Methylocella silvestris BL2 uid59433

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|217976299|ref|YP_002360446.1| arsenate reductase [Methylocella silvestris BL2]
    MDVIIYHNPKCGTSRNVLGLIRNAGIEPHVIEYLKTPPTRLLISQLAARTGQPLRALLRDKEAIFASLGLDKPDVSDDAL
    LDAIEKHPVLLNRPIVVSPKGVKLCRPSELVLDLLPAQQGEFFKEDGERVVDEKGRHVASA

    >gi|217976319|ref|YP_002360466.1| glutathione-disulfide reductase [Methylocella silvestris BL2]
    MTDFDVDLFVIGAGSGGVRAARIAAGYGARVAIAEEFRVGGTCVIRGCVPKKLMVYASRFRDEFDDAAGFGWTIPETAFD
    WPKLVAAKEREISRLSAIYRANLEKAGVAMIDSRAEIEDPNSIVLADGRRLSAKIILVATGGTPVLEPEIPGRELAITSN
    EVFDLPVMPPRLLIVGAGYISVEFASIFTRLGSKVAIASRGENVLRGFDDDMRCGVRDALVEEGVEMHFSHLPTRIEKID
    GGLRVHLTSGLQLDVDQVMMATGRRPHTKGLGLERAGVKLDGVGAVIVDHFSQSNVKSIYAVGDVTNRIQLTPIAIREGH
    AFADTVFGDKPTAVDHAHVPTAVFTTPELGAVGLTEVEAREVCDCVDIYQASFRPLKATLSGRTEKTMMKIVVDGRSDVV
    LGVHILGEGAAELAQVLAIAIRLGAKKADFDATIAVHPTSAEELVTMRARTARFERATAGPEAPDAVDAEFLNG

    >gi|217976324|ref|YP_002360471.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylocella silvestris BL2]
    MKRMTLFLSFCLGIFATGAMAALKPGDAAPDFSLEAAQGGKPFKFSLAEALKKGPVVVYFYPKSFTSVCTQEAHEFAESI
    EDFAAAGASVIGVSSDNIVTQQEFSSKECRDKFPVGADPDFSVIKAYDAAFTLPIAGPAYAHRISYVISPAGKILSAYAD
    SGAEKHISTALAAVRKWREAHKP

    >gi|217976445|ref|YP_002360592.1| UBA/THIF-type NAD/FAD binding protein [Methylocella silvestris BL2]
    MSQPVLSPEEIERYARHIVLRGVGGPGQQKLRAARVLVIGAGGLGAPLLQYLAAAGVGTIGVVDDDHVSLSNLQRQVLHR
    TEDVGRAKVDSAADAIARLNPHVEVKLHALRLKEANARALVAGYDVIADGSDNFATRYSVSDACFYERRPLVTAAVGAFD
    GSLTVLKPYETGPNGEPNPSYRCIFPQAPPSRLAPN
    CADIGVLGALTGMLGAMMALEVIREIVGFGENLVGRLVLIDALD
    MRFETVRYRWDPDNPLNGEKSAAS

    >gi|217976619|ref|YP_002360766.1| Rhodanese domain protein [Methylocella silvestris BL2]
    MNQTLFVSTEWLADRLGSTDLAIVDGSFFMPAEQRDARAEFAAGHIPGAVFFDIDAIADRSTSLPHMLPSPEAFAAAAGK
    LGLSEGMTIVVYDNSDLVGAARVWWTLRLFGAKEVKVLEGGLAKWRKEGRLLETGERLHKPRNFAAKLNRAGVAAAADVL
    KASEMATAQIVDARSAGRFTGEVAEPRPGLRSGHVPGSRNVPWPEVAAKGRVKPPEEVKAAFAKAGVDLSRPIITT
    CGSG
    VTAAILLLALESVGKQGVALYDGSWSEWGGRLDLPIATGEAEDIAG

    >gi|217976680|ref|YP_002360827.1| iron-sulfur cluster assembly accessory protein [Methylocella silvestris BL2]
    MSEAAVEAPVEMSENAALRISEILKTEPEGSFLRIGVDGGGCSGFTYTYKIETARDDEDLVLDRDGALVLIDPVSLEFLR
    GCRIDFINNLMGRMFKIENPAATASCGCGSSFAV

    >gi|217976709|ref|YP_002360856.1| dihydrolipoamide dehydrogenase [Methylocella silvestris BL2]
    MADPYDVLIIGGGPGGYVAAIRAAQLGLRTAVVEREHLGGICLNWGCIPTKALLRTAEIFHYMEHAKDYGLKAGGKAEAD
    VGAVVKRSRAISAQLNAGVGFLMKKNKVDVIWGEATITKVGEVAVAATKKAIVQPQNPIPKGVLAEGVYRAKNIIIATGA
    RPRALPGLEPDGKLIWTYFEAMKPDAFPKSLIVMGSGAIGIEFASFYRTLGAEVTVVEVLPQILPVEDAEIATLARKRFE
    KQGMKLLTSTKVTKLEKTADGVTATLEDAKGKVETLKAERVISAVGVVGNIENLGLEALGVTLDRGTIKIDDYGRTNVAG
    IYAIGDVAGPPMLAHKAEHEGVICVESIAGKHPHAMDKLMIPGCTYCNPQIASVGLTEAKAKEAGFELKIGRFPFIGNGK
    AIALGEPDGLVKTIFDAKTGKLLGAHLVGAEVTELIQGFVIAMNCETTEEELINTVFPHPTLSETMHESVLDAYGRVIHT


