Methylobacterium radiotolerans JCM 2831 uid58845

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170746494|ref|YP_001752754.1| glutaredoxin 3 [Methylobacterium radiotolerans JCM 2831]
    MQPVTIYTTAWCPYCSAAKSLLKEKGAAFQEIDVERVQGARTAMVERAGGRTSVPQIFIGATHVGGCDDLYALDRAGKLD
    PLLKDTADA

    >gi|170746497|ref|YP_001752757.1| disulphide bond formation protein DsbB [Methylobacterium radiotolerans JCM 2831]
    MNTAAALRLKTAGLWLAIASALTVGAALVLQYGYGYAPCKLCLTERLPYYAAVPLGLLALFLPERLARIALGLAALGLLY
    GAGIGVYHAGAEWGFWPGPAD
    CGGGTGANPGQIGDFLNSLQTTKVVDCSVAALRVLGVSLAGWSAVISAVLASFAGTAAL
    RP

    >gi|170746602|ref|YP_001752862.1| alkylhydroperoxidase [Methylobacterium radiotolerans JCM 2831]
    MATVKLWSDAEADADARVSAVFADIRATRGSDVVNNFWRGLANDPALLERTWSALKTVMGPGTLDPLTKELVYIAVSIAN
    GCPY
    CIHSHTAAARAKGLTEGQHGEFLAVVGMANQTNALVNGMQIPIDAAFRVEEGP

    >gi|170746997|ref|YP_001753257.1| thioredoxin reductase [Methylobacterium radiotolerans JCM 2831]
    MAHTHAKLVIIGSGPAGYTAAIYAARAMVEPLLISGFQPGGQLMITTDVENYPGFAEAIQGPWLMEQMRLQAEHVGTRIV
    SEYITKVDLKQRPFRLEADSGETYSCDALVIATGAQAKWLGIPSEAAFQGGGVSA
    CATCDGFFFRGKEVVVVGGGNTAVE
    EALYLANIASKVTVVHRRDSFRAERILQERLFKHPNVEVLWHREIAEICGVQKPAPNVTHVRLKDPRSGEISEVKADGVF
    VAIGHQPATAIFEGQLPMRHGGYLTVKPGTTETEIPGVFAAGDVTDDVYRQAITAAGMGCMAALEAEKFLANLDIGESPV
    QAAAAE

    >gi|170747041|ref|YP_001753301.1| DSBA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
    MPVSKPVSRRLLLAAAAALGAGLTGASAQSYGQRVAVTGDDGRAVANSILPGEITGQIPGLRGVTYVGPRDAGTTLYEFF
    DFN
    CPYCRKAAADVVALHDSDPELRIGLVHNPILSPQSAQAAKVMLAVQRKLGSEAAWRFYQTLLGKPGRIDGPGALTAA
    AALGIPQAEVEAIADSEEVRAALKSQMRMAADLGLYATPSYVLGNSGILGHPGAGAMAKMIASVRRCDRLAC

    >gi|170747150|ref|YP_001753410.1| DsbA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
    MTTRRDALKFSGLALGAGLALPYLGRPAQAQNSEMAALLQPGPLGDVWLGPADAKCTIIEYASMTCSHCAAFHRNTWPTL
    KERYIDTGKVRFTLREFPLDPLATAAFMLARCQGDSKYYPITDLLFDQQAAWAFTPKPVDALEQMLRQAGYNKQTFEACL
    KDQKIYSAVNAVKQRGLDVFKVDSTPTFFINGERYTGEMTVEGMEKVIKPIIGA

    >gi|170747268|ref|YP_001753528.1| thioredoxin [Methylobacterium radiotolerans JCM 2831]
    MLNDTLAAGGAPAGDTGSLIKDTTTASFRQDVIAESMHRPVLVDFWAPWCGPCKQLTPVLEKVVREAAGAVVLAKMNIDE
    HPSIAGQLGIQSIPAVIVFQKGQPVDGFMGAVPESQIKELIGRVAGPQQDPLEAALADAAALIQEGDLAGAAEIYAAVLE
    QQPDNVTALAGLAKMQLDAGEIENAKRVLAMVPEAKAGDPALVGIRAALELAEQAASLGDLAGLQREVEANPDAHQARFD
    LALGLAARGERGQAVDHLIELRKRDKDWNEDGARKQLLQFFEAWGVMDPDTIRGRRKLSALLFS

    >gi|170747284|ref|YP_001753544.1| glutathione peroxidase [Methylobacterium radiotolerans JCM 2831]
    MTTVHDFSVSAADGTPYPLAQHRGQVLLIVNTASRCGFTPQYEGLEALWRRHREAGLTVLGFPCNQFGAQEPGDAAEIAS
    FCALRYDVSFPVLAKIAVNGSGADPLYAHLTRACTGLFGTRAVKWNFTKFLVGRDGRVIARFAPGTKPAALEAKIQAALA
    A

    >gi|170747300|ref|YP_001753560.1| OsmC family protein [Methylobacterium radiotolerans JCM 2831]
    MDATALRALQAPIKDKYRTAPDAAVITLKARGTLDDTKIACKVETGRAIAEAGLHPATGGSGAELCSGDMLLEALVACAG
    VTLKAVATALEIPLRAGTVSAEGDLDFRGTLGVDKEAPVGFRSIRLFFELDTDAPEDKLAQLLKLTERYCVVFQTLNHKP
    ELSVAATTA

