Methylobacterium nodulans ORS 2060 uid59023

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|220914676|ref|YP_002489984.1| DSBA oxidoreductase [Methylobacterium nodulans ORS 2060]
    MDRIRIEFFHDVVCGWCFVLSPRLKRIAADLPVDIEHRCFVLQDSPAEMERVFGSLPRAKEVILGHWVQCAAADDIPGRI
    NIEGMRRQSFAYPSGLAGTLACKSAERQGGSTAHGALFDRIQAAHLTENRNIADPRVLTDCAAAVGLDMARFEADMADPA
    TRELVEQDRARARALAIRSIPSLVIGQRVISSTLPYHELRRRILACAASTPSVAC

    >gi|220914731|ref|YP_002490039.1| heavy metal translocating P-type ATPase [Methylobacterium nodulans ORS 2060]
    MNAPVRPADLSSASISLPIEGMTCASCVGRVERALKAIPGVETVSANLATERASITTNAPVDRSKLVGAVENAGYSVPAA
    FSAPASSIELSVEGMT
    CASCIGRVERALKAVPGVTQASVNLATERATIEGSADSGALIAAIEQAGYGATVIGKAVNAGGQ
    DDTAEQAEKKETERRELKRDFTIAAVLTAPVFVLEMGSHLIPGVHGAIDATIGMQWSWYIQFALTTLVLFVPGIRFYEKG
    LPALWRLGPDMNSLVAVGTLAAYGYSLVATFAPAFLPPGTINVYFEAAAVIVTLILLGRLLEARAKGRTSEAIKRLVGLQ
    AKTARVRRDGKTVDLPIASVAAGDIIEVRPGERIPVDGEVTEGESYVDESMITGEPIPVSKALGSEVVGGTVNQKGAFAF
    RATAVGGNTVLSQIIRMVEEAQGSKLPIQAMVDKVTMWFVPAVMAVAALTFAAWLYFGPSPALTFALVNAVAVLIIACPC
    AMGLATPTSVMVGTGRGAELGVLFRKGEALQLLKDSKVVAVDKTGTLTEGKPALTDLELAIGFDRKAVLGLVAAVEAKSE
    HPIARAIVEAAHNEGLELPMVSGFESVTGFGVKATVDGKPIEIGADRYMAELGHDVAGFATVAERLANEGKSPLYAAIGG
    KLAAIIAVADPIKETTPPAIRALHDLGLKVAMITGDNARTAKAIAARLGIDEVVAEVLPDGKVEAVRRLKSQYGKVAFVG
    DGINDAPALAEADVGLAIGTGTDIAIEAAEVVLMSGSLQGVPNAIALSKATIGNIRQNLFWAFAYNTALIPVAAGVLFPA
    FGILLSPVFAAGAMALSSVFVLGNALRLRRFKVAH

    >gi|220919735|ref|YP_002495038.1| alkylhydroperoxidase-like protein, AhpD family [Methylobacterium nodulans ORS 2060]
    MPRTAVPNPEQVSADSKRALDMFTNNIGFTPNMLATFAQSPIAFNAWATLRGSLSKSLDLKTRESISLAVSEVNGCNYCL
    GVHSHGAELVKMPADEIILARKGRASDPKRDAAVQFARKVIETRGQVRDADVKAVCDAGYTDANVMEIVALVAMYSLTNF
    FNNVFDPEKDCSGRFVSGVSRASFRDRMTGMRLIPTLIDQNPWAQARKPMEMMRQGWSMSLFQAWQQ

    >gi|220919741|ref|YP_002495044.1| alkylhydroperoxidase-like protein, AhpD family [Methylobacterium nodulans ORS 2060]
    MARTTALNPEQVPADSRPTLDAFTKNIGFTPNMMATFAQSPIAFNAWATLLGSLSKALDVKTRDSIGLAVSEVNGCNYCL
    TVHSFTAEHMAKLPANEIILARKGHASDPKRDAALQFARKVIETRGKVSDADVKAVRDVGYTDANVMEIVALVAMYSLTN
    FFNNVFDPEQDFPAVTPAGSI