    >gi|217976832|ref|YP_002360979.1| methionine-R-sulfoxide reductase [Methylocella silvestris BL2]
    MFTRRTVGAGGIAGVVLALWRGAARAEATRQFPVAFSDAEWRKRLTPEQYDVLRRSGTERPFSSALNDEHRRGVFACAGC
    QAQLFSSAAKFDSGTGWPSFWEPLAGSVGVEADRTFGMTRSAVHCNQCGGHLGHVFNDGPKPTGLRY
    CMNGAAMRFDPIA
    S

    >gi|217976833|ref|YP_002360980.1| peptide methionine sulfoxide reductase [Methylocella silvestris BL2]
    MARPHEIAFPAGKRARRYLAPLLPAAAIIGLVSLGAAPSFAMEGKQLPAPAIDEPASQGATDTAVLAGGCFWGVQGVFEH
    VKGVTSAVSGYAGGGMAQAHYADVSTGATGHAESVRITFDPGKISYGRILQIFFSVAHDPTQHNRQGPDEGTQYRSAIFP
    ISAEQAKIAKAYIAQLNSARVLEAPVATTIEPSRLFFPAEPYHQDFLARNPTYGYIVVNDLPKIENLKRLFPNEYRADPV
    LAPAER

    >gi|217976864|ref|YP_002361011.1| Rhodanese domain protein [Methylocella silvestris BL2]
    MALTLDKVENISLEELKQGLADGSILLVDVREPNEFAAGHIPGSTLNPLQSFDPSRLPRAEGKRVVLSCRSGKRSLTALD
    LARRAGRDDVGAHYPGGFQEWAQRGEKVEF

    >gi|217976916|ref|YP_002361063.1| DSBA oxidoreductase [Methylocella silvestris BL2]
    MFQRSLALFGRAAVILIGLAAVSLSPLRADEFSAPQKAEIESIIKSYLVNNPEILRDVAAALEAKEKLEESKAREQVLAD
    KDNPLHNDASQAVIGNPQGAITLVEFFDYN
    CGYCKRALGDLARLMKDNPDLRVVLRDLPILRQESVDAAKVANAASIQLK
    GPKFWEFHQKLLATRATVGKGEAIGAAKDAGADLDKLARDAASPEVTASIEQSIELAKKLNITGTPSYVIGDEVVVGAVG
    YPDLQSKIAAVRKCGKAVCS

    >gi|217977044|ref|YP_002361191.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylocella silvestris BL2]
    MNTRTKLREALANICAAEMTLGQRLAAYAAAMREFKSPFSDEYDRIVERLRTGEAGAGAPQLGELMPSFVLPAADGRLVS
    LDQLLARGPLVVSFNRGHW
    CPFCKIELRSLAAAEGDIVGCGAQIVSIMPDRQPFVAPLAAELAGKVLILTDMDNSYALSL
    GLAMWIGAPVQKLCLDYGLPLQDFQGNNAWFLPLPATFVVAPDGRVAARFVNPEFRARMAIEDIMAALQSQRA

    >gi|217977053|ref|YP_002361200.1| Redoxin domain protein [Methylocella silvestris BL2]
    MTLLIAAYLAGVLTILSPCILPVLPFVFARAGQPFLRSALPMLFGMAAAFTGLATLAAAGGGWAVATNQYARFAALALFV
    LFALTLFSERLAEWLSRPLVALGARLSSSRFSADSAAPYASLLLGVATGFLWAPCAGPVLGLILTGAALNGASIGTSFLL
    FAYACGAATSLALALFAGAKVGASLKRTLAAGASLRRGLGVAVLAAVGLIATGLDVELLSQIDFANTTSVEEKLLNRARA
    HDVLAPRPAPTADPAALGENDFDHKSWLSPALGAEARLTNVAFLQPAPAAADLGVTKVAAHAAAALPVEGSLPGFAGAVE
    WLNSQPLTPQALRGKVVLVNFWTFN
    CINCLHALPHVRAWAQKYRDHGLVVIGVHTPELSFEKDPANVRKAVARLGIDYPV
    AIDTAYAVWKAFGNEYWPAAYFADAEGRIRHHHFGEEDYENSERVIQQLLEEAGNRNVPGGLVTASGSR