    >gi|170747359|ref|YP_001753619.1| dihydrolipoamide dehydrogenase [Methylobacterium radiotolerans JCM 2831]
    MSYDLVVIGTGPGGYVCAIRAAQLGLRTAVVEKRATHGGTCLNVGCIPSKALLHASEAFEEANTHFADLGIDVGTPKLDL
    KKMMAFKAEGVAGNTKGVEFLLKKNKVDTFHGTGRIAGAGRVEVIAEDGGNRMLETKSIVIATGSDVARLPGVTIDEKVV
    VSSTGALELDRVPKKLLVIGAGVIGLELGSVWRRLGSEVTVVEYLDRVLPGMDGEVGKQFQRILTKQGIAFKLSTKVTGV
    EVGKKGGATVTVEPAAGGAAETLQADVVLVCIGRTPYTEGLGLDTVGVQRDDKGRVLTDSHYATNVTGIYAIGDVIAGPM
    LAHKAEDEGVAIAEMLAGQSGHVNYGVIPNVVYTFPEVASVGKTEEELKKDGIAYNAGKFPFTANGRAKANGTTDGFVKV
    LADAQTDRVLGVHIVGADAGNLIAEVAVAMEFGASSEDIARTCHAHPTLTEAVKEAALAVNKRAIHV

    >gi|170747393|ref|YP_001753653.1| alkylhydroperoxidase [Methylobacterium radiotolerans JCM 2831]
    MMKDWNQYGAELVSTLGRIGAVSPDLLKAHDQLAAAAPTERKLDAKTRELIALAVAVTTRCDGCIAVHSDAARKAGASKE
    EVVEALGVAVALNAGAALVYTARAFEAFTGEAG

    >gi|170747426|ref|YP_001753686.1| dihydrolipoamide dehydrogenase [Methylobacterium radiotolerans JCM 2831]
    MSDTYDVLIIGAGPGGYVTAIRAAQLGFKTAVVDREHLGGICLNWGCIPTKALLRSAEIFHYFQHAGDYGLTAEKVGFDT
    AAIVKRSRGVSGRLNGGVGMLLKKNKVDVIWGEAAVDSVAQGNQPGQVTVKETKRAEPPKGAKGAGTYQAKHIIVATGAR
    PRAIPGIEPDKKLIWTYYEAMVPETMPKSLLVMGSGAIGIEFASFYRTMGAEVTVVELLPQILPVEDAEIAGLARKRFEK
    QGIKILTGAKVTKVEKGANSVTATVEGGDGKSQQITAEKLISAVGVVGNIENIGLEKLGVKIDRGIVVTDGLGRTNVPGL
    YAIGDVAGPPMLAHKAEHEGVICIETIKGLHTHPMDKAKIPGCTYCQPQIASVGLTEAKAKEQGFSVKVGRFPFAGNGKA
    IALGEPDGLIKTVFDAKTGQLLGAHMVGAEVTELIQGYVVAMNLESTEEELMHTVFPHPTLSEMMHESVLDAYGKVIHT

    >gi|170747429|ref|YP_001753689.1| iron-sulfur cluster assembly accessory protein [Methylobacterium radiotolerans JCM 2831]
    MSAGFKVLSLTDRAADRIKAIMAEADRPIAGLRVGVRNGGCAGMSYTMEYAEAAKPGEDVVEDRGVRVFVDPKAVLFLLG
    TEMDFTTNKLASQFVFNNPNQTSACGCGESVAITPVSADRLPAQA

    >gi|170747556|ref|YP_001753816.1| glutaredoxin-like protein [Methylobacterium radiotolerans JCM 2831]
    MTDVNTTIQNEIASQDVVVFMKGTPQMPQCGFSGQVVQILNYLGVPFKGVNVLADQEIREGIKAFSNWPTIPQIYVKGEF
    VGGCDITREMFQSGELQTFLSEKGVPVKTAAA

    >gi|170747695|ref|YP_001753955.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Methylobacterium radiotolerans JCM 2831]
    MDDHYDALVIGSGEGGKFLAWHLAKAGQRVAVVERRWIGGSCPNTNCLPSKNEIWSAEIAHLARHADRYGIETGPVAVDM
    ARVVERKRAMVRGLVDMHLDRYRDSGAELIMGTAAFTGPRALTVALNAGGSRALTAERIFLNLGTRPTIPDVPGLCDAEP
    LTNIEALELDAVPAHLVVLGGGYVGLELAQAYRRFGSAVTVIEHGAQIAGREDPDVASALAQLLEAEGLAIRTGTEVVRV
    RGRSGDAVEITVRDGGGEAVIAGSHILVAAGRAPNTGGIGLDRAGVDLTERGVIKVDDRLRTSAPGVWAIGECAGSPAFT
    HASADDFRVIRDDLAGIPRSTAGRLMPACLFTDPPLARVGSTETEARARGDAVRVAKLPMAAVLRTRTTGQTEGFMKAVI
    GPDDRILGFTMLGAEAGEVMAAVQVAMLAGLPYTALRDAILAHPTTAEGLNSLFSAVPAP

