Methylococcus capsulatus Bath uid57607

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|53802780|ref|YP_112582.1| anti-oxidant AhpCTSA family protein [Methylococcus capsulatus str. Bath]
    MTIRVGDRLPAGSLTECTEFDPATACPMNPRAVDVGEQARGKKLVIFGVPGAFTPTCSVKHLPGFVANHDRLRAKGVDEI
    WCMAVNDGFVMAAWGREQKAGGKVRMMADGSAEYAKKLGLERDLTANGMGIRCHRFAMIVDDGVVKYLGVEASGKFEVSN
    AEAVLAHL

    >gi|53802748|ref|YP_112597.1| thioredoxin [Methylococcus capsulatus str. Bath]
    MSSDKILHVTDAEFEDKVLKAPGPVLVDYWAEWCGPCKMIAPILDEIAGEYEGRLTVAKLNIDDNPATPQRYGVRGIPTL
    MVFKGGEVVASKVGALTKSQLAAFLEGNM

    >gi|53802715|ref|YP_112614.1| glutathione S-transferase [Methylococcus capsulatus str. Bath]
    MKLYYFPGACSLAPHIVLREAGLDFELENVDLGTKKTGSGADFLQVNPKGYVPALQLDDGQVLTEDQVILQYLADLKPES
    GLMPPSGTFERYRLLEWLAFISTEIHKTFGPFWNPESPEASKQIALGLLSRRLDYVEDRLEAGGPWLMGDRYSVADAYLS
    TVLGWCEYLKIDLSKWPRILAYLERNQARPAVQAAMKAEGLIQ

    >gi|53802699|ref|YP_112622.1| UbiE/COQ5 family methlytransferase [Methylococcus capsulatus str. Bath]
    MYYLEPNKDYRNDSLRKGAEFSEAEIRIDTARHYDDCYWDYRTAWFDNENLALHYGYWEEGIKTHSQALINKNRIMAAIA
    GIEAGDHVLDAGCGIGGSSIWLAKHVGARATGITVSEQQVEHARRNARRHGVADKTEFQVADFCQTPFPDAVFDVVWAVE
    SSCYATDKRDFFREAYRVLKPGGTLIACDGYAARREFDEAEWRAVMD
    CLNGWAVPNLSTVEEFHAGMEECGFREIHVTEA
    TRETLPSSRRMYLTARWTAPMQWIMHWLGLRKKAQTANYKVALAQWKVFSEGMVRYCIFRAEKPV

    >gi|53802630|ref|YP_112738.1| hypothetical protein MCA0202 [Methylococcus capsulatus str. Bath]
    MNNRVEILYCTQCRWLLRATWMTQELLTTFDQEIGELTLKPGTGGLFEVWVNGKRIWSRKEQGGFPEISELKRLVRDEVA
    PGRDLGHADQKGKTGASPAPAEP

    >gi|53802618|ref|YP_112742.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
    MDLTITPSAEKFIQRMVRFGGAGPDAGFRLVVSPGGCSGLASEFSIEAAPLPGDAVVTVQGLKLFLPAESRLLLQGVTMD
    FKDTPLQSGLVFIDPKATGCGSCGSSVSAPVPGEGSAGISGIPIKSV

    >gi|53802586|ref|YP_112759.1| nitrogenase-associated protein [Methylococcus capsulatus str. Bath]
    MARVHFYEKPGCANNARQKQMLREAGHELIVHDLLATPWRAGELRLFFGDRPVAEWFNRAAPRVKAGEIVPESLDAEEAI
    ASMLADPLLIRRPLMRVGERREVGFDPETIRAWIGLGSSRQTADADPESCRRPHPCPALEDSIGR

    >gi|53802541|ref|YP_112783.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
    MTSIVDLTPSEPALIFTGNAAAKVSELIAEEGNPALKLRVYVSGGGCSGMQYGFAFEEAVNEDDTTVEKDGVVLLVDPTS
    LQYLQGAEIDYQEGLEGSRFVIKNPNATSSCSCGSSFSVDGGASCSSH

    >gi|53802540|ref|YP_112784.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
    MAVTLTQKAAAQVQKHLAARGTGVGLRVAVKTSGCSGLAYALEFVDEPAPEDQRFESHGVTVLVDPKSLVYLEGTELDFV
    REGLNEGFKFNNPNVKNECGCGESFNV

    >gi|53802524|ref|YP_112793.1| glutaredoxin-related protein [Methylococcus capsulatus str. Bath]
    MSTIEDTIRDQIAKHPVLLYMKGVPEMPQCGFSAKAVSCLQAAGVPFAYVNVLAAPSIRETLPSVSQWPTFPQLFVGGEL
    VGGSDIVSELAASGELKTLLEAAAAGQAQG

    >gi|53802491|ref|YP_112884.1| hypothetical protein MCA0352 [Methylococcus capsulatus str. Bath]
    MKTLIISGSRGTDDPTMATLPFIAAKAAREQGHDVILWLWNEAVTLARKGTADHVVGVNLTPLKDLLAAVQAAGVPIWVC
    GACAVARQIGEADLIGGAAIKGMPDYIAAVLERDRNIAF

    >gi|53802394|ref|YP_112934.1| suppressor for copper-sensitivity D, putative [Methylococcus capsulatus str. Bath]
    MAHRWRRALRWGAVVALFFAVQGVLNRDMASGPAPAIEGSFLDGSPASLDGLRGRPALVYFWASWCPICGTMEDEIGVLA
    RDHAVITVAYQSGDAGEVARHVAERRLDWRVVPDPDGTIGAAYGIRGVPAFFVLGPDGTIHSRNVGFTPEWLLRLRLWLA
    AG

