Methylobacterium populi BJ001 uid58937

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|188579298|ref|YP_001922743.1| glutaredoxin-like protein [Methylobacterium populi BJ001]
    MTDVNTAIKTEIDSQDVVVFMKGTPQFPMCGFSGQVVQILNYLGVPFKGVNVLDDMAVREGIKAYSNWPTIPQIYVKGEF
    VGGCDIAREMFQSGELQQFLSEKGIPVKSAA

    >gi|188579299|ref|YP_001922744.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium populi BJ001]
    MHDVIIVGGGPAGLNAALILGRARRKVLLCDAGEPRNAATPRTWGLFTRDGTPPFDLRAQGRADLERYETVECRAVSVTE
    AAREGEGFAVVLADGRRERARRLILATGLAQDIPEIEGFDTYWGTGVHS
    CPYCDGFEVRDRPLVVYGRGHGGSGLALELT
    GWSRDVTLCTNGGDDDLSDKDRERLARNGVRVIETEITRLEGDGSRPTCLRFRDDGSTPCAALFLMPFSCSPSPLIAQLG
    CELDETRSVVPTREYEKTNVPGLYVAGDASRRVQFAVVAAAEGAMAAFAINAEFVAEATR

    >gi|188579388|ref|YP_001922833.1| glutaredoxin [Methylobacterium populi BJ001]
    MATATARKATLYRMVMPKHLCPYGLKAKDLLEREGFEVEDRWLTTREETDRFKAEHQVKSTPQTFINGERVGGYDDLRQR
    FGKAANDPNATTYTPVVAVFAMTALMALAASYAAYGTPLTQRAAEWFIAFSMCVLALLKLQDVESFSSMFLGYDLLAQRW
    VRYAYAYPFLEGIAGVLMVAGALNWLSIPVALFIGTIGAASVFKAVYLDKREIKCACVGGSSKVPLGFVSLTENLMMVAM
    AVWMLVAHH

    >gi|188579396|ref|YP_001922841.1| Rhodanese domain protein [Methylobacterium populi BJ001]
    MTLTTKSAKDLVAEANREVDTLSAEEALARLGQPDTMLVDVREGEELAKAGRIAGAVHVPRGFLEFQADPESPTHKAELG
    DGRRLVLY
    CGSGNRSALAAKTLKDMGLRSVAHVAGGFSALEKAGASVERV

    >gi|188579404|ref|YP_001922849.1| DSBA oxidoreductase [Methylobacterium populi BJ001]
    MDRRTLLALLPAVALAPALLSLAPHTEEAFAQGIDANAILNDPEAPISGNPKGDLTIVAFLDYNCPFCKKAEPDLTRLVK
    ADGRIRVVHKDWPILGDASVYGAQLALAAKYQGRYDAVHRALMAIPGRKIPKERMLEAVAASGVDMGRLEEDRRAHQAEI
    GALLQRNLDQADALGLQGTPVFLIGPLKVAAALDYDGFKQAVAQARAKGRS

    >gi|188579405|ref|YP_001922850.1| cytochrome c biogenesis protein transmembrane region [Methylobacterium populi BJ001]
    MPNVLANVILAVLVWAGSSLWSPGHCREPAARQAPFTLDVTRDEDLSLRLRWTIAPGTYLYRDKIGASDGSDRELPVTTA
    AGETKDDPNFGATEVYHGAAEAVVPGAALAGVRDVRVTYQGCAEKGICYPPVTRVVEVPAPGPQAAAVPANPAVPASALP
    VDTKAETGSGLLSGNLAGVLATFLGLGLLLAFTPCVLPMVPVLAGMLTRSGERLSAGRGFVLSGTYALAMALAYGTLGVA
    AAWSGRNLQAALQTPVALGLLAATFAALALSMFGAFDLALPTGAAARLSRLSGRRLGALGGAAVMGFTSALIVGPCVTPP
    LAAALLYVAQTGDVARGASALFALGLGMGLPLVAFGTFGAGILPKSGPWLVSAKQAFGVVFLGLAITMVSRLVPPEVTLA
    LWGLLAVGVGVFVGAFDAPLPAGAGAVGRLGKSVGIVAVTYGCALVVVASAGGTDALRPLAGFGQAQAVHAADTRTVASL
    PAFETALQAARAAGKPVLVEFAADW
    CTVCKTNERTVLADAGIRERLKAVSVIRADVTRDDADTRALMQRFGVVGPPTLIL
    MRSDGDEVREARTEGELTVEDLTRRLALVGA

    >gi|188579595|ref|YP_001923040.1| peptide methionine sulfoxide reductase [Methylobacterium populi BJ001]
    MGSERAVLAGGCFWGMQDLIRRQEGVLATRVGYTGGDVPDATYRNHGTHAEGIEIVFDPARTTYRRILEFFFQIHDPTTL
    NRQGNDRGLSYRSAIFYVDDDQHRVAEATIADIDATGLWPGKVVTEVAPAGPFWEAEPEHQDYLERRPDGYTCHFVRPNW
    ALPARAPATQDT

    >gi|188579660|ref|YP_001923105.1| glutathione peroxidase [Methylobacterium populi BJ001]
    MTIRRRDCLAMLAVLAAGRANAPAYAAESGPAGAFAFDTPGGGTLPLSAYAGKPVLVVNTATACGYAPQFAGLQGLWTRF
    GDRGLTVIAVPSPDFGNQEPLDGAAIAEAARKNHGVTFPVADKTHVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRDG
    TLRAAFATQIDPSDPRIVSAIVAELGQA

    >gi|188579675|ref|YP_001923120.1| OsmC family protein [Methylobacterium populi BJ001]
    MDANALRALQAPLKSQYRESPDSAVVTLKAKGSLDDTSIACKVETGRALAVAGLHPATGGSGAELCSGDMLLEALVACAG
    VTVKAVATALEIPLKAGTVSAEGDLDFRGTLGVDKEAPVGFRAIRLKFDLDTDVPQEKLDQLLKLTERYCVVFQTLNHKP
    ELSVNASRS