    >gi|217977055|ref|YP_002361202.1| methionine sulfoxide reductase A [Methylocella silvestris BL2]
    MTTQTERAVLAGGCFWGMQDLIRRYPGVISTRVGYTGGDVPNATYRNHGTHAEAIEIIFDPEKISYRTLLEFFFQIHDPT
    TRNRQGNDVGLSYRSAIYYTSEEQKRVAADAIADVDASGLWPGRVVTEVAPAGDFWEAEPEHQDYLERYPAGYTCHFIRP
    GWKLPVRAEAHKQSGAA

    >gi|217977117|ref|YP_002361264.1| OsmC family protein [Methylocella silvestris BL2]
    MPVDVKYTAEATATGGRDGHAGTPDGKIDLKLSTVKELGGGGGPGTNPEQLFAAGYAACFIGALKVAAIQDKVSVPADTS
    VTAHVGIGPRSEGGFGITADLTISLPGLDPAKAEALIAKAHQS
    CPYSNATRGNLDVGLTLA

    >gi|217977130|ref|YP_002361277.1| Thioredoxin domain protein [Methylocella silvestris BL2]
    MYRRTVLAALTGALALFSVAAGHAAESAEFTQGAFEAAQKAGRPILIEITAPWCPTCRAQKPILSELTAAPKFEDLAVFD
    VDFDSRKDVLRLFHAQSQSTLIAFRGPDEVGRSVGDTAPASIAALLNKTLSSATP

    >gi|217977155|ref|YP_002361302.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylocella silvestris BL2]
    MARIGETLPEFSVTGVKPGFEKHEENGESAFEEITQASFPGKWKIIFFYPKDFTFVCPTEIAEFARLNEEFSERDAVVLG
    GSTDNEFVKLAWRRDHKDLAKLPIWQFADTNGSLTDGLDVRSPAGVAYRYTFIVDPDNVIQHIYATNLNVGRAPKDTLRV
    LDALQTDELCPCNREVGGDVLKAA

    >gi|217977370|ref|YP_002361517.1| glutaredoxin-like protein [Methylocella silvestris BL2]
    MAIKDVIQSTVDSNDVVLFMKGTPNFPQCGFSGQVVQILSYLDVPYTPVNCLETDEIRQGIKEFSSWPTIPQLYVKGEFI
    GGCDIVREMFQSGELASHLAGKGIPVKQPAKA

    >gi|217977371|ref|YP_002361518.1| Redoxin domain protein [Methylocella silvestris BL2]
    MAREDFSLVGDPRLGRGGARRRLIIAFLLVGAAVLAFVYAMNARGGKEAAADVACPGSRQIAKTLAPLAHGEVAAFAVST
    QPGPLPELVFNGPDGAPTALASFRGQTVLLNFWATW
    CVPCRKEMPALDRLQAKAGSDGFKVVAVNIDTAKLDRPKAFLKE
    AEIKNLDFFADETAGVFQTLKGVGKALGLPTTILVDRNGCDLGVMAGPAEWDSPDALALIAAARK

    >gi|217977441|ref|YP_002361588.1| Redoxin domain protein [Methylocella silvestris BL2]
    MTIKVGDRLPNASFAVMTPEGPAVRSTDDIFKGRRVVLIGVPGAFTPTCSNVHLPGFVNRLDDFKQKRIDAIAVTAVNDV
    FVMNAWAASSDAGAHMSFLADGNGDFAKALGLTLDLTERGLGVRSQRYSMVVDDGVVQQLNVEASASRADVSGAEAILHQ
    L

    >gi|217977487|ref|YP_002361634.1| transcriptional regulator, AraC family [Methylocella silvestris BL2]
    MNAPETPLQDSGDPIEARFEAIARRDADAGFVYAVRTTGVYCRPDCAARPARRENVSFFATGAEAERAGFRACKRCRPDQ
    PGQAERDAILIARACRTIDEAETAPALKSLAVAAGLSPSYFHRLFKAATGVTPRAYASAKRAERLAAGLGAAVRITDAIY
    DAGFNSASRFYESSNARLGMTPKDYRDGGAGVEMRFAIGECSLGFVLVAATDKGVCAILIGDDRDALTLNLHDRFRRARL
    IGADADFGARLAQIIALVETPQRNFDLPLDIIGTAFQQQVWQALRAIPLGATASYADVAKAIGRPQSARAVAGACAANPI
    AVAIP
    CHRVVHSDGSMSGYRWGVDRKRALLDREKKKP

    >gi|217977523|ref|YP_002361670.1| alkylhydroperoxidase like protein, AhpD family [Methylocella silvestris BL2]
    MLNWAAYREQLMGTLSTIGEISPGILKGNQILSDAAPAGAGLGAKTRELIALAVAVTTRCDGCIAFHSDLARKAGATKEE
    VVEALGVAIALNEGAALIYSARAMDAFQSA

    >gi|217977591|ref|YP_002361738.1| thioredoxin [Methylocella silvestris BL2]
    MSSTVKVTDANFKSDVVGAGGPVVVDFWAEWCGPCKMIGPALEEIAAELEGKVTIAKLNVDENPGVAGAYGIRSIPTLML
    FKDGKMTSTKVGAAPKGELKRWISEAI

