPL
    NEIRQKLLELDYRKSHVVY
    CQTGRRSSAAAFILAQNGFDVVVLKGGARANGL

    >gi|253996029|ref|YP_003048093.1| dihydrolipoamide dehydrogenase [Methylotenera mobilis JLW8]
    MSNLVEVLVPDIGNFDSVDVIEVLVKAGDTIAKEDSLITVESDKASMDIPSSHAGVVKAINVKVGDKVAKGSLILSVEAA
    EAAAPVKAEVPAAAPAAVTPAAAPIAAPVAAVTVGDSDINTQVVVLGSGPGGYTAAFRAADLGKQVVLIERYSTLGGV
    CL
    NVGCIPSKALLHTAKVITEAEESSHHGVKFGAPQVDLEQLRDWKANDVVGKLTGGLAAMAKQRNVTVVQGVGKFTSANQI
    AVTAADGKVTTVGFENAIIAAGSQATKFPGVEADERIMDSTGALALADVPKRMLVIGGGIIGLEMGTVYDALGSKVSVVE
    FTDGLVQGCDRDLVRPLQKRMEKRFEAIMLSTKVAKMEPKADGIHVSFEGVNGNEDAPKGVEVYDRVLVSIGRRPNGKNI
    GAENAGVAVDDYGFINVDKQMRTNVPHIFAIGDIVGQPMLAHKATHEAKVAAEVIAGEKVEFVASVIPSVAYTDPEVAWV
    GVTETEAKAKGMAIEKASFPWAASGRALSIARTEGATKLIFDKETHRLIGAGIVGVNAGELLAEAVLAIEMGADAHDLGL
    TIHAHPTLSETVCFAAEMKEGTITDLYIKKR

    >gi|253996072|ref|YP_003048136.1| arsenate reductase and related [Methylotenera mobilis JLW8]
    MLTLYGIPNCNTVKKARTWLDENGVAYTFHDFKKSGIDAAIIQQWLTQYPWEKLINRAGLTWRGLDEATKSSITDNTAAT
    ALMQAKTSVIKRPILVNENKIIGLGFDETLYRETFLP

    >gi|253996077|ref|YP_003048141.1| Disulphide bond formation protein DsbB [Methylotenera mobilis JLW8]
    MLNKILIGRTGYFIGFVGCFALVGLALWIQTRFGLEPCPLCISQRIVFMSLGVLFLVAALLPKCLKVQSILQVLTAMGGA
    GVAIRHWWIQAHKEEMIAD
    CGVGFDYMFENFPLQKALTLVFKGTGDCAAIDWTFLGLTIPQMSLIAFVGFGVYAVYLLKL
    NSKKSI

    >gi|253996108|ref|YP_003048172.1| Thioredoxin domain protein [Methylotenera mobilis JLW8]
    MAVIALTKANFKETIENNPFVIVDFWAQWCDPCVAFMPTFEAAAEKNPDIVFGMVNTEADPEIGEYFEVSQIPGILVIRE
    QAGIHAQVGEIGAPALDEIIKWARDFDMTPVREYYKQQAQAAN

    >gi|253996180|ref|YP_003048244.1| protein of unknown function DUF395 YeeE/YedE [Methylotenera mobilis JLW8]
    MENFTPIQSLIGGLLIGASASMLILFMGKITGISGIIASLLQFKNTPKGHYTWRLLFIAGLLISSTVYQTFAPPPASEIS
    ASTGTLIIAGLLVGFGTKMGSG
    CTSGHGVCGLSRLSLRSLMATMCFMFTGFVVAYLMLHVV

    >gi|253996229|ref|YP_003048293.1| Rhodanese domain protein [Methylotenera mobilis JLW8]
    MPKYLTAALYKFVSLPEYQALQAPIMDACKAHQIKGTLLLAEEGINGTIAGLPDDIRQVLHYLRTDPKFSGKFADLEHKE
    SFADEHPFYRMKVKLKKEIVTLGVPGVSPTKKVGTYVKPQDWNALISDPDVVLIDTRNDYEVDIGTFKGAIDPKTTTFRE
    FPEYVAKHFDKTKHKKVAMF
    CTGGIRCEKASSYMLDQGFDEVYHLEGGILKYLETVPEEQSMWEGECFVFDQRVAVKHNL
    EVGDYDQCYACRYPLSPAEMQSEKYVAGISCPHCYDQVSEEKRAKLLERQKQVTLAKQRGETHIGEKQK