    >gi|170747799|ref|YP_001754059.1| arsenate reductase [Methylobacterium radiotolerans JCM 2831]
    MAEPFDVVIYHNPACGTSRNTLAMIRNAGIEPHVVEYVKTPPARALLVQLLARAGLSVRDVLREKGTPFAELKLGDPTLT
    EEQLLDAIEAHPILINRPLVVTPKGVRLCRPSEAVLDLLPVQRGDFVKEDGERVVDEHGRRIATA

    >gi|170748226|ref|YP_001754486.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacterium radiotolerans JCM 2831]
    MPLSEGDPAPDFDLPASGGGRVGLSALRGHKVVLYFYPKDDTSGCTLEAQDFNGLLPAFAEADAKVVGLSPDPVKSHDKF
    CGKYGLTFPLAADEDKTVLEAYGVWVEKSMYGRKYMGVERTTVLVDREGRVARIWPKVKVPGHAEAVLAAARALP

    >gi|170748291|ref|YP_001754551.1| peptide methionine sulfoxide reductase [Methylobacterium radiotolerans JCM 2831]
    MALRDTVRPLSRPLARPLLGAALGLGLAGAVLLPRLPAFAEEAPRRLPEAATRSAEPPGPRVAVFAGGCFWGVQGVFQHV
    RGVTSAVSGYAGGTRAEADYRTVSGGGTGHAEAVSVTYDPAAIRYDELLRIFFSVALDPTQVDRQGPDAGRQYRSALFPQ
    DADQARVARAYIAQLDGAKTYGRPVATRIEPGAAFYPAEGYHQDFMVLHPGHPYIAANDAPKLEALKHLFPERAAAQPVL
    VNRPPA

    >gi|170748310|ref|YP_001754570.1| redoxin domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MPSTHDALPDDLPVPVDDGAADHLRGMRLPDVALTATDGRTVSLARLPGRTVAYAYPRTGEPGQPGLTPDWDAIPGARGC
    TPQACDFRDHHGDLKARGVAQVFGLSTQTSAYQREAAERLRLPFPLLADPHRAFAMAARLPVFEAGGHVLLRRLTLVIDD
    GVVSQLFYPVFPPDRSARQVLDWLDAAGA

    >gi|170748381|ref|YP_001754641.1| rhodanese [Methylobacterium radiotolerans JCM 2831]
    MRRLLLTGRAAAACAALLCLAAAPADSPVNVPEPEGLYAGPPKGYTPPTLKGAAVVDADAVAALMAGPDKPVLLDVAAPD
    RKPSNFPEGRLWLPVHPSIPGAVWMPEAGAEPLAPAREALFYARVAALTGGDKAKPVVVFCHVE
    CWGSWNAAKRLVLKGY
    TGVRWFPQGVEGWQEQHETANLTVDPDWKAGAEPQAGR

    >gi|170748549|ref|YP_001754809.1| methionine-R-sulfoxide reductase [Methylobacterium radiotolerans JCM 2831]
    MADTPTTSPETRSDAEWRSALTPEQYRVLREHGTERAGTSCLLAEKRAGTFTCAGCGQPLFEQGTKFESGTGWPSFFEPI
    DGAVGTTVDRSHWMVRTEVHCARCQGHLGHVFDDGPAPTGLRY
    CMNGAAMNFEPAE

    >gi|170748702|ref|YP_001754962.1| OsmC family protein [Methylobacterium radiotolerans JCM 2831]
    MAAEPTIRITQVADYVFTVDFSAALPALRTDEAPPIGGGTGPFPEQLLISGVANCLCASLVFALGKFRQDARGVAAEASC
    RVERNAEGRLRVTGIGVHIQLGAAAADMPRIDRVLEQFERF
    CTVSESVKAGIPVAVSVADRDGTRLK

    >gi|170748756|ref|YP_001755016.1| thiol:disulfide interchange protein, putative [Methylobacterium radiotolerans JCM 2831]
    MIRRLAILILALAASLSAAAAQGFPQGFRTPADLVRASLVAEPAAVAGAQPFTLAVRMQIKPGWHVYWRNPGDSGLPPEV
    TWTLPAGFNAGAIRWPAPERIPIATLMNYGYEGEVTLLVPVTPPPSLDPADPVRIQAKLTYLVCETECVPGSADLALTLP
    VGKAEPDPASAALFARARAALPVPALWPLRLSSQGDTLRLDFAATGLKPEALRNAAYFPYAETAIDNAAAQVMTVDETGL
    HLTLARSSPTDPVPTALPGVLTVDEVDAAGTRRLAFAYGDEPVLPAAAAPAPTAPNPASTAPATSDFDALTLATAAAFAF
    LGGLILNLMPCVFPVLSIKVLSLVRHAGEGPARLRLHGLAYTAGVLASFLALAAALIGLKSGGAAIGWGFQLQSPAVVAG
    LAYLLFAMGLSLSGAVHVGGRLAGLGDGLTRRAGLSGSFFTGVLATLVATPCTAPFMGSAVGFALTQSAGVALAVFASLG
    LGLALPFLLLTLWPPALRALPRPGAWMETLKQVLAFPVYATVAWLIWVLAQQVDPRGQLAALIGLVLVGFAAWAWEHGRA
    AAPRTGRIAQAAAALALIAVASLAVTLPRSSAAPAAQAAADGVEPFTQARLDALLDAHRPVFVDMTAAW
    CITCAVNEATS
    LNTRAVRSAMAERGVTYMKGDWTNQNPEITRLLEKHGRSGVPLYLLYTGTGEPQVLPQILTEGTVLAALEAVPAAAGRSA
    ALAR