    >gi|217977737|ref|YP_002361884.1| heavy metal translocating P-type ATPase [Methylocella silvestris BL2]
    MSAHPDEISSPPVSVPIKGMHCASCVGRVEKAIATVPGVADVSVNLATEKASVSFLGPVDLDAVIAAINKAGYSAVLASA
    EFSIAQMT
    CDHCVKTVEEAFRGVTGVVDATVNLATGAGVVRYVSSITDPHSIAKAATEAGYPTREIKTGAAPPPSHAAHH
    HGDAETLARDARLALILTLPVFLLEMGAHFIPGLHGFLMDTIGMQPIRIAEFVLTAIVLFGPGRQFFTTGVPALLRGAPE
    MNSLVALGAGAAFLYSTLATFAPQLFPEGTAQVYFESAGVIVTLILFGRMLEARAKGRAGAAIERLVGLQPQSAAVLKGG
    EAVDTPLDQIVVGDVVLVRPGEKIAVDGVVVEGSSFVDESMLTGEARPVQKAAGSDVVGATINTTGSFSFKVTKIGADTA
    LSHIIRLVEQAQGAKLPIQALADKITARFVPVVMGIAAATFLLWLLLGPAPSLSHALVAMVSVLIIACPCAMGLATPMSV
    MVGAGRGAELGVLFRKGDALQRLSEPRTAALDKTGTITKGAPELTDLAPAPGFASDELLAAVAAVEARSEHPVAAAIVAA
    ARAKGLAIKPAEQFLAKTGYGVEAIVEGRKISIGAERFMTELGVDVSVFAQEAARFAAEAKSPLYAAIDGRLAGLICVAD
    PLAEGAASAVAALRGLGFRLVMVTGDNRKTAAAIANAVGIDRVIAEVLPEGKVAEVRRLQTENGRVIFVGDGVNDAPALA
    AADIGLAIGKGTDVAIEAADAVLIGGDLRAVAAAVALSRATMRNIKENLFWAFAYNVVLIPVAAGALYPFFGIMLSPMLA
    AGAMAFSSIFVVLNALRLRGFMPPAGYGAEAVGAPRSIAPAAAPAAEADLAGARLR

    >gi|217977767|ref|YP_002361914.1| DSBA oxidoreductase [Methylocella silvestris BL2]
    MTTLTKAPANPSRRFLFRFAGAALALAAAFVVPAAFGAAPALAQGATVPPDQLMAPGALPDLPLGSADAPITIVEYASMT
    CSHCAAFHTTTFPVLKSKYIDTGKVRFILREFPLDPLATAGFMLARCAGDDKRNAIVDLLFAQQKNWAFTEKPVEALSSL
    LKQAGIGQEGFEACLKNQELYNNVNKVRDNASAKFNVTATPTFFINGKKESGEISPETLDKLLEPLLKG

    >gi|217977782|ref|YP_002361929.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylocella silvestris BL2]
    MTRAAGGKCEPGMAAPEFKLPGDRGEPISLQSFKGRKLVLYFYPKDDTSGCTKEAIDFNQLKPEFEKAGAAILGVSPDTV
    ASHVKFKTKHQLGLDLASDESKAMLGAYGVWVEKSMYGRKYMGVERTTLLIDRQGVIAQIWSKVKVPGHAEAVLAAAKAL
    P

    >gi|217977925|ref|YP_002362072.1| nitrogenase-associated protein [Methylocella silvestris BL2]
    MTNVIFYEKPGCANNTKQKRLLEDAGHSLSVRNLLTEPWTSERLLGFFGDKPVAEWFNKAAPRVKSGEVNPQGLDAGAAI
    ALMLAEPLLIRRPLMEADGARSVGFDPAHVDAWIGLGPKTADADLETCRREAAKAKAPALD

    >gi|217978025|ref|YP_002362172.1| thioredoxin [Methylocella silvestris BL2]
    MAGLYGLSANEAKPDQAAAASVVKDTTTASFGADVIAESARQPVLVDFWAPWCGPCKQLTPILEKVVQAAAGKVKLVKMN
    IDEHPEIAGRLGVRSIPAVIAFQRSQPVDGFMGALPESDVRGFVERLVGPIGGTADLLAEAEALVADGDPAAAAELFAEI
    LAENPADFDALAGFVRLHVEAGDLELARELLDAAPAGAEKHAGVAAARAALELAEQAGALGDLADLKRKVDADPQDYQAA
    FDYAVGLNAHNRREEAAAALLDIIRRDRAWSEDGARKQLLQFFEAWGPADPATIGARKKLSTLLFS

    >gi|217978062|ref|YP_002362209.1| methionine-R-sulfoxide reductase [Methylocella silvestris BL2]
    MPPETKTYPVTHSEAEWRALLTPTQYHIMREHGTEAPGSCALNFEKRAGVFVCAGCEQPLFASTLKFESGTGWPSFNDPL
    AGAVETSEDRSYGMRRTEVHCSQCGSHLGHVFPDGPPPTGLRY
    CINGVAMNFTPE