    >gi|188579753|ref|YP_001923198.1| Heavy metal transport/detoxification protein [Methylobacterium populi BJ001]
    MDQTPIELTMRVDGMTCEGCAEAVRRTIRRLDPQAEVSVDVGLGRVTATTVAQSLDVAQALTKAGYTATAMTG

    >gi|188579964|ref|YP_001923409.1| arsenate reductase [Methylobacterium populi BJ001]
    MPEPFDVVIYHNPACGTSRNTLAMIRNAGIEPHVIEYLKTPPTRDLVRQLARRAGLAVRDLLREKGTPYAELNLGDASLS
    DDQLLDAVAAHPVLLNRPLVVTPRGVRLCRPSEAVLDLLPPQQGAFVKEDGERVVDAHGRRVATA

    >gi|188580067|ref|YP_001923512.1| methionine-R-sulfoxide reductase [Methylobacterium populi BJ001]
    MAGSDVIGRDTETRTDDEWRRALTPEQYRVLREHGTERAGTSCLNAEKRAGTFFCAGCGAPLFESGTKYESGSGWPSFFA
    PLEGAVETQVDRSHWMTRTEVHCARCKGHLGHVFEDGPAPTGLRY
    CMNGVALDFEPAA

    >gi|188580292|ref|YP_001923737.1| thioredoxin reductase [Methylobacterium populi BJ001]
    MAHTHARLVIIGSGPAGYTAAIYAARAMVEPLLISGFQPGGQLMITTDVENYPGFAEAIQGPWLMEQMRLQAEHVGTKIV
    SEYITKVDLKVRPFRLEADSGETYTCDSLIIATGAQAKWLGLPSEAKFQGFGVSA
    CATCDGFFFRGKDVTVVGGGNTAVE
    EALYLANLAKSVTVIHRRGEFRAERILQERLFKHANVSVKWHHAVEEICGSDTPPSVTHLRLKDLRTGEIVEQPTDGLFV
    AIGHQPATGIFEGQLPMRHGGYITVTPGTTATEIPGVFAAGDVTDDVYRQAITAAGMGCMAALEAEKFLANLDVGESPAK
    AAAE

    >gi|188580406|ref|YP_001923851.1| OsmC family protein [Methylobacterium populi BJ001]
    MSGKHSIKIRQIEAYAFRIEFGEAFVPLLTDEPEPIGGGTGPSPEQVLIAAVSNCLCASLAFALGKYRQEGGGVSAEAIG
    RVARNAEGRLRLVGIEVDIALGASAESMDRIDRVLAQFEQF
    CTVSESVKAGVPVAVAVRDGRGNRLK

    >gi|188580595|ref|YP_001924040.1| protein of unknown function DUF395 YeeE/YedE [Methylobacterium populi BJ001]
    MTTFLAPLAGGALIGTAAALLLLVNGRIAGISGIVGGLLGSSGREAGWRVAFLVGLLLGPVLFRLAAGHGPDVRLGAPLD
    AFWPVLVIAGLLVGYGTRLGSG
    CTSGHGVCGLARLSPRSFAAVATFMATAMITVFLVRHGVAR

    >gi|188580760|ref|YP_001924205.1| DSBA oxidoreductase [Methylobacterium populi BJ001]
    MPLSRRRFLVSSLGLAIAGPAAAQSYGQTFKVENDEGRPVANMRLPGEITGQIQELRGVTYLGPREAEVTLYEFFDYNCP
    WCRKAAADVTALAGSDPALRIGLVHNPILSPMSAQAAKVSLAVQRKLGSAAAFAFYGQLLSTKGQIDGLKALDIGAKTGV
    PRAELEQIADSDAVREALRAHMNVAANLGLTATPSYVLGNTGVLGHPGVKSLAKMIAAMRRCDQIACG

    >gi|188580788|ref|YP_001924233.1| peptide methionine sulfoxide reductase [Methylobacterium populi BJ001]
    MTTERLRAPLLIGGLTGLALLVGAALPLAPASAEEGGQRLPEAAMTAREKPGLRTATFAGGCFWGVQGVFQHVKGVKNAV
    SGYAGGSRASARYEEVGTGRTGHAEAVQVTYDPAVVRYDELLQIFFSVALDPTEVDRQGPDTGPQYRSALFPADAEQAAV
    AKAYIAQLDGAKIFSKPIATRIESGAFYPAEGYHQDYMTLHPTNSYIAVNDAPKLRDLKALFPERANAQPVLVGRPPA

    >gi|188580789|ref|YP_001924234.1| methionine-R-sulfoxide reductase [Methylobacterium populi BJ001]
    MNRRQTLRAGASLLGLLAASRLTAVMAGPAASGAFEVEKSEAEWRALLAPAAYKVLREHGTERAYTSPLNGEKRPGRFSC
    AGCDLPLFSSKTKFDSGTGWPSFFEPLPDAVATQVDTAYGMRRTEVHCRRCGGHLGHVFEDGPKPTGLRY
    CMNGVSLRFE
    PSADGPA

    >gi|188580836|ref|YP_001924281.1| dihydrolipoamide dehydrogenase [Methylobacterium populi BJ001]
    MSYDLVVIGTGPGGYVCAIRAAQLGLKTAVVEKRATHGGTCLNVGCIPSKALLHASEAFEEANKHFSELGIDVGTPKLDL
    KKMQGFKQGGVDGNTKGVEFLLKKNKVDAYHGRGRIAGAGRVEVISDDGGNQMLETKNIVIATGSDVTRLPGVEIDEKTV
    VSSTGALELADVPKRLVVIGAGVIGLELGSVWRRLGAEVTVIEYLDRVLPGMDGEVGKQFQRILAKQGMVFKLSTKVTGV
    EVAEKGGATVTVEPAQGGEAETIEADVVLVAIGRVPFTEGLGLETVGVATDNKGRIETDSHYATNVTGIYAIGDVIAGPM
    LAHKAEDEGVAVAEILAGQAGHVNYGVIPNVVYTFPEVASVGKTEEELKKDGIGYKVGKFPFTANGRAKANGTTDGFVKI
    LADEKTDRVLGVHIVGADAGNLIAEVAVAMEFAASAEDIARTCHAHPTLTEAVKEAALAVDKRAIHV