    >gi|220919935|ref|YP_002495238.1| uncharacterized peroxidase-related enzyme [Methylobacterium nodulans ORS 2060]
    MNSRTNAPIGRYPVSTLSDMPADIRDRLLAVQEKSGFIPNVFLVFAHRPDEFRAFFAYHDALMDKPSNLTKAEREMIVVA
    TSNANQCQY
    CVVAHGAILRIRAKNSLIADQIAVNYRKADITARQKAMLDFAMKVALEAYAVGEDDFSTLAQHGFDAEDAW
    DIAAISSFFGMSNRMANVTSLRPNDEFYTLGR

    >gi|220920064|ref|YP_002495365.1| glutaredoxin-like protein [Methylobacterium nodulans ORS 2060]
    MTDINTRIENEIKSQDVVVFMKGTPQFPMCGFSGQVAQILNYLGVDYKGINVLEDMEIREGIKAYSNWPTIPQVYVKGEF
    VGGCDITREMFQSGELQQLLAERGIAVKTAAA

    >gi|220920065|ref|YP_002495366.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium nodulans ORS 2060]
    MRDVIIVGGGPAGLSAALVLARCRRTVLLIDAGHPRNAVTARMNGYLGHDGCPPGELRATARAELARYPSVECRDGEATD
    ARREEDGFTVVLADGRTERARRLILATGLATELPPVEGFAEFWGHGVHH
    CPYCDGYENRDAPVVVYGRGGSGKGLALELT
    SWTRDLVLCTDGPAEELSASDRDRLARQRIRIDERPVARLEGEDGRPVRLRFADGDALPCRALFFAPAACAPSPLVERIG
    CDLTPKGTVPTRDYEQSNVPGLYVAGDASRRVQFAIVAAAEGAMAAFAINTELLQEDTR

    >gi|220920228|ref|YP_002495529.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Methylobacterium nodulans ORS 2060]
    MSATEESEGASPRRGLLFLLPLLVFAALAGLFLGRLLTTGYDPSAVPSALIGKPVPAFSLPALTGLTADGQPVPGLSSDD
    LKGKVTVLNVWASW
    CTPCQAEHPMLMRLSQDGVNLVGIDYKDAPENGRRFLGRHGNPFRAVGMDESGRTGIDFGVYGVPE
    TFVIGPDGRIRDKLVGILTPENYAGFLEKVRAAAK

    >gi|220920545|ref|YP_002495846.1| transcriptional regulator, AraC family [Methylobacterium nodulans ORS 2060]
    MKLPDPDPPVMRPDEAACRAALARRDPAADGTFVYAVRTTGVYCRPSCPARTARPENVSFYATCAEAEAAGFRPCRRCRP
    NEPGLAARQAEAVARACRLIEEAETPPSLDALSRTEGLSPYHFHRIFKRITGVTPKAYAAARRAARLESGLLRDAGTVTE
    AIFEAGYGTSSRFYAAAAARLGMTPTAYRRGGAGTAIRFAVAACSLGAVLVAATQKGVCAIMLGDDPEALVRDLQDRFPR
    AELTGGDAEFETVVAQVVGLVEAPGTARFDLPLDINGTAFQQRVWQALRAIPPGRTATYTQIAQAIGEPKAVRAVAQACG
    ANPLAVAIP
    CHRVVRHDGALSGYRWGVARKRDLLARESTTTRDEAQGDLALDGK

    >gi|220920745|ref|YP_002496046.1| Heavy metal transport/detoxification protein [Methylobacterium nodulans ORS 2060]
    MAHQGQGPAGDRVELLMQVEGMTCAGCVEAVTRAIRRLDPEAAVAVDLGQGRVSVTTDAQAIDVAQVLQRAGYEARAMTG


    >gi|220920842|ref|YP_002496143.1| alkylhydroperoxidase-like protein, AhpD family [Methylobacterium nodulans ORS 2060]
    MLNDWSTYRSNLMSTLKEIGQISPDLIAAHDHIASAAPREPKLDAKTRELIALAVAVTTRCDGCIAVHSEAARKAGASKE
    EIVDALGVAIALNTGAALVYTARAFDAFTKGAS

