Aquifex aeolicus VF5 uid57765

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15605725|ref|NP_213102.1| thiol disulfide interchange protein [Aquifex aeolicus VF5]
    MKRLLPVFLALILFGLLVYIGLNQDKHDHYTITTQKGQKIPNVTLTTPDGKKVSIEEFKGKVLLINFWATWCPPCKEEIP
    MFKEIYEKYRDRGFEILAINMDPENLTGFLKNNPLPFPVFVINEKWKEPLTFQGFQRRTWLTEEEL

    >gi|15605781|ref|NP_213158.1| flavocytochrome C sulfide dehydrogenase [Aquifex aeolicus VF5]
    MGVNRRDVFKLAGLGVALGALQLPSIACAAKTSNSLLSPSKGKRIVIVGGGWAGVTAAKYIRKEIPDAEVVLIEQRKMFM
    S
    CPISNVWLGGLVDLEFLIHDFLTPAAKYGYTFINATVTDIDRDKRRVYTEDGYVEYDYLILAPGIRYNYDAWFNGDKDM
    ARYAQTHYPSAFIPGSEHLRLKKKVENFEEGTFVLVVPPPPHRCPPAPYERAAMIAHVFRQNEAKAKLIILDPKEKIAPK
    GPGFRMAYEQLYLDIIEYVPNAKIKEVDPVKKVIKTTAGDFKFDDANLNPPHQAADIAWKAGLVNPKTGWCDVDPITLQS
    KVDKRIFIPGDANSVKGFPKSGDMANNQTKFMLVKAIKAMIEGKDPLEYVKAPTNTCYSMVNGDPKEAIVINVVYDIDKQ
    KRMPVKKKVNVENERSQRLARATFEWAKAMYRDMFS

    >gi|15605894|ref|NP_213271.1| hypothetical protein aq_390 [Aquifex aeolicus VF5]
    MAGQEFEKLLFYIVTVPFFVRAEPTTGELINPQAGAPFFLATAATTMDYEVEMVITSEAGYLLMRDNAKKVKVRPGVEQT
    VYDFIKMAKDAGVKIYL
    CTPSLDLTDIYKEEDVNKEICDGILGGAAFLDKLMSGEYAVITL

    >gi|15605901|ref|NP_213278.1| heterodisulfide reductase subunit B [Aquifex aeolicus VF5]
    MAVPVQFRKPPMGGIGKKVAYYPGCSLEGAARAYDVSTRIVAKELGLELDYLEDYNCCGAMETKNVSFWGTMLLNARNMS
    LARRQGHNVIVAPCNGCSFSLQRVEYFLETDKNTLDRINQLLQEAGEKPLDNIPHTYHILEWFYHEAGPEKVKEKTKKPL
    RGLKVASYYGCLYTRPHFYARTYSHLAPEDEEQARPRKRETADDDEHPYYMEALLEAAGATSVEIEPMHTQCCGGPHSLS
    DEEVSEKFVMMILQTAKRNGADIIATE
    CPLCHASLEMYRHRLMLKGVPDVDVPAAYFTQLLGLAFGYSVNDVKLKDNLSD
    PIPVLKRLGLA

    >gi|15605902|ref|NP_213279.1| hypothetical protein aq_401 [Aquifex aeolicus VF5]
    MLEKELKIVILMTSGPKTPWRCATPFYIATLMAAQEADVEIFFNMDGTNLIKKGVAEKICPSLEGNCFSANGQKPKTVYD
    FMKDAKLAGVKFYS
    CKQAVDSMGLTEEDLIPELDGIVPASEFALRAMMADKLITF

    >gi|15605936|ref|NP_213313.1| glutaredoxin-like protein [Aquifex aeolicus VF5]
    MLLNLDVRMQLKELAQKEFKEPVSIKLFSQAIGCESCQTAEELLKETVEVIGEAVGQDKIKLDIYSPFTHKEETEKYGVD
    RVPTIVIEGDKDYGIRYIGLPAGLEFTTLINGIFHVSQRKPQLSEKTLELLQVVDIPIEIWVFVTTS
    CGYCPSAAVMAWD
    FALANDYITSKVIDASENQDLAEQFQVVGVPKIVINKGVAEFVGAQPENAFLGYIMAVYEKLKREKEQA