    >gi|188580856|ref|YP_001924301.1| UBA/THIF-type NAD/FAD binding protein [Methylobacterium populi BJ001]
    MAGMALTSEEIERYARHLVLREVGGPGQARLKAGRVLVIGAGGLGAPLIQYLAAAGIGTIGIVDDDTVSLSNLQRQVIHG
    TPDVGRPKVESAADAVRRLNPHVRVETHALRLNPENAPALLAGYDLVADGSDNFSTRYAVSDACFHAKKPLVTAALGAFD
    GSLTTIRAHETGPTGEPNPTYRCLFPSPPPPGSVAP
    CAEAGVLGALAGVMGSLMAMEVIRAVVGFGEPLVGRLLMVDARS
    MRFETLAYAWDPENPLNGAGVRTDPAAAPAALPPRPR

    >gi|188580991|ref|YP_001924436.1| Thioredoxin domain [Methylobacterium populi BJ001]
    MTTRRHVLVLAAALMAGGLPGAGQAAAPVAFDPAAFAAAQAEGRPILVQISAPWCPICRAQKPILATFSADPRFKNLAIF
    TIDFDSQRDLVRRFGAQMQSTLIVYKGAAEVARSVGETQAEWIEQLLEKAL

    >gi|188581460|ref|YP_001924905.1| Thioredoxin domain [Methylobacterium populi BJ001]
    MLEANAAAPADGLIKDTTTAGFRQDVIAESMNQPVIVDFWAPWCGPCKQLTPVLEKVVRAAGGRVKLAKLNIDEHPGVWQ
    QIGQQLGLQSIPAVIAIDRGRPVDAFMGAVPESEVRAFVDRLAGPSEIDQVLEEAAAVASAGDLAAASELYAAVLREEPE
    NLKAIAGLAKTQLELGETENAKQVLAMVPEAKADDPLLAGVRAALELAEQAGSLGDLAGLQRRIEADPNDFQARFDLALG
    LNGAGKRDEAVDQLVAIARADRNWNEDAARKQLLQFFEAWGLMDPAAIRGRRQLSTLLFS

    >gi|188581509|ref|YP_001924954.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Methylobacterium populi BJ001]
    MSETEMSHSFDVDLFVIGGGSGGVRAARIAAGHGAKVMLAEEYRVGGTCVIRGCVPKKLMVYASRFTDEFEDAAGFGWHL
    ETPRFDWAVLKRSRDAEVARLEAIYGRNLAGAGVEVVADRAVIEDPHTVRLVKADRTVRARFILIATGATPVREPLIPGA
    DLAIDSNGVFELERQPERILVVGGGYIAVEFAGVFAGLGSKTTLLHRGKSLLRGFDPEIADALGEAYAKRMDLRLERTVE
    RLERDGSAIRATLNGGESLTVDCVLVATGRRPNVAGLGLERVGIALDARGAIPVEADSRTKVPSIYAVGDVNGRAALTPV
    AIREGHAFADTVFGRKPWCVDHRLIATAVFSTPEIGVIGHNEDVARRCYDAIDVYKASFRPMKATLSGRDERVIMKVLVD
    RASDRVVGVHVMGPDAGEIIQAVGIAVTMGATKADFDRTIAVHPTLGEELVTMRTPFVVKHPVGVG

    >gi|188581513|ref|YP_001924958.1| OsmC family protein [Methylobacterium populi BJ001]
    MTDRHASAHWEGDGKTGKGKITTQSGVLSDNPYGFNTRFENEPGTNPEELIAAAHAGCFTMALAFQLQSAGLKATSLDTK
    AVVTLVQDGDGFKVTKSALTLKAVIPGIDQAKFDELAGNAEKG
    CPISKLLNAEITLDKTLSPG

    >gi|188581595|ref|YP_001925040.1| Glutathione S-transferase domain [Methylobacterium populi BJ001]
    MATLYHSPFCPNSRFIRLVLAEMGMEPTLVEERAWERRRDFLIVNPAGTTPVLVEQTGLAVPGAGVIAEYLDETRGLGLA
    GRRLLPDTTVARVEVRRLLDWFLVKFNSEVTEYLVTEKIDKRFMSSAAGGGPPDMNAIRAARTNVRYHLQYVGYLIGQRR
    WLAGNDLTYADLAAAAHLSCVDYLGDVPWDEDEMAKDWYARVKSRPSFRALLADRAPGMPPAAHYADLDF

    >gi|188581668|ref|YP_001925113.1| OsmC family protein [Methylobacterium populi BJ001]
    MTVDVKYRTTASATGGRDGSARTEDGSFQVQLSTPKELGGAGGPGANPEQLFAAGYSACFIGALKVAGGQLKLKVPADTT
    VTATVGIGPRSEGGFGITADLKVSLPGLERADAERLVEAAHQI
    CPYSNATRGNVDVGLTLA

    >gi|188581751|ref|YP_001925196.1| Rhodanese domain protein [Methylobacterium populi BJ001]
    MTVSPFVTVDWLHQRLSAPDIVVLDASWYLPAQGRDAEAEYRAAHIPGAIRFDLDAMSDTDSPLPHMLPRPEVFSSKMRT
    LGVGDGAQVVVYDGMGLFSAPRVRWMLQTFGMRDVTILEGGMPAWIAAGYPTEDGEGRPRDRRHFTARLDNGAVADAGDI
    ARALANGSAQVVDARSGPRFRGEEAEPRPGVRPGHMPGARNLHYAALQANGRLRDEASLRAAIAEAGVDLDRPVVTT
    CGS
    GVTAAIVALALETLGKKPRALYDGSWSEWGSDPARPVETGPA