    >gi|217978358|ref|YP_002362505.1| iron-sulfur cluster assembly accessory protein [Methylocella silvestris BL2]
    MANSKFSVLSLTEAAAARARDLIAGAGKPVAGIKVGIKNGGCAGMTYTLDLADEVTPGDEIVEDQGVNILIAPKDLMFLL
    GTKLDFETDKFAASFTFKNPNQTSACGCGESVSITPAHG

    >gi|217978597|ref|YP_002362744.1| glutathione peroxidase [Methylocella silvestris BL2]
    MNAYDYSLRTIDGDALPLETFKGKAVLLVNTASACGLTPQYEALEELYRKYQDRGLVVLGVPSNDFGGQEPGTEADIKQF
    CALKFNIEFPLASKEKVAGAAAHPLYRAIASELGEAAAPKWNFHKYLIGRDGALKASFGSRTVPDAPEIVAAIEAALA

    >gi|217978646|ref|YP_002362793.1| dihydrolipoamide dehydrogenase [Methylocella silvestris BL2]
    MSYDLIVIGTGPGGYVCAIRAAQLGQKVAVVEKRKTKTFGGTCLNIGCIPSKALLYASEKFEEAAHHLAALGVVVDKPTL
    DLKAMLKHKDDTVAANVNGIAFLFKKHKIESFFGVGAIKSVAEGAIAVEVTAEDGGQQTLTAKNVVIATGSDVAPLPGVE
    IDEETIVSSTGALSLKQPPKDLLVVGAGVIGLELGSVWGRLGSNVTVVEFLDRILPGIDAEVAKQFQRILQKQGFTFQLG
    HKVTKVEKGERLKITIEPAAGGDSLTLEADVVLVAIGRRPVTEGLGLDKVGVALERGRIIIDERFATNVPGVYAIGDVVR
    GPMLAHKAEDEGIAAAEIIAGQHGHVNYEVIPSVVYTSPEIAAVGATEEDLNAKGIAYKVGKFNFTANGRARAMRQTDGF
    VKFLADATTDRVLGVHIVGAGAGELIAEACVLMEFGGSSEDLARTCHAHPTLSEAVREAALAVEKRQIHS

    >gi|217978705|ref|YP_002362852.1| alkylhydroperoxidase like protein, AhpD family [Methylocella silvestris BL2]
    MSRIPTPATIDDAPAASRPLLEAVKKQLGVAPNLFRLIATSPAALEAYLGLSGALSKGALPAPTRERIALAIAEFNGCDY
    CLSAHSYLGRNLAKLDEAEVAANRAGRSNDPKADAAVRFALKVAQARGHIDEDAFLAVKNAGYDDAQIIEIIFHVAANVL
    TNYLNEALTTDIDFPVVRAQAA

    >gi|217978710|ref|YP_002362857.1| alkylhydroperoxidase like protein, AhpD family [Methylocella silvestris BL2]
    MSLSAENYRALTRGVSKNLATLRADLPAVMKGFSDLARSATEDGALDKKTKELIALALGVASRCDACIGFHAQTLVKLGA
    TKAEIEEMLGMAIYMGGGPSLMYAANALAAFEEFSLAA

    >gi|217978724|ref|YP_002362871.1| protein of unknown function DUF255 [Methylocella silvestris BL2]
    MSAQVMSANELGQAASPYLLQHANNPVHWRMWSEAALAEASAQGKPILLSVGYAACHWCHVMAHESFEDEATAAVMNELF
    VNIKVDREERPDIDHIYMQALHAFGERGGWPLTMFLTPKGEPFWGGTYFPKTEQYGRPAFVTVLRTVAHAFHEEPHRIAA
    NVGAVRRNLTKAPTASGGDFSLAQMDDIAAQLVTAIDTVDGGLKGAPKFPNTPILEMLWRAGARTGTAAYRQAMRLALEK
    MSEGGIYDHLGGGYARYSTDDRWLVPHFEKMLYDNAQILECLALCYDAFKDDLFLQRARETVAWLEREMTNPGGAFSASL
    DADSEGIEGKFYVWTFDELVEPLGADEARFFGKFYNAARIGNWVDAHYPNGVTILNRLESARPTAEEEARLAPLRQRLFD
    RREARVHPGLDDKIMADWNGLMIAALVNAATLTGEHRWIALAARAYNFIVATMLYRDEAGLTRLAHSFRAGVLVKPGLAL
    DYSTMMRAALALYEVRNLKEFAATRDYLSDARAFAQTLEACHIDPDSRLITMAAKDAADVIVKLAPTADDAIPNAHPVYL
    GALIRLAGVSGDQGALDRADALIKAMGPSIRGNIVGHAGTLNAIDLRLRVREIVTAGPARAPLYEAALGAPFIDRIVMDL
    DRPDEIPAAHPARAQAELAGEAAAFVCAGGACSLPARDVDALRQLLGDSGA