    >gi|15605946|ref|NP_213323.1| bacterioferritin comigratory protein [Aquifex aeolicus VF5]
    MKEFLIKILVLLGLAQPGNAIQEGQPAYLFSLNNHEDKVVNLSDYKGKWVVLYFYPKADTPGCTTQAKEYTKLMPEFEKL
    NVKVFGISTDSVEKIRRFREKYGLTVEFLSDPEGIVAKAYGVTLIAGLCSRDTVIINQNLIVEKIYRGVSPSADPHKVLE
    YIKQRAS

    >gi|15605957|ref|NP_213334.1| hypothetical protein aq_477 [Aquifex aeolicus VF5]
    MFMNVPEVTPEEAKKMLEEEKDKVVLLDVRTPPEHFQVRIPNSMLIPLDELRYAFQNLPKDKKYIVYCRIGERSAFATYF
    LRQMGYEAYNLAGGILIWPYEKESGAPAKS

    >gi|15605962|ref|NP_213339.1| alkyl hydroperoxide reductase [Aquifex aeolicus VF5]
    MDVKEIAKKIITDCPVRVGQKVPNFEMETYDPSTGKFGKVVLEDLLKERKWVILFFYPADYTFVCPTELADLAEKYDELK
    EMGCEVISVSTDTKFVHLAWHRDEPLLKNVKYPMGADPTGQVSRLFGVYDENTGLALRGTFIINPEGVLVGSEVNFYNVG
    RNADELVRKMKANVYLMSHPEEACPAKWEPGKKTLKPSEELVGRVGEVLNE

    >gi|15605963|ref|NP_213340.1| thiol peroxidase [Aquifex aeolicus VF5]
    MARTVNLKGNPVTLVGPELKVGDRAPEAVVVTKDLQEKIVGGAKDVVQVIITVPSLDTPVCETETKKFNEIMAGMEGVDV
    TVVSMDLPFAQKRFCESFNIQNVTVASDFRYRDMEKYGVLIGEGALKGILARAVFIIDKEGKVAYVQLVPEITEEPNYDE
    VVNKVKELI

    >gi|15605968|ref|NP_213345.1| hypothetical protein aq_495 [Aquifex aeolicus VF5]
    MLKEGDKVPSFCLPGIDEEVNEREICIDEFKGKKVILYFYPKDNTPGCTQEACDFRDNLNLLKEMGYVVIGVSPDSTASH
    KKFKEKYGLNFILLSDKDKKVAEMFGVYGEKKAYGKVTKGIIRSTFLIDEEGRIIKEWRNVKAKGHVAKVIETLKSLEEK
    Q

    >gi|15605973|ref|NP_213350.1| thioredoxin reductase [Aquifex aeolicus VF5]
    MAVSLMQQPDKVYDVIIIGAGPAGTTAAIYTARAGWKTLVLYRAEADGALGVTQKIENYPGVPGPLSGYELLKIMREQAK
    SFGAEFVRGKVIATDLNSDPKKVYTIDGREFRGKTIIVASGAMERANKFKGEEEFLGRGVSY
    CGVCDAAFFKDQPVAVIG
    DDDYAIEEAEFIARFANKVFFVVPGSKIKAPPEVIEHFEKLPNVEILLRHRPIEIVGDQVVKGIKLKDLEKKEEKLLEVN
    GVFIFLGGTKPSVDFLMGQVEMTEGDCIVVNEEMMTSVPGVFAAGDVLCNEVKQAVVAAAMGCKAALAVDKFLSGKKKIV
    PQW