    >gi|188581786|ref|YP_001925231.1| heavy metal translocating P-type ATPase [Methylobacterium populi BJ001]
    MAAQATAEGARRNGTTFEFPVRGMSCASCVGRVETAVRAVVGVQAANVNLATGRVSGVLAAGASDIAVADAVRGAGYEPV
    EVVTELRVSGMT
    CASCVGRVERALGHVPGVRDATVNLATQRASVRHLGGAGMAQRIVAAVAAAGYEAEPVRDAAAAGDRE
    RAEREAEIAALRRSVLLAALATAPLLVFEMSAHLSGSLHEALTRTLGQGMLTLLSLVFASLIQFGPGLRFYAKGIPALLR
    GAPDMNSLVMLGTSAAYGFSVVAALAPWLLPAGTAYTYFEAGAVIVTLILLGRWFEARARGRTSDAIRHLLTLQARTARV
    VRDGVETEVDVEGVRPGDVVAVRPGERLPVDGTVLDGASYVDEAMVTGEPVPARKATGDEVIGGTVNGTGSFRFRATKVG
    SDTLLAQIVRTVEAAQGSKLPIQALVDRVTTWFVPAVLGAAAVTLGIWLAFGPSPALAFALANAVAVLIIACPCAMGLAT
    PTSIMVGTGKAAEFGILFRRGEALQALRDARVIALDKTGTLTKGTPELTDIAVLPGFDEDTVLRLLASMEARSEHPVAAA
    IVAAAQRRGVRLAEAVGFEAIPGFGARAMVEGRRVEAGADRLMRRRGLDLSALSGAAERLADDGRTPLYVAVDGVLAALV
    AVADPIKESTPEAIAALRRLDARVVMVTGDNRRTAEAVARRLGIDAVEAEVLPTDKADVVRRLQVDGTVPVAFVGDGIND
    APALAQADVGLAIGTGTDIAVESADVVLMSGDLRNVANAVALSRATIRNIRQNLFWAFAYNAVLIPVAAGALYPAFGILM
    SPLFAGLAMAFSSVSVVLNALRLRAFAPMLQATKAAAS

    >gi|188581870|ref|YP_001925315.1| Redoxin domain protein [Methylobacterium populi BJ001]
    MTIQVGDHLPQATFRVNGPDGPQAKTTDDVFKGRRVVLVGVPGAFTPACHRNHLPGFVAKREEILARGIDAIAVTSVNDI
    FVLNAWQQQSGAEGIEFLADGNAEFAKAIGLEMDGSGFGLGPRSQRYAMVVEDGVVRILNVEDTPSKAEVSGAEALLKVL


    >gi|188581891|ref|YP_001925336.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Methylobacterium populi BJ001]
    MSAQAPGSLPPGTGDRPRRSLLVLLPVVVFAVLAVTFFVRLRSGADPQALPSALIGKPAPAFALGPVPGLEADGKPVPGL
    SSADLKGQVTVLNVFASW
    CAPCQVEHPMLMRLAQEPGIRLVGIDYKDPGDAGRRWLERHGLPFAAVGADPSGRAGIDLGV
    YGVPETFIIGPDGVIRDKLVGILTPENYASVLGRIRAAGRTTPVTN

    >gi|188582058|ref|YP_001925503.1| heavy metal translocating P-type ATPase [Methylobacterium populi BJ001]
    MDTVLDPSTRPSAPASGSAGTRLTLPVEGMSCASCVGRVERALAALPGAVDVCVNLATGRASLVLPEGVPASRAVEAIHE
    AGYDVPESVTAVAVEGMS
    CASCVGRVERALLALPGAVAASVNLATGRAELRHAAGIVSASDVEAAVRRAGYEPRPLDAAP
    DTSHEERQEREAAALRRDLIIAAILASPVVVLDMGGHLLPGFHHAVTGVLGASGLAWLQAVLATAVLAGPGRRFFRIGVP
    NLLRGHPDMNALVALGAGAAYLFSLVSTVAPRLLPDGAAHLYFEASVLIVTLILLGRTLEARAKGRAGAAIARLIDLSPK
    TARLVEVGSEREVPASDLRIGDRVRVRPGERVPADGTVTAGSSFVDESMITGEPVPVEKGMGARVVGGTLNTTGSFDLTV
    DRTGADTALARIVRMVEEAQGGKLPIQALVDRVTLWFVPAVIAVAVLTFLAWLVFAPAPAFGHALVAAISVLIIACPCAM
    GLATPVSIMVGTGRAAERGVLFRQGAALQALREARVIALDKTGTLTEGRPRLTDLVTVPGFAREEVLALAGAVEARSEHP
    VARAIAEAAREAGAVPETEAFEAVPGHGVSARIAGRPVALGNRRFMGRLGIATDALEADAARLAGEGKSPIFAAVDGRLA
    ALLAVADPVKPEARAALDALRARGLTVAMLTGDARATAEAVARSLGITEVEAEVLPEGKVAALRRLREAHGPIAFVGDGI
    NDAPALAEADIGIAIGTGTDIAVESADVVLMSGALGGLVEAVALSRATLANIRQNLFWAFAYNVALIPVAAGVLTIVGGP
    QLSPVLAAGAMALSSVFVVGNALRLRRAGA

    >gi|188582158|ref|YP_001925603.1| dihydrolipoamide dehydrogenase [Methylobacterium populi BJ001]
    MSETYDVLIIGAGPGGYVTAIRAAQLGFKTAVVDREHLGGICLNWGCIPTKALLRSAEIYHYMQHASDYGLSAKEVSFDT
    AAIVKRSRGVSGRLNGGVGMLLKKNKVDVIWGEAAIDAAAKGNEPGKVTVKETKRAEPPKGAKGAGTYSAKHVIVATGAR
    PRVLPGIEPDKKQIWTYYEAMVPEAMPKSLLVMGSGAIGIEFASFYRTMGAEVTVIELLPQILPVEDAEIAGIARKRFEK
    QGIKILTGAKVTKVEKGANSVTATVEDDKGKTQTLTAEKLISAVGVVGNIENLGLEKLGVKIERGIVVTDGLGRTNVPGV
    YAIGDVAGPPMLAHKAEHEGVICIETIKGLHTHPMDKGKIPGCTYCHPQIASVGLTEGKAKELGFSIKVGRFPFAGNGKA
    IALGEPDGLIKTIFDAKTGQLLGAHMVGAEVTELIQGYVVAMTLETTEEELMHTVFPHPTLSEMMHESVLDAYGRVIHT

    >gi|188582410|ref|YP_001925855.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacterium populi BJ001]
    MPLEPGNAAPLFSLPGAGGETISLESLRGHKIVLYFYPKDDTSGCTLEAQNFNAQSDAFAAAGAKVIGVSPDSVKSHDKF
    RAKYGLTFPLASDEAKSMLETYGVWVEKSMYGRKYMGVERTTLLIDREGRIARVWNKVKVPGHVEEVLAAAQALA