    >gi|53802371|ref|YP_112948.1| thiol:disulfide interchange protein DsbE [Methylococcus capsulatus str. Bath]
    MMPIERNPTVTSHMRFAIPLVIFVLLVVLLGVGLTLDPREVPSPLIGKPAPAFSLPEVAAADRTLSLEQLKGQVFLLNVW
    ASW
    CVSCRQEHPVLVDFAKRGIVPIYGLNYKDTRNDALAWLKRFGDPYRASVFDEDGKTGIDWGVYGVPETFLVDKHGVI
    RYKQTGPVTHEDLENKILPLIRELQGAA

    >gi|53802339|ref|YP_112964.1| thiol:disulfide interchange protein DsbE [Methylococcus capsulatus str. Bath]
    MPRLFLLLPLLIFSILGFLFFQGMNLDPNTLPSPLLGKRLPAFELPALRDLSRTIRDGDIEGPALVNFWASWCAACRDEH
    ALLVDLARNAGVKIYGIDYVDQRDAALGWLDRLGDPYVEVLFDERGTLGAAFQVMGAPETYAVDGDNIVRYRHVGRLTWE
    VWTAMQAALAGPALPPGSPEE

    >gi|53805176|ref|YP_113094.1| thiol:disulfide interchange protein DsbC [Methylococcus capsulatus str. Bath]
    MKPDSIKPSPLAGISEVIVGPKLFYVSDDGKYLFQGSLIDLKNREDLTEPKLATARLGALEKLGEKNMIVFKPKIGKYVA
    YVFTDID
    CGYCRKLHSELDSYLKEGIEIRYLFFPRAGEGSESWDKAVNVWCAKDRNAALTKAKKGEKVEERTCDNPIKEQ
    MALGTAIGAQGTPMIVTGGGNVLPGYVPAEQLARMLKHEKDEGGRQARTP

    >gi|53805170|ref|YP_113100.1| methylated-DNA--protein-cysteine methyltransferase [Methylococcus capsulatus str. Bath]
    MPDLGLTDAESLGHCLFDTGFGVCGIAWRAFEGKDEAPVVTLFLLPEATAAGTAAAMARRCGGSPTVPPPAIAEVIEKVR
    RHFRGDLQDFSRVRVEPDGAGPFARAVYSAARDVPAGQIRTYGELARALNRPAAARAVGQALGRNPVPLIIP
    CHRILGAG
    GKLGGFSAHGGVATKARMLRLEGVAV

    >gi|53805169|ref|YP_113101.1| hypothetical protein MCA0585 [Methylococcus capsulatus str. Bath]
    MSTAMPGAFSPPRGLADLPLCPVYSRLGRPFHQPVAATSLPEPRMVHFNAALAGELGFGPEAGPQLLEILAGNRPWPGYA
    SSASVYAGHQFGAWVPQLGDGRALLIAEVRTPARERVELQLKGAGPTPYSRGLDGRAVLRSSIREYLASEAMHALGVPTT
    RCLSLVASPQPVARETVESAAVVCRAAASFVRFGQFEYFAGRGQTEPMARLADHVIAEHFPHLQGHPERHAAWLGEVIER
    TARLIAQWQLLGFCHGVMNTDNFSVLGLTLDYGPFGFMDRFRWYHVCNHSDYEGRYAYRAQPEVGRWNCERLLQAVSPLL
    ADAPGRAAEIGQDLLRRYASVYHRAVMRGWADKLGLREVRETDAGLIDEFLGLLQRGRGDFTRSFRLLGRIRTDSDAPAR
    GVREAFADINAFDAWVADYRTRLRSEQNVDDEARAGRMNRVNPKYVLRNHLAQIAIDKAMLGDYSEVARLAELLRRPYDE
    QPDMEAYAAEPPDYMRNIEVS
    CSS

    >gi|53805061|ref|YP_113127.1| mercuric ion binding protein, putative [Methylococcus capsulatus str. Bath]
    MATIQLQVTGMKCGGCENTVVKTVAALAGVTSVTASHKENRVDVEYDPDRIDPDAIRKAIAGQGYTVA

    >gi|53804967|ref|YP_113177.1| anti-oxidant AhpCTSA family protein [Methylococcus capsulatus str. Bath]
    MNTPTLGQAVPDFQAESTSGGTFRLSQRHGRPLVLYFYPKDSTPGCTQEGQDFRDLYPEFQKLGADIVGVSRDSLKSHER
    FRCKYGFPFELLSDGDEALCRLFDVIRLKNMYGKQVRGIERSTFLIDAEGRLAAEWRKVSVKGHAEEVLRAVAGLAAKTS
    A

    >gi|53805105|ref|YP_113215.1| copper-translocating P-type ATPase [Methylococcus capsulatus str. Bath]
    MLLQKHPAVRRVRVVPALGSVTVHFDPAAVTTADLQSFFGKLLDNLGSSPTLPSAVRSGTNPAAPLHEFHVAVEGMTCVS
    CALLIEMLLRRDPRVASASVNFATETAQVLTSMSWDELSGTLRRRGYQARPLDSVAQRRVWLARETTRIGKTWQHCFWSL
    VFSLPTFLIGLFAPRSRLMGWVQLAVSAPLLLGGGREFFDRAWQTARRRSVSTDTLVAAGVGAAYAYSFFSLASGRGGYY
    FEAAAGVMSFVLMGRYLEEKARSQAGQAIRQLVELQPLTATVLQSGRPVSLPIEEIRVGDRLLVRPGERIPADGEVVHGL
    SAVDESMVTGESLPVVKETGHRVTGGSINGDGALQIRVSAVGADTVLAGLLHTLDEAQTSRLPVQRMVDRLSAFFVPAVM
    AVSGATFFGWMAAGAGFGTALIHAVTVLLVACPCALGLATPAAVMVGTGQAARRGIFIRNAESLETAAGLTVIVFDKTGT
    LTEGRPRITDIANVSDLDDAGLLRLAASAESHSEHFIGKAILAHAATLGLAWPEPAEFRLEPGLGIAAIVEGHEVLIGNQ
    RWLDRHKIESGRNLGDAARKLGAQGKTPVFVALDGHAAAVLGVADPPRPDAAEAVASLHRRGVHTLMVTGDVAPAAEHIA
    ALVGIDRIEAGARPGRKLEIIRQLQNRGERVGMIGDGINDAPALAAADVGLAVGHGTDIAKQSADLTLLTGDISKAAEAM
    ELSARTLRVIRQNLSWAFGYNLVAIPLAAFGKLHPMAASAAMAASSVGVVLNALRLQRD