    >gi|15606129|ref|NP_213506.1| dihydrolipoamide dehydrogenase [Aquifex aeolicus VF5]
    MEFDLIIVGAGSGGYEAGLYAFRRGMKVAFVELSPETVGGNCLNRGCIPSKYMRHGAYLLDKFQKMEQYGIISKGYDIEY
    KKLKEGRDNVVVTIRENFKKFAQQLRIPIYYGKGVLKDPNTVFVEGPEETLKAKYILVATGSSPTSVGNLVPDGKYVIDT
    DQIWEIDYVPKKVLIVGGGAVGVEFAYIFRKYGSEVVLVEIKDRLLPTPDIPEDSGRYLARKLRELGVDIRTRTSVESWE
    KTQNGVKAKLTDGSEVVADFILLGVGRKPNTKGIGLEELGIEMDERGFVKTNEYAQTNIPNIYACGDITSPLMLAHKSMY
    EGKIAVSHILGERDWKKNERIIPKIIYSALEVASVGLTEEQAEDEDIEVRVGVASFVSNPKAMDDGENEGFVRIVADDET
    GEILGCHIVGPHAGELIHQVVHMIKDGKTVEFASKTMYSHPSLSENIGIASSEVYYGPISWVKRR

    >gi|15606208|ref|NP_213585.1| alkyl hydroperoxide reductase [Aquifex aeolicus VF5]
    MEVVSLPRLGEPAPAFEAQTTFGPVKFPDDFKGQWVVLFSHPADFTPVCTTEFVAFAKNYEEFKKRNVQLIGLSVDSNFS
    HIAWVMNIKEKFGIEIPFPIIADHNMEVAKKYGMIHPAQSTTFTVRALFVIDDKGILRAMIYYPLTTGRNIREVIRLVDA
    LQTADREGVATPADWVPEPQTWEFTEENTKVIVPPPTTYEDAVKRLQEGYECADWYICKKKV

    >gi|15606354|ref|NP_213733.1| thiosulfate sulfurtransferase [Aquifex aeolicus VF5]
    MLLLLLLVSIAFSVPKLVSPEWLKENLSKKNLVIIEFGDTQSYLVEGHIPGAVLTEKEQWRKMDPETGALVRRSVEYYEK
    LFRSWGINNDSEVVIYYKGNTRNEILGAVYAYWVFHLLGHKRVGILDGGWKEWIKKGYPVSYEEPEINRGNFKAKYNKEL
    ETNWKYVYENIGKIPIIDGRLPDFYFGIGKFPAAKKYGHIPCSVPFSWEWWVKRDRETEKLYIEFPYYAKEFLRNQGLKP
    EDEVILF
    CFGGTGAAFLYWVFDVSGHKNMKVYDASKREWEALNLPLNRYVWETFRDCRKFFYTN

    >gi|15606532|ref|NP_213912.1| molybdopterin biosynthesis protein MoeB [Aquifex aeolicus VF5]
    MFNFTEEQIKRYARHIILPEVGGKGQAKLLQSKVLVIGAGGLGSPALYYLAAAGVGTIGIVDFDVVDFSNLQRQILHTTE
    RVGTPKVESAKKTLEALNPDVKVITYNTKINKNNVMDIIKDYDVILDGTDNFPTRFLINDACYFAGKPLVSAAMLRFEGQ
    CTVFDFRDKENSPCYRCLFPEPPPPGLVPS
    CQEAGILGSVGGIMGSIQATEAIKLLLGIGEPLVGKLLIMDALSMDFRKV
    KLRKDPKCPLCGENPKIKELIEYDQSCEVRF

    >gi|15606544|ref|NP_213924.1| hypothetical protein aq_1343 [Aquifex aeolicus VF5]
    MRVIYKFLFIVFIFLIACSSGEEKSQVQEAKSIIPKNKYALLIVESKSCIYCAQLKKDIKTEKRLQEALKGIDIYTLLYE
    SYEPVKTNIGGKVEVLSEKELARKLKATSFPNLIFYDKNGNLILQIPGYLPPEKFACVINYVKKEEFKKERLEDYIKKCA