    >gi|170748853|ref|YP_001755113.1| rhodanese domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MRVVDLDRETVKRGLDDGSMLIIDVREPHEYAAGHIPGAVSHPLSSFDPRAVAALVAEDGRRAVFSCAAGVRSVHALMAA
    QNAGLDLAEHYKGGFKDWYSAGETVD

    >gi|170748952|ref|YP_001755212.1| glutaredoxin [Methylobacterium radiotolerans JCM 2831]
    MQATASRKAVLYRMVTPEHTCPYGLKAKDLLERQGFEVEDHLLTDRAQTDRFKAEHQVKSTPQTFINGERVGGFDDLQRQ
    FGKAANDPNATTYTPVIAVFSMTALMALAASYAVYGTPLTMRAAEWFIAFSMCVLALLKLQDVESFSSMFLGYDLLGRRW
    VRYAYAYPFLEGIAGVLMVAGALNWISIPVALFIGTVGAVSVFKAVYVDKRDIKCACVGGSSKVPLGFVSLTENVMMVAM
    AVWMLAVHH

    >gi|170748962|ref|YP_001755222.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Methylobacterium radiotolerans JCM 2831]
    MSWTHDVVVVGAGAAGLTAAGGLAQLGLRVALIEAGAMGGECLNTGCVPSKALLAIAARAQAVRDMGRFGIRAQEPQVDF
    SGVMAQVRGVIAEIAPHDAQERFEAWGAEVIRAHARFTAPRTLLVAGRTLRAPRIVLAVGSRPAVPSIPGLDAVPFLTNE
    TLFSIDAFPERLVVLGAGSVGMEMAQAFRRLGAEVAVIDRGPPLSRDEPEAAALVSERLEAEGIAFHRAAIRGVSSVGGG
    VAVALDDGDTVGGSHLLVALGRSANLHGLGLEEAGVGTDGGGIVVDDRLRTSARGVYAIGDCRDGPRLTHAAGYEGARIV
    AAIGFGLRARVDYRALPRVAYTSPELAQVGMTEAEAREGGGRVTAMREPFADNDRAVAEGASVGFLKVVRRNGRIVGACL
    VGERVGDLTMPWVLSIGGAKPTPWALSGMILPYPTRSEITKAAAFAMYAPRLFSRPARIWAGVLAALRRRLG

    >gi|170748963|ref|YP_001755223.1| methyltransferase type 11 [Methylobacterium radiotolerans JCM 2831]
    MSLENTQHYYGRVLQGSADLRTDACCTLEPPSPAVRSALARIHPDVSARYYGCGLVVPERVAGVRILDFGCGSGRDVYLL
    SQLVGVSGSVLGIDATAEQLAVARQHRDWHRDAFGYETSNVDFVEGDIARLDELDLEPASFDVIVSNCVINLVTDKAAVF
    SAAHRLLKEGGELYFSDVYADRRLPSAWKEDPVLHGE
    CLAGALYWGDFLTHARAAGFVDPRLVTDRPLNVGDAEVAAKVA
    GTRFFSATYRLFKLAALDMACEDYGQALRYRGTPASAEPFHLDKHHAFQPGRIVPV
    CGNTYRMVAETRFAPEFDLFGDFT
    RHFGIFAGCGTDLPFGGDASGPSSTACC

    >gi|170748971|ref|YP_001755231.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacterium radiotolerans JCM 2831]
    MTAPHSLFPRQPTPALQLPLAGGGEYILGHASVVAFTLLVFYRGMHCPICKSQLIELEKKLPEFQQRGVDVVAVSADSRE
    RAERAKTDWHLENLKLAYGLDLRVARAWGLYISTAKPGSDEPAYFTEPAIYLVRPDGTLYFGSVQTMPFARPHLPDILAA
    IDFVAEKNYPARGEVIELP

    >gi|170748973|ref|YP_001755233.1| thioredoxin domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MLNRRILLAAAALVGSLSLAGPASAFDKKPYDAKAFAATQAAGKPILVDVSAPWCPVCKAQKAVFDKLAANPKFKDLVVY
    EVDFDSRKDVLRDLNVKMQSTLISYKGAKEVARSSGETNADKIEDQLNKSL