    >gi|53804946|ref|YP_113251.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
    MTSELGIFYRSDFDRAWCDMSAETIKFTDSAAQRVSELLAEEGDQNLKLRVYVTGGGCSGFQYGFTFDEVVNEDDTVVEK
    NGVSVLVDPMSLQYLQGAEIDYTENVSGSQFVIRNPNATTTCGCGSSFSV

    >gi|53804835|ref|YP_113305.1| copper-translocating P-type ATPase [Methylococcus capsulatus str. Bath]
    MSDSAGLDTSTPRAPAAPFAHAWPNLEVVHALRRRIRIQAPALRKDPERCYLLQILLLKHAGIRSVRVVADLGSVAIRFN
    PEQLPRANLLQVADHLIASLGRRRPAPETPGIPVGNGPVREWQFAIEGMT
    CVSCALLIEMMLKRQPGIRDVSVNFATETA
    TVRAVLGRDAVMAAIARLGYRAHAADSIVQRKLMAAREAERLRKARRQALVSVLLSAPVIVLGMVMPHGRVWAWLSAILT
    TPVVLGSGRSFFSKAWKLAGQGTANMDSLVALGVGAAYGSSVVALLTRRGELYFEAAAAIVSFVLYGRYVEETSRGRAHE
    AIRRLLDLQPATATLLKDGEEFEVPVESLQVGDVVRVRPGDRLPTDGEVLSGISGIDESMVTGESVPAIKRPGDRVIGGC
    VNGSGALQVRVTAVGEDTVLAGIIHMVEQAQSSKLPIQKTVDRVSAVFVPTVLVISAGTFLGWVWLGAPAARAFANAIAV
    LLIACPCALGLATPAAIMVGTGQAARKGIYIRNGESLEMASKLTAIVFDKTGTITEGKPEVTDLIRFARLGETRLLSLAA
    AAEIDSEHFLARAIVRKARDVGAEPMVSHAFDSVPGRGIRARVDRREVLIGNAEWLEESGVGLTAAVEPVANLAGQGKTP
    VFMALDGKLAAVFGIADRPREHARAAVQRLQDLNVRTLMVTGDVEAAAQHIAQQVGIAEVTARARPERKLEIIRALQEQG
    ERVGMIGDGVNDAPALAAADVSFAIGSGTDVAIQTADMIISQGDISRVADGMALSQFTLRVVHQNLAWAFGYNTIAIPLA
    VMGRLSPMIAAGAMAFSSVSVVLNSLRLQRR

    >gi|53805013|ref|YP_113337.1| glutathione peroxidase [Methylococcus capsulatus str. Bath]
    MNIYEFEVRTLEGETVRLDGYRGKVLLIVNVASRCGFTPQYAGLEALYRRHRNAGLVILGFPCNQFGGQEPGSETEIRRF
    CSSRYEVSFPLFAKIEVNGEHTHPLYAYLKSAQPGLLGSEAIKWNFTKFLVGRNGEVVKRYAPTATPESIEPGLLPLLTV
    GSGG

    >gi|53804842|ref|YP_113499.1| antioxidant, AhpC/Tsa family protein [Methylococcus capsulatus str. Bath]
    MSVLVGKPAPDFKAAAVLGCGTIVDDYWFSKETKGKYVALVFYPLDFTFVCPSELIALDHRVDELKKRGVEVIGVSVDSQ
    FTHNAWRNTPIDKGGIGPVKYTLVADVSHAIVKAYDVEVEGAAVAYRGTFLIDKSGIVRHQVVNDLPLGRNMDELIRMVD
    ALQFHEEHGEVCPAGWNKGQSGMKADPEGVASYLSKNADKL

    >gi|53804808|ref|YP_113516.1| DsbD family thiol:disulfide interchange protein [Methylococcus capsulatus str. Bath]
    MRDAVKRIGLLLILGLVGIPALAVDGRDLLPPERAFPVAARQSGAGVVSLVWDIVDGYYLYRSKFKFASRTAGVRLGEPV
    FPEGHKKHDAFFGEVETYRGHIEVRLPLVAESALPESLELEVTVQGCADAGVCFPPYQRRVEVKTSAISGGGAFTRLAGA
    LRNVGTGVATGDLLPPDQAFRFFAEAPTGEILRLGWQIAPGYYLYREKFRISLRDSGGVALGDYTFPRGEPKVDEEFGAV
    EVFHGEVAVDVPLVRTDAGPRTVTVEAGFQGCAERGVCYPPMTRTIDLVLPAAAEGKSVSAMAGATLITEQDRIADGLWR
    GSLWLNLLSFLGLGILLAFTPCIFPMIPILSGVIVGHGHAITTRRAFSLSLAYVLAHALAYTCFGVLAALFGANLQVALQ
    NPWAIGVFSGLFVVLALSMFGFYQLQLPTVLQSRLAALSSRQQAGSLVGAAVMGLLSAGLVGPCVAAPLAGALIYIGRSG
    DVLLGGLALFSLGLGMGLPLLAVGTSAGKLLPKAGMWMNTVKSVFGVAMLAVAVSMLERIVPLSLAMLMWALLLIVPAVY
    MGALDALPAGASGWRKLWKGLGVAMVAYGVFMLLGVAAGSRDPLQPLRGVAGASATVADAGPPPFVRVASLADLEARLAE
    AAAAGRWVMLDFYADW
    CVSCEEMERHTFSDPVVKAKLKEMVLLKVDVTENDDEDQALLQRFGLIGPPATLFFGPDRSERK
    PFRLVGFTESEEFVHHLERLFDGVR