    >gi|15606617|ref|NP_213997.1| cation transporter E1-E2 family ATPase [Aquifex aeolicus VF5]
    MRKAFKVYGMSCVNCARAIEITLKRTEGVKNVNVSFELGRVEVEFDEDLISEEEIVKKIEELGYSVERKKDYDKLFLGLG
    VLSSLFFLVGMFFTFPLKYELQFLLSSIVQFTAGWKFYRGAYSSLKKGIGSMDTLVALGTTGAYVYSVLSYFNLINSTPF
    FETNVFLITFVRLGKFIEEKAKERAVKGLKELVNLSFRKVKVLEGEKEVEKNVREVFKGEKVVYRSGEQILLDGVIIKGE
    GLVNEAVITGEPVPILKKEGDEVYSGSVLEKGYIITKVTKTFESSFINTMKKLVEESLKEKPKIQRISDKVSHYFVLFVV
    ILSVITFLTWFIKTGEINRAVQFSLAVLVVSCPCAFGIAVPLAVSVGIYKAVKRGILPKKGTIFEVAPKVDTVIFDKTGT
    LTEGKLKVKEINVPEKYFDVLYSMENYSNHPVAKAVREYLKPYVKREAKLEGCEEILGVGVRCGEFIAGKAELWGKNSQN
    GVIRVGFGTKDKLIGEIILEDSVRKEAKEVVEFLKGKGINVILLTGDTKENAQRIAKELGIKEVIANVKPEEKLKVVKEL
    QEKGRKVCMVGDGVNDAPALAQSDLGIAVAEGTDLAKLSGDVVIHKLSSLPQVFTLSERVYRKIKENFFWAFAYNVTFIP
    IAAGVLWSKGIYLKPEFAGLLMALSSVSVVLNTLRLLKD

    >gi|15606652|ref|NP_214032.1| O-6-methylguanine-DNA-alkyltransferase [Aquifex aeolicus VF5]
    MSTERRREVISGTSAQIALIILRKITIRGAELQDLPEERYVKSVYSLKSQTKKTVIPITVLKTALTPSLSLEIFFDKGKI
    SKISILKKKEQKIIPEFLLYFLKEGDPLINLEYLDLKRINPKCIKVYLKLKEVASFGKIITYGELARLTDLHPRFVGYCM
    KINPFPVIIP
    CHRVISKRDLGGFNQGIEIKSELLKHEGLIL

    >gi|15606719|ref|NP_214099.1| hypothetical protein aq_1599 [Aquifex aeolicus VF5]
    MGKMKKYLAVALAVVSFGGLSFGVDEALIKKYDKMFSQMTQETLAKSPCRVTPKQVVEMIKKGEDVVLLDIRTEAEQSIV
    GLTYKNSLHIPMDKLFKPENLKKIPRDKKVIVI
    CRSGARAIAATFALRSAGFDNVYALKGGIAALADYVTPKTTLGIK

    >gi|15606771|ref|NP_214151.1| hypothetical protein aq_1669 [Aquifex aeolicus VF5]
    MRVLKILLFIIFFSFGVEAVPFEKISFLNLKEDLEEAKKEGKYLFIMFEQEECPFCDKMKRVTFQDPRVREYFTKHFYMV
    RIDIKGSNPVVYFDGTEMTEKELAHKFRVRATPHFVFFDHEGKKILSIPGYIPPEEFLLIGKYVAEGYYKKMSYFKFKRM
    IKKD

    >gi|15606812|ref|NP_214192.1| hypothetical protein aq_1740 [Aquifex aeolicus VF5]
    MRRAIGFLLIVITFTFASLYEEFVKEQVKELPLDKAVVVGTGKKELIIFVNPDCPHCRHEWKSLREHLDKLKIYVFVVPF
    KAWGEDNLKKAYYIVCSQNPEKALDEVLTGKVDGKNLNPPTCELLNYHLKAADIVGLRGVPLNIIPDKGKVIEGASPKLL
    EELGITSAGSRD

    >gi|15606854|ref|NP_214234.1| thiosulfate sulfurtransferase [Aquifex aeolicus VF5]
    MRGVILFLLFFTLSFAKIYLISPEELHKLIKEEKNLVIIDLRKSIKEYWKEHIPGAQWVHFEAFRFPKGGTPAFFLHTEI
    FVKKLEKLGIDKNTPVVLYDAEGTFIPFYVAWGLDYINHKKVYVLHGGFNHWKDKDLPTTKDYPKVKEKRYGKYTINKSI
    RADLDYVKKALNREDVVFLDARTPELYEGKAGFWKRLGHIKGAVNRFWKQDFEEHVNKYGKKYYLLKPKEDISLFYESLG
    IGKGKEVILY
    CGQGLMSAATYYVIKYYLGLTDKVRLYDGSWNEYSQTNLPKEP