    >gi|253996483|ref|YP_003048547.1| Rhodanese domain protein [Methylotenera mobilis JLW8]
    MDLLLNLLHQYGLLIVFLNVLLEQIGLPLPAYPTVLIASAISVSNGTSLASLMLVAVIGALLADMFWYVAGRRYGKKVMS
    KLCKISLSPDSCVKQTESMYLKIGPSALLFCKFVPGFASISSALAGALGTKTITFIVLDGIGAAIWVGSAVLLGSMFSAS
    IDQLLLTLVEMGKWGALIIALAFTLFIVNKWWERYRFLKALRMARISVDALNELLVSGKQPVIIDTRPPNLIEDGWIPSA
    RFVTTDQVKDILPEIDISEDIVLY
    CACPNEVTAAKVAKAFMNHGYFNVRPLAGGIDAWVASGFDVHKPADGGQN

    >gi|253996579|ref|YP_003048643.1| heavy metal translocating P-type ATPase [Methylotenera mobilis JLW8]
    MANQVNNERTFAINGMTCASCASRVEKALLKVPGVTSAEINLALETAQVTATDKVMTQQLVDAVVAAGYQAQLLSAEQDR
    VEHLADKDKQHLWWPSALAALFSMPLVIAMVAQWLGWQVAIPGWLQWLLATPVQFWLGWRFYQAGWHALKARAGNMDLLV
    AIGTSAAYGLSVYLLFTPSHGGALHHLYFESSTIVITLVLFGKWLESRAKSQTTQAIRALNTLRPEFATVVSNGQTQQVA
    IATVKVGDVVLVRPGERIAVDGNVEQGDSQVDESLITGESLPVAKNMGDKVTGGAMNGEGVLYVKTTAVGAETVLARIVR
    LVESAQAKKAPIQRLVDKVSAVFVPIVMAIAALTLLVWGFYNGNWEAAIINAVTVLVIACPCALGLATPTAIMVGTGVAA
    QHGILIKDAEALELAHALKTVAFDKTGTLTEGHPKLLVLRSTAKEGDALDSDQLLMLAASLQASSEHPLAKAVTDAAKAK
    GITLQLAQGLQALAGKGVVGEVGGQKLYIGSTRLMTELKVNLAKYKEDALLLEQSGQSVSWIAQARVLDNFAPKLLGFFS
    FGDSIKPTAQQAITALSKAGIKTVLISGDNQGSAANVAHQLGISQYFAQVLPDEKASIVAQLKQDGLVAMVGDGLNDAPA
    LAMADVGVAMSSGTDVAMHTSGITLMRGDPALIAHAIDISKRSYQKIRQNLFWAFIYNVVGIPLAAMGILSPVLAGAAMA
    LSSVSVISNALLLKLWRPT

    >gi|253996616|ref|YP_003048680.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylotenera mobilis JLW8]
    MLIKTLFYAAVILVAFIGYRHYSIKQPSLTIGENAPEFALKDTKGTQHTLSDYKGKYVVLYFYPKDDTPGCTKEACSFRD
    DLSKLEHLNAKVIGVSVDTESSHQQFAEKYHLPFTLLADTDGNVANAYHALTNLIFIKIAKRYTFLIGPDSKVIKIYDNV
    NVSNHSQQIIDDLTNIQAN

    >gi|253996665|ref|YP_003048729.1| Redoxin domain protein [Methylotenera mobilis JLW8]
    MATVTLKGGPVNVGGNLPQVGQTAPNFELADAKRVTQSLDAFSGKRKVLNIFPSIDTPTCATSVRTFNQKASSVANTVVL
    CISADLPFAQSRFCGAEGIENVVTLSTFRNTAKFATDYGVFITDSSLAGLTARAVVVLDEHNKVLHSELVAEIADEPNYE
    AALAVL

    >gi|253996672|ref|YP_003048736.1| protein of unknown function UPF0061 [Methylotenera mobilis JLW8]
    MRTLNFDNRFYRELPGDAITDNYTRQVKDALWSSVMPTPVKAPSLMAYSSDVAEMLGLSDADMHDPDMVNALGGNQLLPG
    MQPYATCYGGHQFGNWAGQLGDGRAIYLGELVHNNQRFELQLKGAGETPYSRRADGRAVLRSSLREFLCSEAMYYLGVPT
    TRALSLVCTGDQVVRDMFYDGNPQMEQGAIVCRVAPSFTRFGHFELLASRGNLALLKQMIGFTIDRDFSDWLQQQNHTLS
    KDEPSTALIEAWFTEICERTARMIAHWMRVGFVHGVMNTDNMSIIGLTIDYGPYGWVDNFDPGWTPNTTDAQGRRYCFGR
    QHDIGRWNLERLADALSTILPDAVGLNHALDQYETVYTQSLIDALVGKFGLDTWQDDDGELINRCFELMTRAEVDMTLFF
    THLSHINLASPNIADLKIAFYTEQGYTNFESDFNAWLAQYAKRILQSTESIAARQARMASHNPRYVLRNYLAQEAIDLAE
    QGDSSMIETLLKLLKNPYTQQAGMEKFEDKRPDWARHKAG
    CSMLSCSS