    >gi|188582494|ref|YP_001925939.1| Peroxiredoxin [Methylobacterium populi BJ001]
    MSDIYDHSPRDARGAPHPLSQYRGKVLLVVNTASKCGFTPQYQGLETLWRRHRARGLVVLGLPCNQFGAQEPGDAAAIEQ
    FCSLTYDVTFPVLAKIEVNGPGADPLYVDLKRERPGLFGTQGIKWNFTKFLISRDGRVIERFSPSTKPAALEGAIEQALA
    APGG

    >gi|188582613|ref|YP_001926058.1| DsbA oxidoreductase [Methylobacterium populi BJ001]
    MITRRDALKITGLALGTAALLPSFSLEALAQSADTAALMQPGPLGDVWLGPADAKVTIIEYASMTCSHCAHFHATTWPVL
    KERYIDTGKVRFTLREFPLDPLATAAFMLARCDGDAKYYPITDLLFDQQPNWAFVRKPQSPVDALEQLLRQAGFSKEKFE
    ACLKDQKTYAAINAVKTRGLETLKVESTPTFFINGEKRAGALSIEEMEKIIKPILGA

    >gi|188582715|ref|YP_001926160.1| glutaredoxin 3 [Methylobacterium populi BJ001]
    MQPVTIYTTAWCPYCSAAKSLLREKGVSFNEIDVEKTAGARATMVQRAGGRTSVPQIFVGDRHVGGCDDLYALERAGDLD
    PLLAA

    >gi|188582720|ref|YP_001926165.1| peptide methionine sulfoxide reductase [Methylobacterium populi BJ001]
    MLLFRKRPEMPAPSEALPGRPHPLPTAERHFVNGHPLKGPYPEGIETIVLGFGCFWGAERKFWQLPQGIYVTAVGYAGGF
    TPNPTYEEVCSGLTGHNEVVLVAFDPAVLPLESVLKTFFESHDPTQGYRQGNDVGTQYRSGIYTRDEAQAATARTVRDAY
    ARALDARGYGPVTTEIVPLDTFYFAEEYHQQYLAKNPGGYCGLGGTGVSCPVGVGVAAE

    >gi|188582728|ref|YP_001926173.1| Redoxin domain protein [Methylobacterium populi BJ001]
    MKATPKILVGTLAAGGALAAVLVGFALYGTGSNLGNLAASGPCAEAAPAAARLAPLARGEVAAFDASAAPKPAPVVAFKG
    PDGAATDLAALRGKLLLVNLWATW
    CAPCKAEMPALDRLQAERGGDAFQVVAINVETRNLDKPPAWFKANAIAHLTYYGDP
    EGKVLPAIQAAVGSTGLPTTMLIDAKGCTLGVMKGPAEWSSEDGQRLIRAALGTGT

    >gi|188582822|ref|YP_001926267.1| iron-sulfur cluster assembly accessory protein [Methylobacterium populi BJ001]
    MADITLTPRAAKRINEIMGSEPPGSSLRISVNGGGCSGFSYAFDITSAREGDDIVIERDGATVLVDPVSLEYMGGATIDF
    VNDLIGQSFKIENPLATASCGCGTSFAI

    >gi|188582960|ref|YP_001926405.1| Thioredoxin domain [Methylobacterium populi BJ001]
    MLQLGKRQDCSSTRRLPRCLSECDSVNRIPRERSAQSAKCGKCGKALFSGKPTEIGGERFRRHIEQNDVPLVLDFWASWC
    GP
    CRAMAPAFDQVANKIEPKARFLKADVDAEPQLTAEFGIQGVPALFVFKNGRVAARQTAAMDFTSLARWVEQASH

    >gi|188582968|ref|YP_001926413.1| glutaredoxin [Methylobacterium populi BJ001]
    MLDTTRRAIVYRMVMEKHVCPYGLKTKDLLEREGFTVDDHWLTTREETDAFKAEHDVKTTPQTFIGGQRIGGYNDLRRHL
    GRAVKDPDATSYTPVVAVFAMTALMALAASYAAYGTPLTMRAGEWFIAFSMCVLAILKLQDVETFSSMFLGYDLLAQRWV
    RYAYAYPFCEALAGVLMVAGALNWLSIPVALFIGTLGAVSVVKAVYIDHREIKCACVGGSGSVPLGFVSLTENLMMVGMA
    IWMLVAHH

    >gi|188583084|ref|YP_001926529.1| OsmC family protein [Methylobacterium populi BJ001]
    MTVTAAKEIVQTFEKVFEPIDRERLHALSEKGRADPSVVKTVRARTVAEGRRFRHLNYIRNLDAHIVDEPPALLGDDTAP
    NPTEALLAALGT
    CVAVGLQANAIACGWTVKGIEVESEGDINITSVWGTGDLSEKPVGLTTVRLKVHLDIEGASPAELDEL
    VAHAGQWSPVLNTVKNPVSVTLARA

    >gi|188583158|ref|YP_001926603.1| DSBA oxidoreductase [Methylobacterium populi BJ001]
    MPLFRSVSALALAGGLALGAAAGARAEDAAPFTDAQRKAIEGIVKDYLVKNPDVLQEAIAEGERRAQETQKLAQAAALKE
    SREALTNSPHGIVAGNPNGDVTLVEFFDYN
    CGYCRKAFTDVQTLIKSDPKLRVVLKDFPVLGAESLEASRIALAAKMQIK
    PEKMFDFHAKLLETKGRINGERAIAVAKEFGADVERLKKDAQGPEVKAALTENVGLGDKLSLSGTPAFVIGDEILPGAVG
    VEPMRKTISDVRQCGHASC

    >gi|188583265|ref|YP_001926710.1| arsenate reductase [Methylobacterium populi BJ001]
    MDVVIYHNPACGTSRNTLAMIRNAGIEPHVVEYLKTPPNRALLKQMLARAGLSVRDVLREKGTPYAELGLADPALTDEQL
    LDAVEAHPVLLNRPLVVSPMGVRLCRPSEAVLDLLPDQQGEFVKEDGERVVDERGRRVATA