    >gi|15606862|ref|NP_214242.1| thioredoxin [Aquifex aeolicus VF5]
    MLALRFFLIFLMFLSVTFSQEWFADFDKGVNTAKKEKKLVLIYFYSDHCPYCHQVEEFVFGDEDVEKFLNKNFIVISVNI
    NSNLSEKFDVFGTPTFVIYDPLRGKVLAKFFGSLDAQTFLSMLTRVCNKSSVRRC

    >gi|15606896|ref|NP_214277.1| hypothetical protein aq_1857 [Aquifex aeolicus VF5]
    MQEQAQQFIFKVTDKAVEEIKKVAQENNIENPILRIRVVPGGCSGFQYAMGFDDTVEEGDHVFEYDGVKVVIDPFSMPYV
    NGAELDYVVDFMGGGFTIRNPNATGSCGCGSSFSCG

    >gi|15606934|ref|NP_214315.1| thioredoxin [Aquifex aeolicus VF5]
    MAGRVIELNEQNWEQEVLQSDKPVLVDFWAPWCGPCRIIAPIIEEIAEELGDKVKVGKLNTDENPNIAMRYGIRAIPTII
    LFKNGEVVDTRIGVQPKERLNKWFLSTFNNLWRLRPVLIPLLKPHVTSFGGPPPRKSFS

    >gi|15607050|ref|NP_214432.1| thiol:disulfide interchange protein [Aquifex aeolicus VF5]
    MKKLSFILLSAAFVYASCPEPSKFEEKLKEITQREWKVQAVSEVKDLGLCQVVVKRGLEPLVIYMDKDMNYLITGNVIDL
    KNGKNLTAETVRKYAKVSPEVLKELEKMTDLKFGKGDKYVYFISDPH
    CPYCNRLAPILKNWADKNDVQIRVIFYPLPFHK
    GADEKAASLICKKDVKYEELHTKDKPEKVCEEGMEKVKKNVEYLSKLGVTGTPTLIGMNGKVLVGLPRSEKQLDELVK

    >gi|15607089|ref|NP_214471.1| hypothetical protein aq_2146 [Aquifex aeolicus VF5]
    MEKKPNRLIKEKSPYLRQHAYNPVDWYPWGEEAFKKAKEEDKPIFLSIGYSTCHWCHVMEKESFEDPEIAEILNNYFVPI
    KVDREERPDVDAFYMSVCQAMTGTGGWPLTIIMTPDKEPFFAGTYIPKEGMFGRPGLRDLLLTIRELWEKDRTKILNTAK
    HLVKALQEASRETQKAQIGEETIHRAFSELFSSYDEHFGGFGSAPKFPTPHNLMFLGRYYYRYKREQALKMIEKTLTNMR
    MGGIYDHVGFGFHRYSTDREWILPHFEKMLYDQAMLLFAYTEGYQLLKKDLFKQTVYEIVDFLKRDMLSPEGAFYSAWDA
    DSEGEEGKFYTWSFEELKEVLDPEELELAVKVFNLSQEGNYLEEATKVKTGRNVLYIGKSYEELAKELGISEKELKEKLE
    RIRKKLFEAREKRVKPLRDEKILTDWNGLTIAALSYAGKVFGEKEWIDLAKGAADFVLKNMRTENGLLLHRYMEGEAKYW
    GFLEDYAYFIWGLMELYEATLDSKYLEEVIKLQEIQIKHFWDKENGGFFQTPDFFTEIPVRKKEVYDGAIPSGNSVSAYN
    LIRLGRLISRSEYEKYGTKTLEAFSWEIANFPSAHTFSIIALDLIVNGTKELVIVPTDDSWRNLKAQLDKEYLPDLLILK
    KDKVIEKLSENLEQMKPVEGKTTYYLCRNYTCESPQIQSDKVLERIKGKGKG