    >gi|220920846|ref|YP_002496147.1| cytochrome c biogenesis protein transmembrane region [Methylobacterium nodulans ORS 2060]
    MTLFVISYLAGVLTILSPCILPVLPFVFARSDQPFSRSTLPMLIGMVATFASIATLAAVGGSWAVHVNEAGRAVALALLA
    LFSVTLLSRRAAAVLTAPVVRLGSDLSDRAGRQAAGAAGSSLLLGMATGLLWAPCAGPILGLVLTGAALRGADVETTLLL
    ATYAAGAATSLAVAALAGGSVLAAMKRWLGVGERLRQGLGLAMLAALAAVALGSDTGLLARLSFATTTKLEQALVDGLGG
    ATASTGAVQDADAARSADATPGRYRSRLPVEGRFPSLDGAVQWLNGGPQTVYQLRGKVVLVHFWTYS
    CINCIRTIPFVRA
    WAETYRDKGLVVIGVHAPEFAFERNLDNVSSAIQKFSLSYPVAVDNDFRLWRAFRNSYWPALYFIDAEGRVRHHHFGEGE
    YARSERVIQDLLAEAAGHRNADARLTAPGAHGAELAPDLRRLRSGETYLGHAKAENFVSPEGVEPDAARDYTSGQPRLNE
    WSLAGNWTVLPEQAGLNRAGGAITYRFRARDLHLVLGPGPAGRPVRFVVTLDGEAPGADHGADVDRSGHGVVSEARLYQL
    VRQTGDVGERTFAIRFLDPGVEAFAFTFG

    >gi|220920979|ref|YP_002496280.1| conserved hypothetical selenoprotein [Methylobacterium nodulans ORS 2060]
    MTNASAGKPRVAITYCTQCGWLLRAGWMAQELLSTFKDGLGEVALIPATGGAFSITCGDVLIWERVRDGGFPDVKTLKQR
    VRDVVEPGRDLGHVDRG

    >gi|220921072|ref|YP_002496373.1| methionine-R-sulfoxide reductase [Methylobacterium nodulans ORS 2060]
    MGAFETAKDEAARSEEEWRERLTPEQYRVLRGHGTERAGTSPLNHEKRPGTFLCAGCGQPLFESETKYESGSGWPSFFAP
    IEGAVETQVDRSFFMTRTEVHCQRCKGHLGHVFDDGPAPTGLRY
    CMNGAALQFEPRE

    >gi|220921138|ref|YP_002496439.1| dihydrolipoamide dehydrogenase [Methylobacterium nodulans ORS 2060]
    MSYDLVVIGTGPGGYVCAIRAAQLGLKTAVVEKRATHGGTCLNVGCIPSKALLHASEAFEETTKHLPVMGISVGEPQLDL
    PQMMAFKQEGVDGNTKGVAFLLKKNGVESFQGVGRLAGAGRVEVRLEDGGNHLLETRNIVIATGSDVANLPGVTIDEEVV
    VSSTGALDLTKVPEKLLVIGAGVIGLELGSVWRRLGSEVMVVEYLDRILPGMDGEVGKQFQRILEKQGIKFRLSSKVTGV
    ERTNVGAKVRVEPASGGTAETLEADVVLVAIGRVPYTNGLGLETVGVQLDNKGRILTDNLYATNVTGIYAIGDVIAGPML
    AHKAEDEGVAVAEILAGKAGHVNYGVIPNVVYTAPEVASVGMTEEELKKDGIAYKTGKFPFTANGRAKVNQTTDGFVKVL
    ADAGTDRVLGVHIVGADAGNLIMEVAVAMEFGASSEDIARTCHAHPTLTEAVKEAALAVEKRALHM

    >gi|220921148|ref|YP_002496449.1| peptide methionine sulfoxide reductase [Methylobacterium nodulans ORS 2060]
    MLFFRKRAEMPAPDQILPGRPTPLPTAERHFVNGRPLKGPYPEGIETALFGLGCFWGAERKFWQLGDGIWVTAVGYAAGT
    TPNPTYEEVCTGLTGHNEVVLVAYDPAAMPFERLLKTFWESHDPTQGMRQGNDVGTQYRSGLYVADAERRAQAEASRDAY
    GEALRAKGYGPITTEIRDPGPFYFAEAYHQQYLAKNPAGYCGLGGTGVACPIGTGVRNAAE