    >gi|188583279|ref|YP_001926724.1| heavy metal translocating P-type ATPase [Methylobacterium populi BJ001]
    MTEAATLDRTDVPTTRLRVTGMDCASCAAKVEAAVRRLPDIAQVQVSVAAETLAVRHGPGTDARMIADTVRGLGYGAEDP
    DAVALGDTAETPWWRAPKALLAASCGAALVTAYALGHVAPITERWAFLAAMAVGLVPVARRAILAARHGTPFSIEMLMTI
    AAVGATVIGATEEAATVVFLFLIGEVLEGVAAGRARASIRGLTGLVPETALLERDGTTESVPAASLKVGATVLVRPGDRV
    PADGTILDGGSDVDEASVTGESVPRRKEPGDAVFAGTVNGDGALRVRVTAAAKDNTIARVVQLVEEAQEAKAPTERLIDR
    FSRVYTPAVVAVATLVAVVPPLLTGGAWGDWVYKGLAILLIGCPCALVISTPAAIAAGLSAGARRGLLIKGGAVLERLAS
    VTTVAFDKTGTLTEGKPVVTNVVAFGRSERDVLSLSGALEGGSSHPLARAVLAKAAEAGAPVPPAFGAQAFGGKGIASKV
    GGLDLFLGSPREAGARVPFTPDQEERVSGLQGEGKTVSVLLANGAVAGLLAMRDEPRSDAREGVDRLASLGVGAIMLTGD
    TARTAWAVAAALGIEVWAELLPEDKQRIVRERQATGAVVAKVGDGINDAPALAAADVGIAMGGGADVALETADAAALHGR
    VADIARMIELSRRTLFNIRTNIALALGLKAVFLVTTVLGVTGLWPAILADTGATVLVTANALRLLGEGRSSA

    >gi|188583323|ref|YP_001926768.1| heavy metal translocating P-type ATPase [Methylobacterium populi BJ001]
    MSQAAGADRTSFPTNGPQALRYRVKGMDCPTCAGKIETAVSRLPGVADVRVNYGSQVLDLALDEAATPRTELEGRIERLG
    YGVALLPTAADLAMAQASGGAPPAGTAEEPEPPLWRSRKARLGILIGALFAAGFLVERIAPGLAGEYAYWPGALVGLAYY
    GRRAAVAALAGTPFSIEMLMSVATAGALAIHAAEEAAIVVLLFTVGEMLEVVAAGRARAGIKALAALVPKTARLVDEANG
    TIREVAAASLAIGQVVVVRPGDRVPADGVITDGASSLDESPITGESVPKPKEVGDPVYAGSVNADGALQVRVTKTAADNT
    VARILHLVEEAQASKSPTARFIDRFSAVYTPIAFAFAAAVAVVPPLLGADWGTWIYRGLALLLIACPCALVLSTPAAIAS
    GLAAGARRGLLVKGGAALEVIGRVHTVAFDKTGTLTAGRPRVSDILVFAPDASERSLLGLAAAVESGSGHPIARAILDRA
    SADGVPLRPTRDARAIPGKAVSATVMGQTVLVASPRHAAESARLGPEAERAVADLEAGGKTVVIVVRGAEALGAISVRDE
    PRADAAAGISALRKLGVRSVMLTGDNRRTGEAVASELGLDVKAELLPQDKLAEIAALKAAAPVAMVGDGINDAPALAAAS
    VGIAMGGGTDAALETADAAVLNDRVGDVAALVSLSRATLGNIRQNVAIALGLKAVFLMTTVAGITGLWPAILADTGATVL
    VTANALRLLRA

    >gi|188583335|ref|YP_001926780.1| copper-translocating P-type ATPase [Methylobacterium populi BJ001]
    MPHSVPPSHERHGHHAGHDHAQLGHGDHETQASGTGTVKDPVCGMTVDPHAAKHRAEHAGHPYYFCSNGCRTKFEADPVR
    YLDPGQARVEPVPEGTIYTCPMHPEVRQVGPGG
    CPICGMALEPAVVGADTGPSEELVDMTRRFRVGLVLTLPVFVLEMGG
    HLFGLAERLGQQTSNWIQFVLAAPVVLWAGWPFFVRGYRSVVSRNLNMFTLVSLGTGCAFLYSVVATAAPGLFPQALRGH
    GGAVPAYFEAAAVITVLVLLGQVLELRARESTGGAIRALLDLTPKTAHRIRPDGSEEETSLDAIAAGDRLRVRPGEKVPV
    DGFVAEGRSSVDESLVTGESMPVTKAAGAPVVGGSLNQSGALVIEATKVGRDTMLARIVQMVAEAQRSRAPIQRLADQVA
    GWFVPAVIGVAVLAFLAWMVFGPEPRFTFALLAAVAVLIIACPCALGLATPMSIMVGVGRGAGAGVLVKNAEALERMERV
    GTLLVDKTGTLTEGKPAVTRIVPSASFDEATVLRLAASVERASEHPLATAVVRAAEERGVATAAVADFESPTGKGAFGTV
    EGRRVALGNAAFLREHGVDVSAYAAGADELRRDGATAIFAAVDGRVAGVIAIADPVKATTAEALAALRTEGIRVVMLTGD
    NRTTAEAVARRLGIEEVEAEVLPDRKAAVVERYKAAGQVVAMAGDGVNDAPALAAADVGIAMGTGTDVAIESAGLTLLKG
    DLMGIVRARRLSKAVMGNIRQNLFFAFVYNAAGVPVAAGVLYPFLGILLSPVIAAAAMALSSVSVIGNALRLRTARLDP