    >gi|53804807|ref|YP_113517.1| thiol:disulfide interchange protein like protein [Methylococcus capsulatus str. Bath]
    MFPDMSGRPVRLSDEHSEVLLLNFWASWCEPCREEMPMLDELQAEFGPRGLKVVGLALEDRAAVAAFLRRLPVGYRILVG
    ERGGDALAARLGDAGGGLPFTVAFDIRGQVLATFLGSQTRDGFLAVIGPRLLSPR

    >gi|53804399|ref|YP_113720.1| resA domain-containing protein [Methylococcus capsulatus str. Bath]
    MRFVRFLAVAGLLVPVIWFGCGPFERKNLSPALGFTTIEGQRVNLEEWRGRPVLLAFWASNCRSCLEEMPELAAMFRDYQ
    GQGLRMAAVAMPYDVPSRVVSLAGKEGWPFPVALDPLGQLAGALGVELVPNCYLLDGDGAIVATYLGKPDFRELRGTIDK
    LLREG

    >gi|53804549|ref|YP_113802.1| putative mercuric reductase [Methylococcus capsulatus str. Bath]
    MSRHELLIDGMTCTSCAEHVRQALEKVPSVRSASVSFPRKRAEIEADPGVGPDPLVAAVTALGYRARVSDTPGKSAGGLF
    DETFGCPDGGTKRVSGEPALHVTVIGSGGAAMAGALKAVELGARVTLIERGTIGGT
    CVNVGCVPSKIMIRAAHIAHLRRE
    SPFDEGLPPTPPVVLRERLLAQQQGRVEELRHAKYEGILASTPAVTVLRGEARFMDAHTLTVALCHGGTRELSFDRCLVA
    TGASPAIAPIQGLADTPYWTSTEALASDTIPERLAVIGSSVVAVELAQAFARLGSRVSILARRTLFFREDPAIGEAVTNA
    FRLEGIEVLEHAQASQVAYANGEFVMTTGHGERRADKLLVATGRAPNTRNLNLEAAGIKVDAQGAIIVDRAMRTSAPHIF
    AAGDCTDQPQFVYVAAAAGSRAAINMTGGSAELDLTTMPKVTFIDPQVATVGYSEAEARHDGIETVSRTLTLDNVPRALA
    NFDTRGFIKLVAEAGTGRLIGVQAVAPEAGELIQAAALAIRHRMTVQELADQLFPYLTMVEGLKLAAQTFTKDVKRLSCC
    AG

    >gi|53804135|ref|YP_114007.1| ArsC family protein [Methylococcus capsulatus str. Bath]
    MTTLTLYGIANCEACRKARQALESRGCSSCFHDLRRDGLDRLLLERMVTDLGWENLLNRRSATWRALPEPIRTPLERERA
    LELMLEHPTLIKRPVVERAGRFFLGLGDLLP

    >gi|53804132|ref|YP_114010.1| mercaptopyruvate sulfurtransferase [Methylococcus capsulatus str. Bath]
    MTCLSGGSFFVRRKDGRQWYHASLSRDFRSVPMPETAFPPLVDVRWLAGHLHDPQVVVVDASFFMPAQRRDAKTEFGAAH
    IPGARFFDIDAIADTTCPLPHMLPAPAFFAEQVGRLGIGNDTHVIAYDGNDFMASARVWWTFRVFGHDRVSVLDGGLRCW
    RDQGLPLSSEEAARTECEFQARFRPELVSNLEDLRKAAAERSIQILDARSPGRFAGTEPEPRPGLRSGHIPGSRNLFFQR
    LIDETSHCFKSVAALAALYRDAGIDLDRPVTTT
    CGTGVTASILALGLYLLGRTDTAVYDGSWTEWGGRTDTPVETG

    >gi|53804018|ref|YP_114137.1| thioredoxin-disulfide reductase [Methylococcus capsulatus str. Bath]
    MSEPKHSRVLILGSGPAGYTAAVYAARANLRPVLVTGIQMGGQLTTTTEVDNWPGDADGVMGPDLMERMRRHAERFDTEI
    VFDHIHTADLSERPFTLTGDAGVYTCDALIIATGASARYLGLPSEEAYKGRGVSA
    CATCDGFFYKGKHVAVIGGGNTAVE
    EALYLSNIAAKVTVVHRRDKFRSEKILSDKLLERAANGNVSIEWNSVLEEVLGDDMGVTGMRIRNVQDGTSKDIALEGVF
    IAIGHSPNTEIFAGQLGMRNGYIVVKGGSEGGATATTVEGVFAAGDVSDSIYRQAITSAGSGCMAALDAEKFLDSLG

    >gi|53803922|ref|YP_114181.1| rhodanese-like domain-containing protein [Methylococcus capsulatus str. Bath]
    MRQLTPHQVKALLDEPEAAPLLLDVREPGEFAFCHIDGSLHIPMGEIVSRLGELDPDWTTVVVCHHGMRSFQVARFLETQ
    GFGRVINLAGGIDAWAREADPGMPRY