    >gi|220921156|ref|YP_002496457.1| OsmC family protein [Methylobacterium nodulans ORS 2060]
    MDAAALRALQAPIKDRYRTDPDAAIITLKAQGSLDDTAIACKVETGRALAVAGLHPASGGSGAELCSGDMLLEALVACAG
    VTLKAVATALEIDLRKGVVKAEGDLDFRGTLGVDKGAPVGFRAIRLAFEVESDAPQEKIDQLLKLTERYCVVFQTLSHRP
    ALDVTLTRG

    >gi|220921173|ref|YP_002496474.1| OsmC family protein [Methylobacterium nodulans ORS 2060]
    MSTYTADVTWTLKEGEDFASGRYSRGHTLSFDAGMTLPGSASPHVVGRWAVKEAVDPEEMLTAALSSCHMLTFLHLARQA
    GFRAMAYRDHAEGVMGEIAPGRQAVTRVTLHPRIEWSGPAPDAESLAQLHHAAHEG
    CFIANSVRTEVVVA

    >gi|220921576|ref|YP_002496877.1| DSBA oxidoreductase [Methylobacterium nodulans ORS 2060]
    MPLTIAVFSDVICPWCYLGKRRLERALDQLGLRETAAVEWLPFELNPDMPAEGMERALYRARKFGAERSAQLDAQMAELG
    RQDGISFAFERMTRTPNTRRAHMLIAAGMHVGRADPVVGALFRAYFEEGRDIGDSDVLLDIGVAAGLDRDLVVEALCSEK
    LTQLVENIEQQAAQMQVTGVPFFIVDRKWAVSGAQPTEQWVEMIQNRQND

    >gi|220921617|ref|YP_002496918.1| thioredoxin [Methylobacterium nodulans ORS 2060]
    MATVKVTDASFKQDVLEASEPVVVDFWAEWCGPCRAIGPALEEISSEMQGRVKIAKVNVDENPGIASEYGIRSIPTLMIF
    KDGKLASQKVGAAPKGDLSRWIQSTSA

    >gi|220921774|ref|YP_002497075.1| glutathione peroxidase [Methylobacterium nodulans ORS 2060]
    MPIARRDALILFGGLLASPLAAEAAGAVSQNAVTAAAFGFDRADGTRLALADLAGKPILVVNTATACGYAPQFAGLQQLW
    TRFGSRGLTVIAVPSGDFGHQEPLDGQAIVEAARNNHGVTFPVVAKTSVIGPNAHPFYRWAAGERPGETPRWNFHKYLVG
    RDGHLSGAFATPVEPTDPRIITAIARELDPQAG

    >gi|220921852|ref|YP_002497153.1| protein of unknown function DUF1223 [Methylobacterium nodulans ORS 2060]
    MTCAASHWLLLVLLLGGSFPAAAGDAPRAVVELFTSQGCSACPPADRIIGDLSRDPSVIALSLPVTYWDYLGWKDTLARA
    AFTERQRAYAGVRGDRQVYTPQAVINGALAVVGSDRNALEHTIRDPGTAVSLPVPIRSELEGDRIRIDIGAAPDAGRKAE
    LWLLPVARAREVAIARGENRGKTVTYRNVVRGMHHVGSWSGAPAHYEVPRTILQSGDADTYVLVLQAEYGGPGRILGAAK
    GPGL

    >gi|220922155|ref|YP_002497456.1| iron-sulfur cluster assembly accessory protein [Methylobacterium nodulans ORS 2060]
    MTEITLTPRAARRINEIMGAEPPGSMLRISVNGGGCSGFQYAFDIARDRAGDDIAVERDGATVLVDPLSLEYMRGSTIDF
    VNDLIGQSFKIENPQATASCGCGTSFSL

    >gi|220922711|ref|YP_002498013.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacterium nodulans ORS 2060]
    MALQIGDTAPDFEAETTAGRIRFHDWIGQSWCVLFSHPKDFTPVCTTELGYMAKIKPEFDKRNVKIIGLSVDPVESHARW
    VADIEETQGFSPNYPMIGDSDLQVSKLYGMLPAGTSGTSEGRSPADNQTVRNVFVIGPDKKIKLILVYPMTTGRNFDEVL
    RVIDSLQLTAQHRVATPVNWQQGEDVIIAGSVSDEEARRIYPQGWKAPKPYIRIVPHPAA