    >gi|188583347|ref|YP_001926792.1| cytochrome c biogenesis protein transmembrane region [Methylobacterium populi BJ001]
    MPNVFTHLILAALLWTGSSLWSPGQCREPGARPTPFTVDAARDPDLSLRLRWTIAPGTYLYRDKIAATDASGRELPVSTQ
    LGETKDDPNFGPTEVYHGATEAIVPGAALAGVREVRVTYQGCAEKGICYPPINKVIEVPALGPQATATAATPATDAQAEP
    ASGLLSGHLAGVLATFLGLGLLLAFTPCLLPMVPVLAGMLARSGERLSAGRGFVLSGTYVIAMALAYGTLGVAAAWSGRN
    LQNALQTPAALGLLAAAFAALALSMFGVFDLALPSGVAGRLSRLNGGKLGALGAAAVMGFTSALIVGPCVTPPLAAALLY
    VAQTGDVARGAAALFALGLGMGLPLIAFGTFGAGILPKSGPWLVAAKQAFGVVFLALAITMVSRLVPSEVSLVLWGALAI
    GVGVFVGAFDVLRAGAAGRLSKVAGIVAVTYGCALVVGAAGGGTDPLRPLAGFGPSRAVHVEESRSVSSVPAFEAALAAA
    RAAGKPVLVEFAADW
    CSVCKTNERTVLADPGIRARLRAVSVIRADVTRDDDATRALMRRFEVVGPPTLILMRPDGGEVRE
    ARTEGELTVEDLKRRLALVGA

    >gi|188583348|ref|YP_001926793.1| DSBA oxidoreductase [Methylobacterium populi BJ001]
    MDRRTLLALMPAVALAPALLSLAPPIEEAFAQGVDPNAILNDPEVPVSGNPKGDLTIVAFLDYNCPFCKKAEPDLIRLVK
    ADGRIRLVHKDWPILGDASVYGAQLALAAKYQGRYDEVHRALMGIPGRKIPKERMLEAVAASGVDVARLEEDRKAHQAEI
    AALLQRNLDQADALGLQGTPVFLIGQLKVAAALDYDGFRQAVAQARARGRS

    >gi|188583351|ref|YP_001926796.1| protein of unknown function DUF395 YeeE/YedE [Methylobacterium populi BJ001]
    MDGFTPVSALAGGALIGTSAALFLLLNGRIAGISGILGGLLTPPSRETGWRAAFVAGLVLAPFAYAGLGGSLPPLTVDAS
    FPLLVVAGLLVGFGSRLGAG
    CTSGHGVCGIGRGSPRSVVATGTFMAVAILTVLVVRHLVGA

    >gi|188583355|ref|YP_001926800.1| Rhodanese domain protein [Methylobacterium populi BJ001]
    MTMRSAKDLVAEANREVETLSAEEALARLGQPDTMLVDVREGEELAKTGRIAGAVHVPRGFLEFQADPESPTHKAELGGG
    RRLVLY
    CASGNRSALAAKVLNDMGLGPVAHVAGGFPALVKAGASVDPA

    >gi|188583359|ref|YP_001926804.1| SoxS [Methylobacterium populi BJ001]
    MVKFERRGCPWCKVWDKEIGPIYPKTDIGKRAPLRRVDLDAGIPPGLTLKRPILYTPTFVLIEGGAEVDRIEGYPGEEFF
    WGRAERLLKQLPASP

    >gi|188583360|ref|YP_001926805.1| putative thioredoxin [Methylobacterium populi BJ001]
    MSTRRRFLAGALALGLPSKAMAQAIQGDDGLYREPWFLESFLDLSDDLRAARDHGKRLAVLWELKGCPYCKQIHLVNFAD
    RATSTYIRERFDILQLNFIGSREVTDFDGQTLSEKGFAEKYGIYSTPSIQFFPAEESTLADKPPQQREVLRLRGYVAPEE
    FRRTFAFVAERAYERTNLQDYLRSPEAARRG

    >gi|188583651|ref|YP_001927096.1| iron-sulfur cluster assembly accessory protein [Methylobacterium populi BJ001]
    MSGFKVITLTDRAADRLKAIMADAEKPIAGLRVGVKNGGCAGMSYTMEYAEERKAGEDVIEDRGVTVFIDPKAVLFLLGT
    EMDFQTTKLSSQFVFNNPNQTSACGCGESVAITPANPERLAAGAPA

    >gi|188583719|ref|YP_001927164.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium populi BJ001]
    MRYDAIIVGGSFAGLSAALYIARARRRVCVIDAGAPRNRFADASHGFFAQDGENPLAMIAAARAQLAGYPNAGFVAGEAV
    SARAAGDGFAVSLAGGQRLEASKLVLAFGIRDILPDLPGLAERWGASVLH
    CPYCHGFEFAGRMLGVLFAGPKSLHQAELI
    AEWGPTTLFLNGNPAPDAEACTRLAARKIRIETGSVRALAGEARALSALAMADGRTIPLEALFVGPRYRLNSPLAEQLSC
    AVDEGMLGPTIRTDAMKETTVPGVYAAGDAARFPHSVAWASADGVTAGVSLHQTLVFPRLAA

    >gi|188583749|ref|YP_001927194.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium populi BJ001]
    MRELSCDVAVIGAGTAGIAAHRAALDAGVKAVLIEQGPGGTTCARVGCMPSKLLITAAEAAHAARAADRLGIRIGDVRVD
    GPAVLVRMRDLRDRFVASVFEGLDGLPEDTRLHGRAVFEGPDALRIDDHTRLRFKAAVLATGSSPSVPEPLKGLGSRILT
    TDTVFEIADLPASLAVLGAGPVGLELAQAMARLGVATSVFDPGDSLGGLGDPDLKRAAREIFSEAFDLHLGAKVESGAIE
    GEGARLGWKGDEGEGEKTFERVLAAAGRPPNVAGIGLEQTGVTLNDKGGPVHDPRSLLCEGAPILIAGDANADRPVLHEA
    SRQGRIAGRNAARLARGEGAARPERWVALAMVFSDPQIAVIGGGFDRQAGHRVGRADFCDQGRARVMDRAQGGLRLYAEA
    DGRLAAAELIGPEVEHLGHLLAYAVQDGLDVRRLRDRPFYHPTLEEGLDTALSDLA

    >gi|188583854|ref|YP_001927299.1| OsmC family protein [Methylobacterium populi BJ001]
    MSASAAPKTITTYLRPIDRDGLMQFAEKGRSNPGSRGTNKVHTVVEGQYRTLSYVGDHQPVVVDEPLHLFGENTAPAPGE
    IVLSALGG
    CLAVGITAVATWKQVRLSRLELHLEGDIGNPAAWGAGGAEKQPAEMGFQEIRVAVTIEGDASREDLDAIVQH
    ANVFSPVANSLRNPIAFKIGLAA