    >gi|217978784|ref|YP_002362931.1| beta-lactamase domain protein [Methylocella silvestris BL2]
    MIFRQLFDHVSGTYTYLLASRPGGEALIIDPVLEKVDRYLQLFDELDVKLVKAVDTHLHADHVTGLGALRDRTHCITVMG
    EQTKADVVSMRVADGDRIDIEGLSLEALFTPGHTDDSYSFLLEGRVFTGDTLLIRGTGRTDFQNGDPRAQYHSIFDRLLK
    LPDETLVYPAHDYKGDTVSTIGEERLFNPRLKVRSVDEYVDLMNNLNLPNPKMMDVAVPANMRVGFHQDEIARKGWAAQA
    AEALALFGRPDIAIVDLREKREREKQGIIPGSLHAPYPDLRESIGPGGALHELAAAGKTILFY
    CAFGERSAMAVQAAQDA
    GFKSARHIAGGFDAWKKENGAVAP

    >gi|217978785|ref|YP_002362932.1| Peroxidase [Methylocella silvestris BL2]
    MTLAINDIAPDFEAETTEGKISFHDWIGDSWAVLFSHPKDFTPVCTTELGYMAKIKPEFDKRGVKIIGLSVDPLDRHSGW
    ASDIQETQGVAPNFPMIADVDYNVSKLYGMLPAPVSGDPTKRTAADNQTVRNVFVVGPDKKIKLILIYPMTTGRNFDEVL
    RVIDSLQLTAKHKVATPVNWKHGEDVIIAGSVTDEEAKKTYPDGWNAPKPYLRIVPQPKA

    >gi|217978945|ref|YP_002363092.1| thioredoxin reductase [Methylocella silvestris BL2]
    MSASPAARSSHAKVIIVGSGPAGYTAAIYAARAMLEPVVIAGFEAGGQLMITTDVENYPGFASPVQGPWLMEQMRAQAEN
    VGARMISDHIVKVELDRRPFRLFGDSGEAYVCDSLIIATGAKAKWLGLPSEQAFKGYGVSA
    CATCDGFFYRGKDVIVVGG
    GNSAVEEALYLSHLAARVTVVHRGSAFRAERILQERLFKRPNVEIIWDHVVDEIHGSDNPPGVTHVTLKNAVTGALQPIE
    AHGVFVAIGHKPASELFAGQLDIKPNGYIQTAPNSTATNIPGVFAAGDVTDDIYRQAVTAAGMGCMAALEAERWLAAEEH
    RRIAAE

    >gi|217978969|ref|YP_002363116.1| OsmC family protein [Methylocella silvestris BL2]
    MTDSATTVSGLQPVDKAGLDSLIEKGKANPEAVRTLKARTVAAGKFRQLNYIRNLPEHVVDEPPGLLGDDTAPNPSEAAL
    AALGS
    CLSVGILANALAQGVTIRSLEIDLEGDINISAVWGAGATPDSVGFSAVRAAVKLDADAPQETLDALVAHATVWSP
    VANTFTRAVPLEVKRAG

    >gi|217979008|ref|YP_002363155.1| mercuric reductase [Methylocella silvestris BL2]
    MSARFDAIVIGAGQAGPPLAERMTKAGMKVAVIERSRFGGTCVNTGCMPTKALVASAYAAHLAGRGADFGFAAGEVRVDM
    KAVAARAGAISARASAGVESWLRRMDNCVVYQGSARFESPGKVRVGADLLEADRIFINVGARAATPHMPGIDQISYLTNS
    SMVRLDVLPSHLAIIGGSYIGLEFAQIYRRFGAKVTVVEMAPRLVSREDSDVSAAIKSMLESEGVDFRVDAECIRFARRG
    EDILVGVNCLAGEPEIACSHVLLAIGRRPNTDDLGLDATGVAMDARGHIIVDDQLRASVPGVWALGECNGRGAFTHTAYN
    DFEIVAANLLDHDPRRVSERIEAYALYVDPPYAKIGMSVAAAKASGRRVLVGERPMTRVGRAVEKGETTGFMRILVDADS
    REILGAAIFGTGGDEAIHCVLDLMYAKAPYSTLQRAVHIHPTVSELLPTLLGELKPLA

    >gi|217979252|ref|YP_002363399.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylocella silvestris BL2]
    MKRILAWALVLTGLFATPVFAALKAGDSAPGFTAKAAVGGKDFTFSLFEALGKGPVVLYFYPKSFTRGCTIEAHDFAEAA
    ESFAEAGATLIGMSKDTIETQRKFSTEECRDKFPVAADPDLAVIRSYDAVRTAPTASGETVSDRISYVIDPDGKIIYAYS
    DSAPEKHIENTLAVVRKWREQHAQ

    >gi|217979305|ref|YP_002363452.1| thioredoxin domain protein [Methylocella silvestris BL2]
    MMIARRPLLACVLATAGAFYVGAALPGTARAGEPPTPFDAEAFEAAQKTDKPILVEITAPWCPVCAAQKPILERLRALPR
    FSELQIFTIDFDTQKELMRRFHATLQSTLIGYKGRQEVGRSTGEAQAEWIETLLDKTL