    >gi|220922811|ref|YP_002498113.1| Glutathione S-transferase domain protein [Methylobacterium nodulans ORS 2060]
    MTEPLRLYYSPGACSLAPHIALEETGAPYEAVRVNLAAGEQREPSYLAVNRKGRVPALAEGDWVLTENPAVLRYIAQRFP
    AAGLWPEDPRAEARCAEWLAWIASTVHVAYAHVRRAERYASGEAAIAEVQAKGRETCLDLWSMVEAGLSRGGWALGERYS
    VADPYLLVFWTWGRGPTLGYDMARQFPRWTDHARRMAARPAVQRAFAREGLALPE

    >gi|220923249|ref|YP_002498551.1| FeS assembly scaffold SufA [Methylobacterium nodulans ORS 2060]
    MVKSFKVMTLTEAAADRIKRIIAEADRPIAGVRVGVKNGGCAGMSYTMEYAEEQRPGEDVVEDRGVRVFVDPKAVLFLLG
    TEMDFQTTKLASQFVFNNPNQTSACGCGESVAITPAKPEALQAAGA

    >gi|220923400|ref|YP_002498702.1| selenide, water dikinase [Methylobacterium nodulans ORS 2060]
    MNAEPVRLTSLAHGGGCGCKLDPAILRSLLARQPASGAFDRLLVGNETADDAAVWALDDGTCLIATTDFFTPMVDDPYDF
    GRIAATNAISDVYAMGGRPLLALAILGVPVGKLPPEIVARILDGGASLCAEAGIPIAGGHSIDTPEPIYGLAVIGTCRRE
    QVRRNSDARAGDRLILTKPVGVGVYSAAIKRSGLGEDGYAEFVATTTLLNRVGADLAADADIHAMTDVTGFGIIGHGLEL
    ARGAGLRVVIEAGVVPLLTQAETLARDGFVTGASHRNWSAFGGDVSLPEGFPDWRRHLLTDPQTSGGLLIACAERSAAAI
    RDRIRTVGYPAAAIVGRVEAGPAGLRVEAPTDRAPSATA

    >gi|220923578|ref|YP_002498880.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Methylobacterium nodulans ORS 2060]
    MSRRFDAIIIGAGQAGPSLAGRLTAAGQEVALIERHLFGGTCVNTGCMPTKALVASAYAAHLARRAADFGIVVPGPVGID
    PKAVAARQQAVSATARANVERWLRGMPGCTVITGHARFHGPHAVAVNGEVLEAARIFINVGGRARVPDLPGLDRVPFLTN
    TTMLQLDSLPEHLVVVGGSYIGLEFAQIYRRFGSAVTVVEQGPRLIGREDPDVSEAVADILLREGIQLRLNAACIRLSPR
    DGGIAVGVSCEDGPPEVVGSHVLLAVGRQPNTDDLGLEAAGIATDAQGSITVDDELQTNVPGIYALGDCNGRGAFTHTAY
    NDFEIVAANLLDGARRRVSERIPGYALYTDPPLGRVGLTEAQVRARGRPALIGTRPMTRVGRAVEKSETLGFMKVLVDAE
    SRALLGAAILGTGGDEAVHGILDMMNAGAPAPMLQWAVPIHPTVSELIPTVLGGLRPLA

    >gi|220923611|ref|YP_002498913.1| alkylhydroperoxidase-like protein, AhpD family [Methylobacterium nodulans ORS 2060]
    MTPRLRNPHKLAPEGIQAMLALEASFKAGPLEHRLMELVKMRASQINGCAFCIHMHATDARRHGETEMRLYMLSAWRESS
    LYSPRERAALAWTEALTRVAETGAPDADYALLAAEFSEAEQVRLTLLIGAINVWNRLQVGFRVPHPAEAPRDAA