    >gi|170749103|ref|YP_001755363.1| glutathione-disulfide reductase [Methylobacterium radiotolerans JCM 2831]
    MSAFDVDLFVIGGGSGGVRAARIAAGYGARVMLAEEYRVGGTCVIRGCVPKKLMVYAGRFADEFEDAAGFGWTVEKPRFD
    WGTLKTRRDAEVTRLEGIYDANLIRAGVEIVPERAVIEDPHTVRLVASGRTVRAERILVAVGAHPVKEPAVPGIDLAITS
    NEVFELESLPERILVIGGGYIAVEFAGVFAALGSRTTLLHRGDRLLRGFDDEIRDALAEAYGQRMDLRLGRTLRRVERRD
    GGLCAQLDDGSDILVDQVLVATGRRPNVEGLGLDRVGIATDAAGAIPVDAFSQTRVPSIYAVGDVTNRANLTPVAIREGH
    AFADTVYGGKPACVDHRLIPTAVFSTPEIGVVGHNEAAAREIYGKIDVYKARFRPMKATLSGREERILMKVLVDCASDRV
    VGVHIFGHDAGEVIQAVGIAVTMGATKADFDRTIAVHPTAAEELVTMRVPEVTKHPVGVG

    >gi|170749110|ref|YP_001755370.1| DSBA oxidoreductase [Methylobacterium radiotolerans JCM 2831]
    MPFIRPLPALVLALGLVAVPALAQTATPPAAPFTDAQRAGIEAIVKDYLIKHPEVLQEALAEAEKQQAETQRLAQAAALK
    ESREALINGPHDVVAGNPTGDVTLVEFFDYN
    CGYCRKALGDVQALIKSDPKLRVVIKDFPVLGPESLEASQVAVAVRQQL
    KGDKLFEFHQKLLETKGRVNGARAIQVAKDMGVDTAKLQKDMASPEVKAALSENRGLGDRLGLSGTPAFIIGDEVIPGAV
    GVEPMRKTIADVRQCGHASC

    >gi|170749177|ref|YP_001755437.1| iron-sulfur cluster assembly accessory protein [Methylobacterium radiotolerans JCM 2831]
    MAEITLTARAAKRINEIMVSEPAGSSLRISVNGGGCSGFSYAFDITRAREAQDVAIERDGATVIVDPVSLEYMSGSTIDF
    VNDLIGQSFKIENPLATASCGCGTSFSL

    >gi|170749241|ref|YP_001755501.1| putative selenoprotein [Methylobacterium radiotolerans JCM 2831]
    MRDGPAGAEPGSDVTAEGAAGPGRPRVAITYCTQCNWLLRAAWMAQELLSTFRDDLGEVALVPATGGTFRIELGAALLWE
    RVRDGGFPDVKALKQRVRDHLDPARDLGHIDRS

    >gi|170749257|ref|YP_001755517.1| OsmC family protein [Methylobacterium radiotolerans JCM 2831]
    MPVDVKYRTSATATGGRDGAARTADGNFEVKLSTPKELGGAGGPGANPEQLFASGYSACFLGAMKAVAPSLQLKVPADTS
    VTAEVGIGPRSEGGFGITADLTISLPGLDRADAQKLVDAAHQV
    CPYSNATRGNVNVGLKLA

    >gi|170749383|ref|YP_001755643.1| thioredoxin domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MKSRRHVLALVGLALAGSSLLGASARAGETQPFSDAAFEAAQRSGKPVLIAVSAPWCPICRTQKPILARLSAEPRFKDLQ
    IFDIDFDSQKDLLRRLNVRMQSTLIAYKGATEVGRSVGETQPEWIEGLVEKTL

    >gi|170749538|ref|YP_001755798.1| glutathione S-transferase domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MATLYHFPFCANSRFIRLVLAEMGMEPTLFEERPWERRDDFLLINPAGVTPVLLEQNGLVVPGAGVIAEYLDETRGLGLS
    GRRMLPEDTVERVEVRRLLDWFLVKFESEVTAYLVNEKISKRFMSANEGGGPPDMNAIRAARSNVRYHLKYIGYLIARRR
    WIAGDNLTYADLAAAAHLSCVDYLGDVPWDEDEMARNWYARVKSRPSFRALLADRVPGMAPAAHYADLDF

    >gi|170749562|ref|YP_001755822.1| UBA/THIF-type NAD/FAD binding protein [Methylobacterium radiotolerans JCM 2831]
    MALAPDEIERYARHLVLAEVGGPGQARIKAARILVVGAGGLGAPLIQYLAAAGIGTIGLVDDDTVSLSNLQRQVIHGTPD
    LGRPKVESAADAVARLNPHVTVVRHPFRIDAGNAVDLIAGYDLVADGSDNFATRYAVSDACFRAGRPLVTAALGRFDGTL
    TTIRAHETGADGTPNPTYRCLFPNPPPPGSVPA
    CAEAGVLGALAGVMGSLMAMEVIRAVAGFGEPLVGRLLMVDARAMRF
    ETLTYGWDPENPLSGSGASAA

    >gi|170749779|ref|YP_001756039.1| thioredoxin [Methylobacterium radiotolerans JCM 2831]
    MATVKVTDASFEQDVLKSAEPVVVDFWAEWCGPCRQIGPALEEIATDLQGKVKIAKVNVDENPQIAAQYGIRSIPTLLLF
    KNGERVDQKVGAAPKGDLSRWIGAQTA