    >gi|53803906|ref|YP_114189.1| OsmC/Ohr family protein [Methylococcus capsulatus str. Bath]
    MKARIKWVDHMAFLGESGSGHAVLMDTAPESGGRNLGVRPMEMLLLGMGGCTAFDVVHILKKGRHDVRDCEVQLEAERAE
    TDPKVFTRIHAHFVVKGKGLREEVVKRAIELSAEKYCSASIMLGKTAEITHDYEIADG

    >gi|53804095|ref|YP_114254.1| rhodanese-like domain-containing protein [Methylococcus capsulatus str. Bath]
    MALTPMDLVAAAKQRIREIGPGEVRTMLGDTLILDVREPEEYAAGHLPGAINIPRGVVEFRIETHPVFQGKKDAAIVVYC
    QSGLRSTLATDILQQLGWRGTVSMAGGFKAWIEGGLPVSS

    >gi|53803989|ref|YP_114388.1| peptide methionine sulfoxide reductase, putative [Methylococcus capsulatus str. Bath]
    MGEQPPKGEPKRLSEPRKTACAGLGPTQTGTWPLRWTLFQRPVRDFDGDTAMGWDRKNFRRPTEEEIKERLSEEQYAICR
    GNGTERPFANPYWDNHREGIYVDIVSGEPLFSSADKFDSGTGWPSFTRPLEPDHIVTLTDHSHLMVRTEVRSRYGDSHLG
    HVFDDGPAPTGKRY
    CINSGALRFIPKEELAEAGYEEYLKLFD

    >gi|53803979|ref|YP_114392.1| stringent starvation protein A [Methylococcus capsulatus str. Bath]
    MATAASRKSVMTLFCSPTCVYSHRTRIVLHEKGISADVEYVDMGDPPEDLVELNPYGTMPTLVDRDLVLYDSRIIMEYLD
    ERFPHPPLHPMDPVSRARARLLVHRVEQDWYGLVEEIENASDGGAQKARKQLRESLLAATPVFAAKPYFLSDEFCLVDCS
    LAPLLWRLPMLGIELPRQAEPVKAYAARLFERHSFQASLSDEEREFGAAARLTPENA

    >gi|53803690|ref|YP_114452.1| hypothetical protein MCA2020 [Methylococcus capsulatus str. Bath]
    MVSTETPECEFGRKAPDFALPGVDGKIWTLERCRGPKGLLVMFICNHCPYVKAVQDRLVRDAKDIQALGIGVVAIMPNDP
    TDYPEDSFENMQKVAADLSYPFPYLLDETQAVARAYGAVCTPDFFGYNADLELQYRGRLDASRREASPPGCRRELYEAMK
    QIAETGKGPAEQIPSMGCSIKWRNA

    >gi|53803908|ref|YP_114502.1| copper-translocating P-type ATPase [Methylococcus capsulatus str. Bath]
    MRCAGCVEAVETALKEVPGVESVSVNFGDHSALVKGEADPESLKAALKEAGYDGAVMEALEDPAAQERAEEERYRELLKK
    AAWAGSLGVPLMLGAHLDWFPMIGTASGTTFWTLVSLLTLVVLYFSGGHFFRGAVKSFQHRQANMDTLIALGTGAAWFYS
    TVAIDSVELLPAQGQHAYFEAAAVILAFINLGSALETRARGKTSSAIRALIGLQPRTARVIRDGQELDVPIAEVGLDEIL
    RVRPGEKIPVDGVLVEGRSTVDESMLTGEPMPVEKGEGDTVVAGTLNQSGSFLFRATRIGRDTVLAQIIASVRQAQSTKP
    EIARLVDKVSAVFVPVVVGISAFTFLVWWIFGPAPSFGYAFVTAMTVLVIACPCALGLATPISIMVAVGRAAQHGILIRR
    GEALQSAGRLTAAVLDKTGTITEGRPSVMGIDTAPGWSEERVLGLAASLEAGSEHPLASAVLRAAEAGKIATSAVEGFAA
    EPGHGVAGSVDGSRLLLGNVAMMEKYGVDLHAFEGLLANCFQEALTPLLLAADGRVVGLLRVADPIKPDAREAVQRLKEL
    GIRVLMVTGDHEATARAIARSVGIDEVRAQVLPQDKATVVKELQSRGEIVGMVGDGINDAPALAQADVGFAIGTGTDIAI
    ESGDVVIMAGSPLKVSEAVHLSRLTVRNIKQNLLGAFIYNTLSIPIAAGILYPFAGILLNPMIAGAAMALSSVTVVTNAN
    RLRWL

    >gi|53803893|ref|YP_114508.1| glutaredoxin-related protein [Methylococcus capsulatus str. Bath]
    MDVIENIKRQIADNPVILYMKGTPDFPQCGFSGRAVQILDKCGVEYAFVNVFEAPEVRENLKLVSHWPTFPQLFVRGELV
    GGSDIMMELYESGELQKLLAGATKAGERQD

    >gi|53803819|ref|YP_114543.1| rhodanese-like domain/ankyrin repeat-containing protein [Methylococcus capsulatus str. Bath]
    MMYRRISTREARELIAAREPLLLDIRDASAYRSGHLPGALLFSDLDPLALRRVLPRDKPLLVYCYHGIASQDVARLFADL
    GFGEVYSLDGGFEAWHADTAHVGMTAAPLADWLREHGFEPGEPNRQGGGTWPLIKACQQGRADIVEALAAAGADLTVTDA
    YGNDALWAACYSGDLTTVAAVLDAGVDPDRRNPSGATALVFAASSGRTEVVSLLLDRGADPGIRTEDDFTAMDLAANLEI
    LHLLRRAQRRESHA