    >gi|188583984|ref|YP_001927429.1| cytochrome c biogenesis protein transmembrane region [Methylobacterium populi BJ001]
    MLRLVLALLLTLSAPGLAAAQGAMTAVKAKDLVRASLVAEREALVPGGTVMLGLHMAMKPGWHVYWRNPGDSGLPPEMAW
    RLPEGFAVGAVQWPVPERIPVQTLMNFGYEGAVTLLVPLTVPENAKENTKAGGPVRLAGTLSYLVCEEICIPGSAELSLD
    LPVSSSAEPASGQAALFARARAALPEAAPGPHRTTRAGDRLVLHLDRPGLAGVSGAAFFPYAEGALDNAAPQDLAVDEAG
    LRLTLTPGDAKAAPEALAGVLAFTEDGTRRAYALGPEPAPAPTASAPAAPEAPPAPASEETLTLWSAAGLALLGGLLLNL
    MPCVFPVLSIKVLSLVRQAGESATRVRLHGLAYTAGVLASFLGLAGLLIALKAGGAGIGWGFQLQSPVVVALLAYGLFAM
    GLSLSGVVHLGGGIAGLGDGLTRRAGYQGSFFTGVLATLVATPCTAPFMGAAVGFALTQSPLTALTVFASLGLGLALPFL
    MLTLFPQALRLLPRPGAWMDVLKGALAFPVYATVAWLVWVLAQQVGPDGLLAGLTGLVLVALAAWAWERARHAGRLGTGL
    SRAAALVALAASLGLVAILDGDRATARTALAQGEEAFTQARLDALRAEGRTVFVDMTAAW
    CITCQVNERTVIARAGVQAA
    FRAGQVVYLKGDWTNQNPEITRLLERYGRSGVPLYLVYRGTSEAQVLPQILTEGIVLAAIGQKDVAAAQ

    >gi|188584021|ref|YP_001927466.1| transcriptional regulator, AraC family [Methylobacterium populi BJ001]
    MLAEPEIVAPDEAPLTEARMRSAVTARDARFDGRFVYAVRSTGVYCRPGCPSRAARPENLSFHADPAEAEAAGFRPCRRC
    RPDEPALSEQQAEKITRACRLIEAAETPPSLDALARAAGLSPFHFHRTFKAVTGVTPKAYAQAHRAGRAADSLAAGETVT
    GSLYAAGYGAPSRFYADGAERLGMSPSAYRKGGAGERIAFATAPCALGLVLVAATGRGICAILLGDEAEALRRDLAARFP
    RAEIAAGDENFAATVAAVVRLIEAPGAGFALPLDIGGTAFQQRVWQALRAIPAGATATYADIARAIGAPAAVRAVAMACG
    ANALAVAIP
    CHRVVRSDGALSGYRWGTARKAALLAREGER

    >gi|188584142|ref|YP_001927587.1| thioredoxin [Methylobacterium populi BJ001]
    MATVKVTDASFEQDVLQSAEPVVVDFWAEWCGPCRQIGPALEEISVDLQGKVKIAKVNVDENPGIASTYGIRSIPTLMIF
    KDGKLASQKVGAAPKGDLSRWIQASA

    >gi|188584211|ref|YP_001927656.1| Rhodanese domain protein [Methylobacterium populi BJ001]
    MKVVDLDRETVKQGLADGSLLLIDVREDHEFARGRIPGSVSHPLSSFDPEAVRALIEADGRRPVFSCASGVRSVHAIAAA
    QRAGLDLSEHYAGAFKDWYAAGEPVES

    >gi|188584584|ref|YP_001928029.1| protein of unknown function UPF0061 [Methylobacterium populi BJ001]
    MTALFPFDNSFARLPDRFFARVAPTAVEAPRLVRLNRTLALDLGLDPDRLESPEGLDVLSGRRVAEGAEPLAAAYAGHQF
    GQFVPQLGDGRAILLGEVVGRDGRRRDIQLKGSGPTPFSRRGDGRAALGPVLREYLVSEAMHALGIPTTRALAAVTTGEP
    VIRETVLPGAVLTRVASSHIRVGSFQFFAARGDVEGLRALADHAIARHDPEAAEAENPYRALLEGVIRRQAELVARWLGI
    GFIHGVMNTDNMSIAGETIDYGPCAFLDAYDPATAFSSIDRHGRYAYGNQPRIALWNLTRLAEALLPLLSEDETKAVAEA
    EAALTGFAGLFEAAYHGLLNRKLGLTTMRDGDPALAGDLLKTMAENGADFTLTFRRLSAAAPGSGPAPEPEAVEAVRSLF
    IDPTSFDAWAERWRRRLDEEPGSAAGRKALMRSVNPAFIPRNHRVEAMIEAAVERQDFVPFETLLTVLSRPYDDQPDFAQ
    FAEAPEGGGRGYRTF
    CGT

    >gi|188584591|ref|YP_001928036.1| Glutathione S-transferase domain [Methylobacterium populi BJ001]
    MTSRTLYYAPGACSLASHIVLEEIGAPYETVRLDLAKGDQRAPEYLAVNERGRVPALYEDGWVLTENAAILRHLARSHPQ
    AALLPEDPRGQAVADEWMAWLSTGHHIAYAHVRRPERYSADEAAFPEIRAKGADTFGDLCTMTEVRLSDGGWALGENYSV
    VDPYLLVFWIWARGPFIGFDMPNQFPAWTAHARRMAARPAVQAVFAREGLALPA

    >gi|188582660|ref|YP_001926105.1| electron transport protein SCO1/SenC [Methylobacterium populi BJ001]
    MRPSRSVLLPLAAFVAGLVVISVALVMTLVPQHPQSGPSSIGGPFTLVNQDGATVTERDFAGKPYLMFFGFTHCPDVCPT
    TLQQISDVLAALGPKADALKVAFVSVDPERDTPDSLKTYLSSFDPRIVGLTGSPEQVAAAVKTFRAYAKKVPSQGGDYTM
    EHTALVYLMDARNGFVGAVNLNRPAAETAAELSKRI