    >gi|253996719|ref|YP_003048783.1| glutathione peroxidase [Methylotenera mobilis JLW8]
    MYFSSSASKIGLSALLSILMLSTTNMANAACSALYNHQFSTLQGGKINLCDYQDKPILVVNTASKCGFTPQFEALESLYS
    QYKKQGLLVIGFPSNDFKQELSDDKQINDFCKLTYSVKFPMISKSSVSGKTANPFYQQLIAKTGQSPSWNFFKYVILPGG
    NDVYAYSSDVKPNAAEILSKIKPSLK

    >gi|253996806|ref|YP_003048870.1| thioredoxin reductase [Methylotenera mobilis JLW8]
    MATRHAKLLILGSGPAGYSAAVYAARANLKPVLITGIAQGGQLMTTTEVDNWPADADGVQGPELMSRFQKHAERFNTEMI
    FDHIHTTHLTEKPIRLVGDSGEYTCDALIIATGASAKYLGLPSEEAFSGKGVSA
    CATCDGFFYRNQEVAVIGGGNTAVEE
    ALYLANIASKVTLVHRRDKFKAEAILVDKLMARVAEGKIVLETFATLDEVLGDNTGVTGMRIKNVNDGSTKDIALQGVFI
    AIGHKPNTDIFAGQLEMEGGYIVTQMGRAGNATATSVPGVFAAGDVQDHIYRQAVTSAGTGCMAALDAERYLDHLK

    >gi|253996856|ref|YP_003048920.1| Heavy metal transport/detoxification protein [Methylotenera mobilis JLW8]
    MYILRVQNMNCGGCVNTIKKTIQQIDALAVIDVELSTKTLRVNSAMPEAVIIQAISDAGFQPLR

    >gi|253996940|ref|YP_003049004.1| methylamine dehydrogenase accessory protein MauD [Methylotenera mobilis JLW8]
    MNTGFIIASNVLLWCAFLSLAALMLGVIRQIGLLHERSAPLGAMLLDNGPEVGERSPVFSLTTFDGAPITVGRAVTPNRP
    SLLMFTGPS
    CPICAKLLPIIRSVAAAEGADVVLISDGTRAEHLEFLRNHPLQNERYVVSAEIGIRYQISKVPYGVLLDAD
    GVILGKGLCNTREHVESLFETVREGHSTLQDFMKHSTTPLLHADENKGVH

    >gi|253996982|ref|YP_003049046.1| peptide methionine sulfoxide reductase [Methylotenera mobilis JLW8]
    MSHEEIAVFAGGCFWCTEPVFSQLNGVKKVISGYIGGHTSNPTYKQICNGDTGHAEAIQITYDAELINFETLLEIFFVSH
    DPTTPNRQGNDVGTQYRSAVFCQNEAQRTATASMINTLNKQQIWASPIVTEINAAETFYPAEDYHQYYFDKNPNQPYCMA
    VAAPKAAKIRAKYAQLIKE

    >gi|253997042|ref|YP_003049106.1| iron-sulfur cluster assembly protein IscA [Methylotenera mobilis JLW8]
    MAITLTETAASRVEKFLANRGKGVGLRLGVKTTGCSGMAYTLEFVDEMHPEDVAFESHGVKVIIDPKSLVYLDGTELDFT
    KEGLNEGFKFNNPNVKDECGCGESFTV