    >gi|53803787|ref|YP_114559.1| glutaredoxin family protein [Methylococcus capsulatus str. Bath]
    MLPVRMYSTAMCPFCSAAERLLKSKGVVEIEKIRVDLDPARLQEMMTITHRRTVPQIFIGDRHVGGFDDLAALERTGELG
    ELLSGPA

    >gi|53803786|ref|YP_114560.1| thioredoxin [Methylococcus capsulatus str. Bath]
    MQLVCPACLTRNRVPADRLGEQPKCGRCSTPLLSGHPVELDDGRFDAYTRHSDLPVLVDFWATWCGPCRSLAPVVAQAAD
    ALNGRILVAKVDVDRAPATAQRFNIRSVPTLVLFRHGQETRRISGALGFGPLMDWLQRG

    >gi|53803486|ref|YP_114631.1| HesA/MoeB/ThiF family protein [Methylococcus capsulatus str. Bath]
    MDDVQLLRYSRQIMLPEVDAGGQDRLLGASALIVGLGGLGSPAAMYLASAGVGRLVISDFDAVDLSNLQRQIAFDTADIG
    RSKAEACAGRLRRMNPDVRIEPVAERLSAAALEEWAGAVDVVLDCSDNFATRFAVNAACVATRTPLVSGAAIRFEGQLAV
    FTPGDGVNPCYNCLYPQGGEPDAS
    CARNGVVAALPGIIGSLQALEAIKLLLGLPGVRSDRLVVFDALRLEWHEVRLGRNP
    SCPTCGRR

    >gi|53803509|ref|YP_114801.1| Na(+)-translocating NADH-quinone reductase subunit E [Methylococcus capsulatus str. Bath]
    MEAYINLFIKSVFIENMALSFFLGMCTFIAVSKKIETAVGLGIAVVIVQTLTVPANNLIYTYLLKEGALSWAGLHDVDLS
    FIALMACIGVIAAMVQILEMVLDKFFPALYNALGIFLPLITVN
    CAILAGSLFMIERDYNFSESVVYGVGSGFGWALAITA
    MAGVREKLKYSDVPAGLRGLGITFISAGLMALGFMAFSGIQL

    >gi|53803508|ref|YP_114802.1| Na(+)-translocating NADH-quinone reductase subunit D [Methylococcus capsulatus str. Bath]
    MNEESKKVLIEPLVDNNPITLQVLGICSALAVTSQLSTALIMSLALTSVTACSSAGIALIRNHIPSSVRIIAQMVIIASL
    VIVVDQLLKAFAYEISKQLSVFVGLIITN
    CIVMGRAEAYAMKNPPWESFLDGIGNGLGYSLILVTVATIRELLGSGKLLG
    IDVLPLVKDGGWYVPNGLLLLPPSAFFLIGLLIWAIRSWKTQQVEKADFVIATAHGEAH

    >gi|53803473|ref|YP_114822.1| hypothetical protein MCA2408 [Methylococcus capsulatus str. Bath]
    MIRHLASGFVAVFFAASASANPAPDCRLSRYQDGTPLNIAGFKGKVTYVDFWASWCGPCLQSFPFMAETYKEFKPKGFEL
    IAVNLDEEREGADAFLAKQHADFTIASDPAGDCPRQYDVQAMPSSFLIDRKGNIRHVHLGFREKDKAEIRAQIEALLSEP


    >gi|53803351|ref|YP_114889.1| hypothetical protein MCA2477 [Methylococcus capsulatus str. Bath]
    MPDPQRSNRLAGETSPYLLQHAHNPVDWYPWGPEALEEARRSDRPILLSIGYSACHWCHVMAHESFEDEATAEVMNRLFV
    NIKVDREERPDLDRIYQTVHQLLSRRGGGWPLTVCLNPHDLVPFFTGTYFPKEPRYGMPAFVSVLHHLAAFYAEHRGDLA
    RNGQVLREALEAMGREGDGALMPDAGLLARATQALRTSFDASHGGFGGAPKFPRTADLELLLRSDGEGVEMLRTTLDGMA
    RGGIYDHLGGGFARYSVDERWEIPHFEKMLYDNGPLLELYARMAAQTGDPAYAVVATGTAEWVIREMQSPEGGYYAALDA
    DSEGGEGRFYLWDRQEVQGLLSADEYLVFSLRYGLDGPPNFEGHWHLRVARSLEAVAAATGKGGDEVTRLLESARTRLRR
    AREQRVRPGRDDKVIAAWNGLMVRGMTVAGRLLGRADFMESADRALGFVRRTMDAGGRLMSVYRDGRARFDAYLDDHAFL
    LDAALEILQTRWSTDDLEWAVSLADRLLERFEDAEHGGFFFTAADHETLIQRPKPWMDESMPSGNGVAIRALIRLAGLTG
    ESRYADAAERGLRAAHGAMARYPHAHCALMNAVREWLTPPPLVILRGGREALKQWCAKAREAAPEALVYAIPSDAVGLPS
    ALAARMPGPGGPVAYVCRGRVCAAPTDSLGTLNEILSAC

    >gi|53803272|ref|YP_114931.1| arsenate reductase [Methylococcus capsulatus str. Bath]
    MSVTIYHNPRCSKSRETLKLLQQRGIEPVIIEYLKTPPDAASLRELVRLLGISPRQLLRKGEAPYKDLGLANPELDDETL
    IEAMASHPVLIERPIVVANGKAALGRPPENVLAILG

    >gi|53803358|ref|YP_114947.1| rhodanese domain-containing protein [Methylococcus capsulatus str. Bath]
    MTRLLEFLGNHWMMAGALLVVTVLLIQDLLESLFRKHKVLTPAGAVQLMNTEDTLVVDVREPAEFAEGHIEGAYHIPLGK
    LEERASEIAQYKEKPVIVT
    CQQGTRSPSACKTLTKQGFSRIYEMRGGMLAWRDAHYPVTRKRKKS