    >gi|220923832|ref|YP_002499134.1| thioredoxin [Methylobacterium nodulans ORS 2060]
    MPTVMVTDASFKQDVLEASEPVVVVFWAEGCVSCQAISPALEEISSEMQGRVKIAKLNVDENPGIVSEYGIAGVPTLMIF
    KDGKLVSQKFGALSKGALLRWIQSASA

    >gi|220923888|ref|YP_002499190.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacterium nodulans ORS 2060]
    MLGIGYTLPVFEIVGVKPGFIYHQENGIPALKPLTLDSFPGKWKVIFFYPKAFTFVCPREIAEFAKLAPEFENRDAVVLG
    GSTDNEHVKLAWRRDHKDLDRLPIWSFADPWDALVDGLGVRSPEGVAYRYTYVVDPDNVIQHVYATNLKVGRAPKDTLRV
    LDALHTDEPAPATARSAVAS

    >gi|220923904|ref|YP_002499206.1| iron-sulfur cluster assembly accessory protein [Methylobacterium nodulans ORS 2060]
    MISLTDNAVSAVKNALSQASGAPTGLRIMVEAGGCAGFKYMILLESTQRRGDLVIEQDGVRLFVEGRSQSLVSGLRIDFV
    TALNNSGFVFENPNAASKCACGKSFG

    >gi|220924391|ref|YP_002499693.1| uncharacterized peroxidase-related enzyme [Methylobacterium nodulans ORS 2060]
    MAGAKTKEKRGDKPEVGEMPRRQEAEGAVMALDLDPAADLPPHLAAYFDKCREKIGFVPNVLLAYAHDTAKLDAFVTFYN
    DLMLAPSGLSKLEREMIAVAVSSINRCYY
    CLTAHGAAVRGLSGDPVLGEMMAMNYRAADLSPRHRAMLDFAVALSEAPWT
    VEEEDREALRDAGFTDRDIWDIAAVASFFNMTNRMASAVDMRPNRSYHGDARALPET

    >gi|220924534|ref|YP_002499836.1| glutathione-disulfide reductase [Methylobacterium nodulans ORS 2060]
    MGNGAATDDFDVDLFVIGGGSGGVRAARIASSYGATVKLAEEYRVGGTCVIRGCVPKKLMVYAGRFADEFEDAAGFGWSV
    ESPRFDWATLKRNRDAEVTRLEGIYTTNLMRAGVDLVADRAVIEDAHTVRLVRSGKTVRARFILIAVGAHPVKEPAIPGG
    ELGITSNEVFELERQPERILIVGGGYIAVEFAGIFAALGSRTTLLHRGDRLLRGFDDEIRDALGAAYARRMDLRLNRTIE
    RLDRRDGAILATLSDGTDLLVDQVLVATGRRPNVQGLGLEKVGITLDTAGAIPVDRFSQTAVPTIFAVGDVTNRAALTPI
    AIREGHAFADTVFGGKPWAVDHDLIATAVFSTPEIGVIGHNEDVARALYGDIDVYEARFRPMKATLSGREDRILMKVVVA
    RESDRVVGVHVLGHDAGEIIQAVAIAVTMGATKADFDRTIAVHPTAGEELVTLRTPLAVKQPVGVG

    >gi|220924610|ref|YP_002499912.1| UBA/THIF-type NAD/FAD binding protein [Methylobacterium nodulans ORS 2060]
    MTSLTPDEIERYARHIVLRDVGGPGQARLKAARVLVVGAGGLGAPLLQYLAAAGIGTLGIVDDDTVSLSNLQRQVIHGTP
    DIGRPKVESAAEAVRRLNPHVRVETQALRLTEGNAEALIAGYDLVADGSDNFSTRYTVSDACFRAGKPLVTAALGQFDGS
    LTTIRAHENGPDGRPNPTYRCLFPEPPPAGAVPT
    CAEAGVLGALAGLMGSLMALEVIREITGFGEGLVGRLLMVDARSLR
    FETLAYAWDPANPLSGTAARRSS

    >gi|220924630|ref|YP_002499932.1| OsmC family protein [Methylobacterium nodulans ORS 2060]
    MPVDVKYTTQATATGGRDGRAKTADGSFDVKLTTPKELGGGGGEGNNPEQLFAAGYSACFLGAMKFVAGQEKIQVPADAT
    VTATVGIGPRSEGGFGITANLKISLPGLDRATAQALVEKAHQV
    CPYSNATRGNVDVGLQVV