    >gi|170749951|ref|YP_001756211.1| AraC family transcriptional regulator [Methylobacterium radiotolerans JCM 2831]
    MPLLNAYAKPHSAAAMSPVPATDPDDAARWAALAARDARADGTFVYAVRTTGVYCRPSCAARAARPENVSFHRTCAEAEA
    AGFRPCRRCRPDEPALAERRAEAVARACRSIETAETMPSLAALARAAGLSAYHFHRVFKDVTGVTPKAYAAAHRAAAVAR
    RLPGAASVTEALYEAGYGAASRFYAGGAPRLGMAPAAYRTGGAGLRIRFGIGACSLGAILVAATEAGVCAILLGDAPEPL
    LHDLQDRFPAAEIEGGDPAFEGWMAQVIGFVEAPGTGLDLPLDIRGTAFQQRVWAALREIPVGSTATYAEIARAIGLPTA
    TRAVAQACGANPVAVAIP
    CHRVVRSDGALSGYRWGVARKRALLDREAEA

    >gi|170749985|ref|YP_001756245.1| heavy metal translocating P-type ATPase [Methylobacterium radiotolerans JCM 2831]
    MSKSVALTLPVEGMSCASCVGRVERALAALPGARDVAVNLATHRASLVLDGATGPGDVATALANAGYPVPETQSLLAVEG
    MS
    CASCVGRVERALAAVPGVTGASVNLAAGRAAIRHPEGVVPMDALVAAVETAGYEARPVEAGHPADPSARQAEEGRALR
    RDLIVAALLSAPVVVLDMGGHLLPALHGGPVTALIQAVLATLVLAGPGRRFFLRGVPGLLRGHPDMNALVALGAGAAYLY
    SLVSTLAPDLLPAGAAHLYFEASVLIVTLILLGRTLEARAKGRTGQAIARLMDLTPKTARVVRDGAENEVPLDALRVGDV
    VRVRPGERVAADGAVVSGTSHVDESMVTGEPAPVRKGPGDPVVGGTLNGRGSLDLRVGAVGGATVVAQIAAMVERAQGGK
    LPIQALVDRVTGRFVPAVIGIAAVTFLAWLILAPAPALGPALVNAVAVLIIACPCAMGLATPTAIMVGTGRAAARGVLFR
    DGAALQGLRDVRVVALDKTGTLTEGRPRLTEIVPAAGVAEDAALALAAALETRSEHPLAGAVVAAARDRGLATPEPDSFE
    AVAGFGISGRVAGRAVALGAPRYLDRLGVALDPDLAARAASLAGAGRSPIHLVLDGRHAAILAVADPVKPGARAAVAALR
    ARGLAVAMVTGDDPVTAAGVARSLGIDAVAAGVLPGGKVEAVQRFRAAHGPVAFVGDGINDAPALAEADVGLAIGTGTDI
    AVESADVVLMSGDLEALVEALTLSRAVMANIRQNLFWAFAYNAALIPVAAGVLVPFGGPALSPVLAAGAMAFSSVFVLGN
    ALRLRRAGGRPAAAATPALAARPA

    >gi|170750122|ref|YP_001756382.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium radiotolerans JCM 2831]
    MRELDYDVAVIGAGTAGIAAHRAATAAGARSVLIERGPGGTTCARVGCMPSKLLIAAGAAAHAARTADLFGIRVPEVAVD
    GPAVLRRLRAERDRFVGSVLDGLDDLPEGERLDGTARFEDDRTLLVDDATRIRFRAAVIATGSSPIVPGPLRGLGAFVLT
    TDTLFEIPDLPASLAVLGAGAVGIEIAQAMARLGVAVTVIDAGDTVAGLTEPDLAGQAAAIFGAELDLHLGAELRKAVPE
    GDGVCLHWTDRAGRERTTRAARVLAAAGRSPNLEALRLEATGLCLEPEGLPAFDRRSLVCAGAPILIAGDVDGWRPVLHE
    ASRQGGIAGANAAALAAGRPVATPEPWTRLAMVFTHPQAAVIGAPYDPEDDRRIVGALDFSDQGRARVEGVNRGGMRIWA
    DRSGRLLGGEMLGPAVEHLAHLLTFAVADEKTAQAVHGRPVYHPTVEEGLTSIMSKMIQRS

    >gi|170750196|ref|YP_001756456.1| rhodanese domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MAQAPLVSPEWLHDRLAAPDIVVLDTSWYLPAAGRDPEAEFRAAHIPGARRFDLDAMSDTESSLPHMLPRPEVFAARMRA
    LGIGDGMQIVVYDGQGLFSAPRVWWMLKAFGVRDALVLDGGLPAWVAAGYPTEEGEPRPHERRHFTARLDHGAVADADDV
    ARALETGSAQVVDARSGTRFRGEEPEPRPGVRPGHMPGARNLHYAALQRDGRMKSPEELQAVFAENGVDPDRPIVTT
    CGS
    GVTAAIIALALETMGRPARGLYDGSWSEWGADPARAVATGS