    >gi|53803235|ref|YP_115007.1| thiol:disulfide interchange protein DsbA [Methylococcus capsulatus str. Bath]
    MLRTGLGVAFLALFSSLLSAAPAPAETQEYTAGKDYEVINPPQPTTDPSKVEVLEFFWYGCPHCYHFEPDLNAWLKTKPD
    NVVFIRQPAVFNERWAAHAKMFYTAEALGVLDKLHPQFYEAIQVKKLALASEDEQAKFFTEHGVTKDAFQKAYKSFAVDA
    KMRQAEGMGARYGISGTPTLVVNGKYRVSGSLAKSYPNMIAITNYLIAKESGKPAK

    >gi|53803242|ref|YP_115017.1| rhodanese-like domain-containing protein [Methylococcus capsulatus str. Bath]
    MSKWLRAAILALTLPAAPVLGGELIGITPDELETLKVQGVPVVDVRTPEEWRKTGLIEGSKPLTFFDSKGAYDAADWLRR
    FKAIAPDVARPVVLV
    CRSGNRTAMVGKMLTQELGYERVYHLEKGLQVWSAEGHKLSPCGNC

    >gi|53803241|ref|YP_115018.1| thioredoxin family protein [Methylococcus capsulatus str. Bath]
    MSDSPFDFDRDVIETSFTIPVLVDFWAPWCAPCRALTPVLEAVAGRLAGRFELVKVNTEEHPEIARRYGVRGIPNVKLFV
    DGTVADEFTGTLPESALEDWLQRALPSPYQARLEQAEALISAGRVAEAEPVLRQILAAEPAYDPAAVLLARVLLDTDPDQ
    ALETLKPIGPDSDQSEAAEALRTLARLFGLLEHPERLAEAPAKSAYLDAIRKIREERYEPALAQLIELVRKARDYDEGGA
    RKACVAIFRLLGNGHELTRRYRGQLSNALYV

    >gi|53803073|ref|YP_115172.1| pyridine nucleotide-disulphide oxidoreductase family protein [Methylococcus capsulatus str. Bath]
    MTADAAIRGIREIDAQGSIGLIGSEPHLPYKRPLLSKGLWLGKSFDQIWYGTETCGISAFLGRTVTRLDLAEKSVTDDEG
    TIYRFEKLLLATGGRPRRFPFGGDDILYFRTVDDYFRLRTLTETRRKFAIIGGGFIGSEIAAALASIGKDVVMIFPEACI
    GARVFPGNLCRFLDGYYRDQGVELLSGRTVTGLVREGDGLRLALGETGEEVLVVDGVVAGIGIEPETRLAEAAGLPVEGG
    IVVNDFLQAGHPDVYAAGDAASFFSPVLGRRMHVEHEDNARTMGRLAGRNMAGEASPYRHLPYFYSDLFDLGYEAVGELD
    SRLETVEDWSEPYHKGVVYYLDQGRVRGVLLWNVWDRVEAARALIGEPGPWGAGDLAGRL

    >gi|53802995|ref|YP_115213.1| SoxR-reducing system protein RsxE [Methylococcus capsulatus str. Bath]
    MNPDFRKITRDGLWDNNIVFSQSIGLCPLLAVTGTATNGLGMGLATLAVMVVCNVLVSWVRVLIPSEIRIPVFVVLIAMV
    VTLVDMMMNAWLHEMHKVLGLFIPLIVTN
    CAILGRVEAYASRHPVAHAAMDGLMMGLGFTLALVVLGAAREALGAGTLFA
    SARLLMGDSFAWLETTLIHGYRGFLLMALPPGGFLMLGFLLAGKKLIDKRLAARQRRSIAVGETLVET

    >gi|53802982|ref|YP_115218.1| electron transport complex, A subunit [Methylococcus capsulatus str. Bath]
    MNDYLMLLLGTALVNNVVLVKFLGLCPFMGVSRKLDSAVGMGFATTFVLTLTAVASWLIEHFVLMPLGIGFLRILSFILV
    IAAVVQFTEMVVKKTSPVLYQVLGIFLPLITTN
    CAVLGVALLNIQQEYDFIHSALFGFGSALGFTLVMVIFAGIRERLAL
    MSVPEAFTGPPIAFITAGILSLAFMGFAGLATH

    >gi|53803065|ref|YP_115245.1| rhodanese domain-containing protein [Methylococcus capsulatus str. Bath]
    MIEQIDPAAAWQFMLEHPEHVLIDVRDPIEFTMIGHPPGAHNVPLKFAPGWLINPDFLEGVRQIVPDLATPVLLLCRSGQ
    RSQEAAEQLSAAGYSKLYNIREGFEGPLDDSRHRSSRGGWRYRGLPWEQS

    >gi|53803003|ref|YP_115278.1| HesB/YadR/YfhF family protein [Methylococcus capsulatus str. Bath]
    MTVTVTENAAAQIARQLRRRGHGLGLRLGVRQAGCSGYSYVVDYADEIAADDAVFEQHGVTVVVKTADLTYLDGVEIDYT
    REGLNETFRFHNPKATASCGCGESFAV

    >gi|53802987|ref|YP_115286.1| Na(+)-translocating NADH-quinone reductase subunit E [Methylococcus capsulatus str. Bath]
    MKDYLLILVSTTLVNNFVLVKFLGLCPFMGVSRKSETAIGMGLATTFVLTLSSVSSYLVDRFLLEPMGLQYLRTLAFIVV
    IAVVVQFTEMVVKKTSPLLYQVLGIFLPLITTN
    CAVLGVALLNVQAGHDFIESFLYGFGAAAGFTLVLVLFAGLRERIDA
    ADVPAPFRGSAIALVTAGLISVAFMGFSGLVRG