    >gi|253997179|ref|YP_003049243.1| protein of unknown function DUF181 [Methylotenera mobilis JLW8]
    MEIKVNFLDKLRLEAKFDDFTVIADQPIRYKGDGSAPGPFDYFLASSALCAAYFVKLYCNTRNIPTENIRLSHNNIVDPE
    NRYQQIFKIQIELPTDISEKDRIGILRSIDRCTVKKVVQAGPEFIIEEVANLDADAQALLTVNPTTDTQTYITGKDLPLE
    QTIANMSGVLAALGIKIEIASWRNIIPNVWSLHIRDAHSPMCFTNGKGATKESALASALGEYIERLSNNHFYAGSYWGED
    IANAEFVHYPNERWFKPGRKDALPKEILDEYTLEIYNPDGELRGSHLIDTNSGNVERGICSLPFVRQSDGETVYFPTNLV
    ENLYVSNGMSAGNTLVEAQVQCLSEIFERAVKREILEGEITLPDVPQEVLTKYPGVVAGIKGLEEQGFPVLVKDASLGGQ
    YPVMCVTLMNPRTGGVFASFGAHPSLEVALERSLTELLQGRSFEGLNDLPQPTFASEAVTEPNNFVEHFIDSSGVVSWRF
    FSAQSDYEFVEWDFAGQGENANTEEAATMFGMLANMGKEAYVAVYDQLGATACRILVPGYSEVYPIEDLVWDNTNKALLF
    REDILNLHKLDDASLEALLERLETNELDDYGDIATLIGIEFDENTDWGQLTVLELKLLTHLALQQFEEAHELVGAFLQYN
    DNTVERGLFYQAMNVVLEVLLDDELELNDYEVNFRRMFGDERMDAVLGSVDGSVRFYGLTPTSMKLEGLDRHQRLIDSYT
    KLHTARAKMATVDLCP

    >gi|253997309|ref|YP_003049373.1| Glutathione S-transferase domain protein [Methylotenera mobilis JLW8]
    MTLPILYSYRRCPYAMRARMALKYAGITVEIREIALRDKPAHLLQISPKGTVPVLVTLQGAVLEQSLDIMHWALQHSDPD
    GWLVADAEQTQALITENDASFKQALDRYKYAIRFPEQPMEDYRSQGEVFLAKLEQRLAQTEFLMGTKPTLADIAIFPFIR
    QFSAVDAVWFETAAYPKLKVWLNLMLSSVLFNSIMDKHPVYSSQ

    >gi|253997320|ref|YP_003049384.1| electron transport complex, RnfABCDGE type, A subunit [Methylotenera mobilis JLW8]
    MTFDFHHYIMILIGTVFVNNIVLVKILGLCPFMGVSKKLEASIGMAGATALVLSVGSMTSWGINHYLLEPNGLFYLRTLS
    FIVIIAGVVQLTEMVMEKNFPTLHQGLGIFLPLITTN
    CAVLGIPLLNAQASHSFLESLFFGLGGALGFSLVLILFASMRE
    RLEGADVPAAFKGSAIAMITAALMSLAFMGFMGLDKY

    >gi|253997325|ref|YP_003049389.1| electron transport complex, RnfABCDGE type, E subunit [Methylotenera mobilis JLW8]
    MSLYKEITLNGIWKQNPGVVQLLGLCPTLAVTTSVVNGISLGLATVFVMAAANGTISPVRKYVPNEIRVPVFILVIAALV
    TVIDLSINAFAHQLHKVLGIFIPLIVVN
    CIVLARVESFAAKNSPIPSILDGLMMGLGLTLVLGLLGGMRELVGKGTLFSG
    LDLVFGPAAKQFVLTVVPDYHGFLLAVLPPGAFLGLGMLIAARNWMEIRNKANAADDHAASPALQPALRP

    >gi|253997348|ref|YP_003049412.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylotenera mobilis JLW8]
    MVSLNPPVCNFGQPAVDFDLLGVDGKRYTLANSAGKNGLLVMFICNHCPYVKAIKTRLVDDCRELLQYGINTIAIQSNDT
    ENYPEDSFERMMEEAKLFNFPFPYVLDETQEVAKAYGAVCTPDFFGFNADLELQYRGRFDAAGRRQSEENHPRDLFNAMK
    LIAETGEGPKEQIASIGCSIKWFPQESI

    >gi|253997390|ref|YP_003049454.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylotenera mobilis JLW8]
    MYKFLLGLLMLMCSQLASADLVAKSNFLLKDMAGVQHQLAQYKGKWVLVNYWATWCPPCLEEVPDLVNLYDQHRQKDLMV
    LGVVFDYKDVNEVKAYVDDMLMSYPIVLGDDSVMEQIGAAEVMPTTFIYNPKGKLVKIKRGIVTKQYVESLIKAGVK

    >gi|253997392|ref|YP_003049456.1| thioredoxin [Methylotenera mobilis JLW8]
    MSEHITHLSDASFEQDVLQSQIPVLVDYWAEWCGPCKMIAPILDEISKEYAGRIKVAKLNIDDNQQTPPKYGIRGIPTLM
    LFKNGNVEATKVGALSKSQLTAFIDSNI