    >gi|170750312|ref|YP_001756572.1| redoxin domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MIQVGDHLPQATFRVIGPEGPIARTTDDVFKGRRVVLIGVPGAFTPSCHRNHLPGFVTHRDEILGRGIDAIAVTSVNDVF
    VLDAWSKASGAEGLEFLADGNADFAKAIGLEMDGTGFGLGMRSKRYSMLVEDGVVRILNVEETPSKAEVSGAEALLKVL

    >gi|170750326|ref|YP_001756586.1| glutathione peroxidase [Methylobacterium radiotolerans JCM 2831]
    MTLLRREALILLGAGLAGGARAAEQPAGTARATDFAFETPEGAPMPLSAYAGKPVLVVNTATACGYAGQLAGLQTLWTRF
    GDRGLVVLGVPSPDFGNQEPLDGPAIAEAARKNHGVTFPLTAKTRVKMPGAHPFYRWAAAERPAETPRWNFHKYLIARDG
    TLAAAFATQVEPTDPRVISGIAATLDQA

    >gi|170750661|ref|YP_001756921.1| uncharacterized peroxidase-related enzyme [Methylobacterium radiotolerans JCM 2831]
    MSAEDAPIGRFPIPRLETLPDDIRARIEAVQEKSGFVPNVFLVLAHRPDEFRAFFAYHDALMDRPGNLTKAEREMIVVAT
    SAINQCQY
    CVIAHGAILRIRAKDPLIADQVAINYRKADITDRQKAMLDFAMLVSQSAHQVGEAAFAALRAHGFDDADAWD
    IAAIAAFFGLSNRLANVTSLRPNPEFYALGRG

    >gi|170750836|ref|YP_001757096.1| alkylhydroperoxidase [Methylobacterium radiotolerans JCM 2831]
    MPMIDWNTYRQQVTAGVGHFAKLSPDTVRGYGTLSTAGQKTGQLDAKTRELIAVAVAISLRCDGCITVHTDAARKLGATE
    AELAEALGVATSLGAGAAVVYATRALDAFAASAEA

    >gi|170750892|ref|YP_001757152.1| redoxin domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MPGRTPILAGAGVAALAVLGLALYGSGLLPGNTGGALQPCAAAKPALARVDAASKGEVAAMQALPQARPAPEIRFKGPDG
    AETGLADLKGRLLLVNLWATW
    CAPCKAEMPALDRLQAQLGGPDFQVVAINVDTRNLEKPPEWLKQAGIHDLAYYADPGGR
    VLPILQRDTQSPGLPTTMLVDAQGCTIGVMKGPAAWSSPDGLALIRAALGRTS

    >gi|170750901|ref|YP_001757161.1| peptide methionine sulfoxide reductase [Methylobacterium radiotolerans JCM 2831]
    MFLFRKRPAMPAPADALPGRPTPIPTAETHVVNGNPLKGPYPPGTGTIVLGLGCFWGAERRFWQLPEGVFVTAVGYAGGY
    TPNPTYEEVCTGRTGHNEVVLVAFDPAVLPLEAVVRTFFESHDPTQGMRQGNDVGTQYRSGIYTVGPDQDAAARSVRAAY
    AEALKARGFPDVTTEIRPLEQFYFAEAYHQQYLAKNPAGYCGLGGTGVSCPVGAGVAA

    >gi|170751275|ref|YP_001757535.1| hypothetical protein Mrad2831_4892 [Methylobacterium radiotolerans JCM 2831]
    MTALPFDNSYARLPERFYARRPPTPVAAPRLVRLNRPLAEELGLDPDWLAGPDGVAALAGNTVPDGADPIAAAYAGHQFG
    QFVPQLGDGRAVLLGEVVDRNGHRRDIQLKGAGPTPFSRRGDGRAALGPVLREYLVSEAMAALGIPTTRALAAVTTGERV
    VRETLLPGAVLTRVAASHIRVGTFQFFAARGDVEGLRALADHVIARHHPDAAGAANPYRALLEGVVAAQADLVARWLHVG
    FVHGVMNTDNMSVAGETIDYGPCAFLDAYDPRTVYSSIDRNGRYAYGQQPRIALWNLTRLAETLLPLLAEAEDASVAEAE
    AALATYAPRFEAAYHGGLARKLGLAETRDGDPALAGDLLKRMAENQADFTLTFRALCAAAERPDADATVRDRFVDPTSYD
    AWAADWRARLAQEARDPAETAAAMRGVNPAFIPRNHRVEAMIEAAVERDDFAPFATLLAVLARPYDDQPDHAAFAEAPAG
    GGVGYRTF
    CGT

    >gi|170751710|ref|YP_001757970.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Methylobacterium radiotolerans JCM 2831]
    MTAPLDDTAGRTPPVRRSLLLILPALVFAALAAVLFLRLRSGADPAALPSAMIGKPVPRFDLPAVPGLTANGAPVPGLSS
    ADLKGQITVLNVFASW
    CAPCQVEHPMLMRLAKEPGIRLVGIDYKEPTPEAGQRFLTRHGVPFSAVGADAGGRAAIDFGVY
    GVPETFIIGPDGVIRDKLVGILTPENFASVLARIRAAGKVAAAQ