    >gi|217979306|ref|YP_002363453.1| rhodanese [Methylocella silvestris BL2]
    MPRPISATETAARSVAAIALGLLLIGAAGSPGHVPEPDGLWQGVMRGYTPNSVKGARVLDTAALVRLIEEKNPVLLDVGP
    ADKKPASISPATPWMPAHRSIPGAVWMPGGGSGTPNPQFSESFRSRVTSLTGGDIERPIVTFCHPE
    CWGSWNAAKRLVGY
    GYSNVYWYPEGLEGWQAEREPVTVAPDPAWALAAPADQPK

    >gi|217979321|ref|YP_002363468.1| OsmC family protein [Methylocella silvestris BL2]
    MKRTASAAWQGGFKDGQGSITTQSGALKAYPYGVASRFEDQPGTNPEELLGAAHAGCFTMALSLILGEAGLTADQMDTHA
    EVTLEKQGEGFAITKSHLTLRAKIPGVDAAKFAELANKAKQG
    CPVSKVLNAEITLDAALV

    >gi|217979342|ref|YP_002363489.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylocella silvestris BL2]
    MATNETTKGDGGRLDFNHGVDIEALRDGQLIEGEYSGKTILVLRRGEDIRVFRGTCTHLGAPLSEGLLSGDRLRCPWHQA
    CFDIKTGEATAAPAFAALKRFDVRREGEMIHLEAPQPAAPVQENASGVFVIIGGGAAGFAAADMLCRHSAGRGVTLVSED
    QSPPYERTLLTKDFLDGSWDDPRINLGAEPLDRRGVTLQLGAKVARVDRDRHVVRLDDGRELSYQKLLLAPGAAPRWPDF
    PGARLPQTHVLRTLAD
    CQAIVAAAKEARRVVILGSSFIGLEAAASLRARGLEVDVVSQDTAPMQRVFGPEISTAMVATHR
    KNGVRLHLGRQIKNFDGAAATLDDGANLPADFLLIGIGVTPRLDLAEEAGLTVEKGVVVDQFLTTSDPDIFAAGDVAAWP
    DPHSGQRLRVEHWNVAVRQGQVAAQNMLGGEIPYRDVPFFWTRQFDFSPLYLGHATEWDEIKIDGDIERRDCAVRYIRAG
    RVMASVMIGRERECLEERERMERALAGS

    >gi|217979416|ref|YP_002363563.1| peptide methionine sulfoxide reductase [Methylocella silvestris BL2]
    MFRKLLTLPSAADALPGRSEPTKTAERHFVNGRPISPPFPEGVETALFGFGCFWGAERKFWQLDEGIYTTAVGYAGGVTP
    NPTYEEVCSGLTGHNEVVLVAFDPKRISYATLLKSFWESHDPTQGMRQGNDVGTQYRSGVYVADATQRATAEASRDAFSR
    ALARKGYGPITTEIIDRPAFYYAEGYHQQYLAKNPNGYCGVCGTGVSCPIGISVAA

    >gi|217979451|ref|YP_002363598.1| selenide, water dikinase [Methylocella silvestris BL2]
    MLDAPVRLTDLAHGGGCGCKLAPSVLQQLLANQPQAAPYAQLLVGTETGDDAAVWQIDEERCVIATTDFFMPMVDDPRDF
    GRIAAANALSDIYAMGGTPIMALAILGMPLGKLPIETVRAILAGGASICAEASIPVAGGHSIDSPEPIYGLAVVGLCAVS
    DIRRNSGARPGDALILTKGIGVGVYSAAFKKQALSNAAYEEMMASTTLLNRVGHKLAKDDDVHAMTDVTGFGLLGHGVEL
    ARGGGVALDIDFARIPFLKEAQELAEAGLITGASGRNWASYGDAVVLPAETPDWRRALLTDPQTSGGLLIACAPERAEAI
    RGTIEAAGFPRATIIGAVAAGEPAVRIG

    >gi|217979607|ref|YP_002363754.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Methylocella silvestris BL2]
    MTSTDHPAVAPRKRRSWLVFLPLLLFAALAGLFLLRLFAGDASRLPSALVGRQVPAFALPGVEGLPRADGFTDADLRQGH
    VTVLNVFASW
    CVPCREEHPVLTRIADNAALKDQGVRLVGLAYKDAPDNVRTFLGKLGNPYATIGADEKGRAAIDLGVYGV
    PETFVIKGDGTVAYRFVGPLSDEDVAKTLLPEIEKAGR