    >gi|253997406|ref|YP_003049470.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylotenera mobilis JLW8]
    MELSTISAINFLMLNQTVPDFQLPATSGKTFQRSYYSGKYLVLYFYPKDSTPGCTTQGMQFRDAYAEFQAKNTEIFGISR
    DSLKSHENFKAKFSFPFELLADTEEAACTLFNVIKMKNMYGKQVRGIERSTFIIDANGTLIKEWRGVKVDGHAAEVLSFI
    NSL

    >gi|253997435|ref|YP_003049499.1| methylated-DNA/protein-cysteine methyltransferase [Methylotenera mobilis JLW8]
    MMNTNPQNLCDDAFIRAPFGGVRIAIHDHQLMIELLALPASVQALPPQREIALEVASTHSLVDSATKQVLQYLQQASYDF
    SLPVEQVGTSFQQKVWQAIAAIPRGQTRTYSELALQIGSGPRAVANACGANRLPLVIP
    CHRVVAKNGLGGFMQGTHNGWL
    IKQWLLQNELTSAEGSLHE

    >gi|253997502|ref|YP_003049566.1| Rhodanese domain protein [Methylotenera mobilis JLW8]
    MSEIQEILALAEKRAIEKRLPYAGALTPQEADAILRADASAQLVDVRTRAELELVGRVPTALHVEWAFYPGMVANPDFAA
    HLQAQLKQKGADKDTVIMFL
    CRTGGRSHNAAVVAESLGYLHAYNVLEGFEGDANEYKQRTLINGWKHAGLPWTN

    >gi|253997592|ref|YP_003049656.1| alkyl hydroperoxide reductase, F subunit [Methylotenera mobilis JLW8]
    MALETGIKTQLQTYLQMLREPIVLAASLDETPAAQEMRELLEEITSMSDKITLTMEDDARKPSFAVKRGAGHAEANKAVG
    VRFAGIPMGHEFTSLVLALLHTGGHPMKLEPEKIAQIAAIEGSFHFETYISLS
    CHNCPDVVQAMNMMAVINPNITHVMID
    GALYQDEVKAREIMSVPTIYLNGEVFGAGRMELDEILPKIDLGAVAREAKKLDAQAPFDVLVVGGGPAGASAAIYAARKG
    IRTGIVAERFGGQVMDTLGIENFISVKETEGPKLVMALEEHVKSYDVEIINLQRAVSLTEPGKHGNKNEDLIELKLESGA
    TLRSKSVILATGARWRELNVPGEKEYRGKGVAY
    CPHCDGPLFKGKPVAVVGGGNSGVEAAIDLANFVDHVTLLQFDTELK
    ADAVLQKKLRSLHNVTIITSAQTTEVTGDGNKMNGLTYTDRVTGESKHLALDGVFVQIGLVPNSDWLKGTLNLSKYGEVE
    VNHHNATSLPGVFAAGDVTTTPYKQIIIAMGEGAKASLGAFDYLIRQ

    >gi|253997593|ref|YP_003049657.1| peroxiredoxin [Methylotenera mobilis JLW8]
    MSLINTQVQPFKTEAFHNGKFVEVSDVSMKGKWSVVIFMPAAFTFNCPTEVEDAADNYAEFQKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAKFPLVGDPTHKLTRAFDVHIEEEGLALRGTFVINPEGVIKTVEIHSNEIARDVKETLRKLKAAQFTAA
    NPGQVCPAKWQEGAKTLTPSLDLVGKI

    >gi|253997686|ref|YP_003049750.1| DSBA oxidoreductase [Methylotenera mobilis JLW8]
    MKKFLTALMLLASFSVMAEPQMGKDFDRTAQTINTDNPNKIEVIELFWYGCGHCHSMEAPINAWIKKLPADVTFKRVPGL
    PHQAWAPMAKTYYAMETLGVLEKLHTPLFEAIHTKKTLNPTDEKAAIAWVTQQSGLDKRKVEEVFGSFATNTSLNRAANI
    FRSSGATGVPSLIINGQFITSSTMAGNNDAALKTADYIIANIRADKARAATPAKK

    >gi|253997244|ref|YP_003049308.1| electron transport protein SCO1/SenC [Methylotenera mobilis JLW8]
    MLLRCDSVNKFMRLVLLGLLLPLLVACGQANNAQKFNSTDITGVDFGNTLSLTDHTGKPRSLSDFKGKVVALFFGYTHCP
    DVCPTTLNDMKQSMKLLGAHANEMQVLFVTLDPERDTQPLLAQFVPAFDPSFIGLYGTKEQTATVLKDFKIFAAKVENKG
    RSGYTIDHSAGVYVFDKTGKIRLYVDYGTKPDMIAADIQKLL