    >gi|53802974|ref|YP_115291.1| SoxR-reducing system protein RsxE [Methylococcus capsulatus str. Bath]
    MKLGPYRKIALDGLWHNNQALVALLGLCPLLAVSSTVVNSLGLGLATTVALVFSNGVVSLIRNRITPDVRLPVFVLVIAA
    NVTVIELLMNAFFHDLYKILGIFIPLIVTN
    CAIIGRAEAFASKNAVDRAVLDGLFMGLGFTAALVALGAFREIVGTGALL
    NRAELMFGETARNWSVRIIENYDGFLLAILPPGAFIGLGLIIALKNVIDARAKVRAQAAAGQPVAFTPAVRKA

    >gi|53802840|ref|YP_115368.1| peptide methionine sulfoxide reductase [Methylococcus capsulatus str. Bath]
    MWFKSAGSALPDPHDALPGRATPLQVTETHFVHGRRIRPPFPSGTARAFFGMGCFWGAERRFWTLPGVYSTAVGYAGGST
    PNPTYDEVCTGRTGHAEVVLVVYEPDKVGFDALLQVFWTSHDPTQGMRQGNDVGTQYRSVIFATTPEQLQWALVSRDAYE
    RALERAGRGGITTEIRMAPDFYYAESYHQQYLAQHPNGYCGLRGTGVECPPFRIEQSRADPI

    >gi|53802925|ref|YP_115390.1| pyruvate dehydrogenase complex, E3 component, dihydrolipoamide dehydrogenase [Methylococcus capsulatus str. Bath]
    MAEPKTIHADVLVLGGGPGGYTAAFRAADLGRQVVLVERYPTLGGVCLNVGCIPSKALLHVAQIIHEAREAGEFGLRFGA
    PEIDLDQIRGFKDKVVKTLTGGLETLARQRKVTVVQGTGRFTGEHGMQVETTDGPVTVGFDHAIIAAGSRAVKIPDFPHD
    DPRLMDSTDALALQEVPKRLLIVGGGIIGLEMATVYHALGAGITVVELMDQLIPGCDADLVRPLHQHIKKQYENIYLKTR
    VSRIEPEAAGLKVFFEGEGAPESDLFDRVLVAVGRAPNGALIGAENAGVHVDAKGFIPVDEHQRTNVPHIYAIGDIVGNP
    MLAHKATHEAKVAAEVIAGKPSAFQALTIPSVAYTDPEVAWMGVTEAQAKAQGIEYEKAVFPWAASGRALGIGRKEGATK
    LLCDKTTKRVIGAGIVGPHAGELIAEAVLAMEMGADAEDIGLTVHAHPTLSETFAFAAEMIEGTITDLYIRKR

    >gi|53802915|ref|YP_115392.1| pyridine nucleotide-disulphide oxidoreductase family protein [Methylococcus capsulatus str. Bath]
    MNSIPKRILIVGGVAGGATCAARARRLCETCEIVVFERGPHVSFANCGLPYFVGDVIPSEANLLVASPDLFARRFNIEVH
    TETEVIGLDRHARRIEVRDLRTGAVRPEPYDALVLATGAQPVRPPLPGIDLPGIHVLRTIPDSRGIKAAVAHAKRVVLVG
    GGFIGLEMAENLVGLGLEVTLLELADQVLPPLDPEMATYAAERLKTHGVSLRLGEGVEAFDKHPEHGLNLRTSKGGTIAA
    DLVILGIGVRPESGLAAAAGLELGAFGGIRVDEYMRTSDAAIWAVGDVVEVKNRVTGEWQLVPLAGPANRQGRVAATAIL
    HHFECSDGTPPPLKFEGVLGTAVCEVFGLTIACTGANEKVLRRAGMDYDKVYLHPGHHASYFPGAKPIHIKLLFSRTDGR
    ILGAQAVGELDVARRIDVIATAMMQGATVFDLEDLELCYAPQFGAAKDPVNLAGMIAANHLRGDLSLAAWEALTETTALL
    VDVRSEAEFAAGHIPHARNLPLETLRDRLSELPRDREIWLV
    CGVGQRAYYAYRLLYRAGFNVKVLSGGMQTYRAWMRARD


    >gi|53802896|ref|YP_115403.1| YeeE/YedE family protein [Methylococcus capsulatus str. Bath]
    MKTFEYNEMRKGSLPNVHCTPYSAAHWCTNSDGILMNSQTLLSALGGGALIGAAACGLLYSNGRLAGVSNILAGMLWPAS
    VDWAWRCAFVLGLVVAGVLLLGVYPEAFDTAPRPLWALGIGGFLVGLGAQISNG
    CTSGHGVCGLGRRSMRSVIAVLTFMG
    TGMATVLLFNRLSGG

    >gi|53802807|ref|YP_115446.1| disulfide bond formation protein B [Methylococcus capsulatus str. Bath]
    MTLPSARTCFLLGFLFCAALLAAALYFQFSGGLEPCPLCISQRIMVLAVALVFLAAAIHHPASLGIRAYALLGTAVALGG
    ASISGRHVWLLHLPPEEVPE
    CGPGLSYMFRNFPLGDTLKAMLSGTGDCAKVDWTFLGLSMPAWVLICFLGLGAFSLLQWW
    NAER

    >gi|53804573|ref|YP_113793.1| intracellular sulfur oxidation protein DsrE [Methylococcus capsulatus str. Bath]
    MKFVIQIDASPHEAQAANTAYQFIKAALANGHHILLVFFYYDGVCNAQVSSFAGKDDLSGRWSALAREHGLDLVLCVSAA
    QRRGLVSAEGKDQGLLAPGFRIGGLGQWVDACLKADRILTFTS