    >gi|170751763|ref|YP_001758023.1| selenide, water dikinase [Methylobacterium radiotolerans JCM 2831]
    MSDAPRLTSLAHGGGCGCKLDPATLRQLLAQQPAAGPFERLLVGNETADDAAVWELEDGTCLIATTDFFTPMVDDPVDFG
    RIAATNAISDVYAMGGRPLFALAILGMPLGKIDPEVVARILRGGAEQCAEAGIPVAGGHSIDAPEPIYGLAVIGTCRREA
    VRRNADAVAGDAVLLTKALGVGVYSAAIKRATLDEAGYRDFIATTTLLNRIGTDLAADPAVHALTDVTGFGILGHGLEIA
    RGAGLTLALEADALPLLPQAEALARAGAVTGASHRNWAAFGEAVDLPADLPEWRRHLLTDPQTSGGLLVTCSADRADAIL
    ARVRAAGYPAAARIGRIEPGPARIRVAA

    >gi|170751979|ref|YP_001758239.1| dihydrolipoamide dehydrogenase [Methylobacterium radiotolerans JCM 2831]
    MPETFDIRVPDLGDYADVPVIEIPVAPGQPVDKDQTLLVVESDKATLDIPSPAAGRLVEMLVGLGDTVSAGTLVARLAVE
    APGARAEPLTAPVPAPRPAAPPPEPRAEAGCDLLVIGGGPGGYSAAFRAADLGQRVVLVERHATLGGV
    CLNVGCIPSKAL
    LHVAAVTEEAVRLAAHGISFGAPTVDLEKLRTFKAGTVRRLTDGLAQMARQRKVEVVRGTARFIGPDTVSVTLHDGGTRD
    ITFTGAVVAAGSAPVALPMLPDDPRIVNSTGALELPAVPRRLLVIGGGIIGLEMATVYSALGARVDVVERLPGLLEGVDR
    DLVGVWTKRNAHRFDRVLTGVEVVSAEARPDGIAVTFSGEAEPGTYDLVLQAAGRRPNGATLGLDAAGVALDGGFVPVDA
    QMRTNVPHIFAIGDCVGQPMLAHKAVHQGHVAAEAAAGHKAGFDAAVIPSVAYTDPEIAWAGLTETAAKAAGRAVEVARF
    PWAASGRAIANGADYGLTKLLFDAQTGRVVGGAIVGPSAGDMIGEVALAIEMGADATDIGRTIHPHPTLGETIGLAAEAG
    LGLCTDLPPLARR

    >gi|170745249|ref|YP_001766706.1| protein of unknown function DUF395 YeeE/YedE [Methylobacterium radiotolerans JCM 2831]
    MTAFLAPLAGGALIGASAALLLLANGRIAGISGILGGLLDSLFGSPLGPAARDWAWRAAFLVGLLAGPALYRLAAGHWPD
    VRAGASWPMLIAAGLLVGYGTRLGSG
    CTSGHGVCGLARLSPRSLAAVATFMAAAIVTVFLVRHGVTR

    >gi|170745297|ref|YP_001766754.1| peptide methionine sulfoxide reductase [Methylobacterium radiotolerans JCM 2831]
    MRTERAVLAGGCFWGMQDLIRRQEGVISTRVGYTGGDVPNATYRNHGTHAEAIEIIYDPDRTSFRRMLEFFFQIHDPTTP
    NRQGNDRGLSYRSAIFYTDDGQRRVAEETVADVDASGLWPGKVVTEVSPAGPFWEAEPEHQDYLERRPDGYTCHFIRPGW
    VLPARAPATQGA

    >gi|170745507|ref|YP_001766964.1| glutaredoxin [Methylobacterium radiotolerans JCM 2831]
    MPSAARKAVLYRMVTPEHTCPYGLKAKDLLERQGFEVEDHLLTDRAETDRFKAEHQVTSTPQTFINGARVGGFDDLQRHF
    GKAANDPNKPTYTPVIAVFSMTALMALAASYAVYGTPLTMRAAEWFVAFSMCVLALLKLQDVESFSSMFLGYDLLGRRWV
    RYAYAYPFLEGIAGVLMVAGALNWISIPVALFIGTVGAVSVFKAVYVDQRDIKCACVGGASKVPLGFVSLTENVMMVAMA
    LWMLAMHH

    >gi|170752173|ref|YP_001783319.1| rhodanese domain-containing protein [Methylobacterium radiotolerans JCM 2831]
    MPTAVTVVPPAPSDLAREHFAAEFGFETDCWDVHDSLAQGADFVLLDVRSPALFAAGHVPGAINLPHGKIVRSKLAHWPE
    GTVFVTY
    CAGPHCNGAARGALRLAELGRPVKIMAGGMTGWLDEGFALARAGATA

    >gi|170747790|ref|YP_001754050.1| hypothetical protein Mrad2831_1369 [Methylobacterium radiotolerans JCM 2831]
    MTETPFAPVLFLKAGCPFCMKVRLFLLEAGQLDGVVLREFAPGTEEETEIRGLLGPVVETVTFPAAELTPGSFTTESDAI
    VAHFAARAGVEPAALPTYQSYLNGVFKNLGALYRENMDLKKRLPPA