    >gi|217979654|ref|YP_002363801.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylocella silvestris BL2]
    MSETIKTDVLIVGAGPAGLFAVFELGLLDIKCHLVDILPKAGGQCSELYPEKPIYDIPGYPIVTGQGLVDHLLQQIEPFH
    PTFHYGEMVEAIEPLGTAEAPLFKVSATGGKIFECKSIIVAAGGGSFQPKKPPIEGIEAYEGNSVFYAVRKMEDFRGRHV
    VIVGGGDSALDWTLNLQPIVERLTLIHRRDDFRGAPHSVKAMRELVANGLIDLHIGQVASLAGEGGQLRGLTLKGADGAL
    RDIACERLIPFFGLTMKLGPVAEWGLNLHENLVPVDTEKFETNVPGVFAIGDINTYPGKLKLILCGFHEGALAAQKIHRY
    VYPDKKLTFQYTTSSTNLQKKLGVH

    >gi|217979722|ref|YP_002363869.1| iron-sulfur cluster assembly accessory protein [Methylocella silvestris BL2]
    MIQLTDGAVDAVRQAIEGAGAQVEGLRIMVEAGGCAGLKYMMGLVSDINPNDILVERDGVKVYVDEASLPHLYGTTVDFV
    SGLEGAGFTFNNPTATNSCSCGKSFS

    >gi|217979744|ref|YP_002363891.1| HesB/YadR/YfhF-family protein [Methylocella silvestris BL2]
    MNITLTPAAHKFVRRLVMFDGGPGSGLRLQVTPGGCSGLSAEFSVQPAPAANEQVFTQDGVSLFLGAEARLLLDGVTINF
    VDTPAKTGFDFIDPKKASCGCSSTAPAALEEPALSSAK

    >gi|217979780|ref|YP_002363927.1| Glutathione S-transferase domain protein [Methylocella silvestris BL2]
    MITLYHHPLCAHSRFVRLLLGEYGIEPRLIEEDSFERRRDFLILDPAGQTPVLIEHPSVVVPGAATIAEYFDETRGVSLG
    KHRLLPEDPLSRVEVRRLSDWFGQKFFREVTDWLVTEKVYKRFRPRERGGGAPDMDLVRAARANIRTHLRYIEYLAGGRK
    WLAGERLSHADLAAAAQLSCVDFLGDVPWEDYETAKLWYSKVKSRPAFRSLLADRLPGMSPAPVYADLDF

    >gi|217979787|ref|YP_002363934.1| DSBA oxidoreductase [Methylocella silvestris BL2]
    MLNVSRRGLLAGAVMAVCIGAASAAPLSADDPDLSREALLSDPATPVGGDPNGDVTIVAFFDYNCPFCMKSEPALERLIA
    SDKNIRLVYKDWPIFGGVSVYAAKLALAANFQGKYAAAHHALMATSRRKSSEAEARQLVAAAGVDMARLDADFSGKAAQI
    DAILKRTEKQATGMGFAGTPVYLIGPFLVAAALDFDGFKKAVADARAKREP

    >gi|217979789|ref|YP_002363936.1| glutaredoxin 3 [Methylocella silvestris BL2]
    MAQITIYTTSTCPYCIRAKALLEKKKLEFTEISVDGDPKLRSELAERTGRSSVPQVFIGESHVGGCDDLYELHYDGKLEQ
    LIADHAQ

    >gi|217979971|ref|YP_002364118.1| glutamate synthase subunit beta [Methylocella silvestris BL2]
    MGKVTGFLEIDRRDRRYAPASDRIRHYKEFVIPLSEEATKDQAARCMNCGIPYCHTGCPVNNQIPDWNDLVFHSDWEEAS
    RNLHSTNNFPEFTGRVCPAPCEGSCTLNLNDQPVTIKTIECAIVDRAWANGWLPPEIATKKTGKKIAVVGSGPAGLA
    CAQ
    QLARVGHEVHVFEKNGKPGGLLRYGIPDFKMEKHIIDRRVDQMQAEGVEFHVNVNVGIDIEAATLVNDYDAVVLAGGAEK
    PRDLPVPGRDLSGVHFAMEFLPQQNRRVSREPVQSNEPILAAAKHVIVIGGGDTGSDCIGTSIRQGALSVTQLEIMPIPP
    EKENKLLTWPNWPLKLRTSSSQEEGAKREFSVLTKAIHGEDGVVKKIVCVHVDEKLKEIPGSEFDIRADLVLLAMGFVSP
    VQEGMLASLGVAFDPRGNVAADQTSYKTSLDKVFACGDMRRGQSLVVWAIREGRQAAQSVDTFLMGASVLPR

    >gi|217977412|ref|YP_002361559.1| protein of unknown function DUF1223 [Methylocella silvestris BL2]
    MELFTSQGCSFCPPADALLATLARKPDVVAVSFPVDYWDYIGWKDTMASPVFAARQRAYAAAIGDQHAYTPQMIVDGMLG
    AVGSDRKEIESAIALSRGREGAMSVPVRLTQANGALVVEVGDGEGGPAVVLALRVMRSRTVHIGRGENAGRNVTYTNVVR
    AMDEIGVWSGAAATFHAPDVREDGEGYVIFVQKGSPQRPGVILGAAKAPGF