    >gi|220924706|ref|YP_002500008.1| protein of unknown function UPF0061 [Methylobacterium nodulans ORS 2060]
    MLRHPSAKARSAMTIPFDNSYARMPERFFARIDPTPVPAPRLIRLNRDLARMLQLDPDWLASPEGLAVLAGNRVPAGAEP
    IATAYAGHQFGHLVPQLGDGRAILLGEVVGRDGIRRDIQLKGSGPTPFSRRGDGRAALGPVLREYIVSEAMAALGIPTTR
    ALAAVATGDRVVRERLLPGAILTRVASSHIRVGTFQYFAIRGDAEGVKRLADHVIARHYPEIAAEEHPYAALLSAVIARQ
    AALVAQWLCVGFIHGVMNTDNMSVVGETIDYGPCAFLDAYDPAAVFSAIDEHGRYAYGNQPMIAHWNLVRLAETLLPLLA
    AETEEAIRVAEERLAGFAPLFQAAYQAGLRRKLGLFTARDDDVVLAGDLLTAMAANRADFTLTFRRLGAAAADPARDGPV
    RDLFIDPTVYDAWAARWRQRLATEPQTADERRRAMDRANPAYIPRNHRIEAVIEAAVERDDFAPFAELLTVLAGPYEDQP
    DFARYAAPPEEHERVHRTF
    CGT

    >gi|220924864|ref|YP_002500166.1| thioredoxin [Methylobacterium nodulans ORS 2060]
    MPTVMVTDASFKQDVLEASEPVVVVFWAEGCVSCQAIGPALEEISSEMQGRVKIAKLNVDENPGIVSEYGIAGVPTLMIF
    KDGKLVSQKFGALSKGALLRWIQSASA

    >gi|220924882|ref|YP_002500184.1| Redoxin domain protein [Methylobacterium nodulans ORS 2060]
    MPLTERLIGDPAAEIRVQTYLKGTPIAALAQGCVHVVVFWETSCGPCTASIPRLTELQRRYPDVVFLGVAVNWTDFGELE
    AFVRDQGDAIGYRIAADLPLSPGERQGTMYRTWYKAAYETGVPSAFIIDRDGRIAWIGPPWDIDDPLAAVVEGRWDLAAA
    REEQEATLRRDKVRELWSLEETVERHLAAGDRTGLLQAYDTAFAADPGLEPLHGLHKFALLLLSARDEAALDYARHLIGA
    VVADQIDPLIQLGLMLAGAAEQGTEAPDWPPAATVRIGDLLIYLLSTMPAKAVEQGTEAPDWPPAAANLALTAITQAEAL
    FNEETHPRLRMMLAEAAARALLVVGRTGEAADRARAARALAPAFALASDTELAAIISQLDQFVAHCDAAAGRGD

    >gi|220925035|ref|YP_002500337.1| thioredoxin [Methylobacterium nodulans ORS 2060]
    MLTDTPAAGQAPADALIKDTTTNGFRQDVMQESMRQPVLVDFWAPWCGPCKQLTPILEKAIKNAGGKVKLVKMNIDEHPQ
    IAGQLGIQSIPAVIAFQRGQPVDGFMGALPEGQVKSFIERLVGPLGPTQVEDLMAEAEAVAADGDAEAAAEIYSAVLAQE
    PGHAGAIAALAKLVLDRGDVEGARQFLDSAPPEAAKSPAVASVRAAIELAEQAAALGDLGALQRQVEADPSDHQARFDLA
    LGLNARGRQEDAVNHLIEIVRRDRGWNDDAARKQLLQLFEAWGPMDPMTIRGRRKLSSLMFS

    >gi|220925178|ref|YP_002500480.1| glutathione peroxidase [Methylobacterium nodulans ORS 2060]
    MTAIYDFSPAAADGTPHPLAAYRDHVLLIVNTASRCGFTPQYEGLEALWRRHRAAGLVVLGFPCNQFGAQEPGDADEIAR
    FCRLTYAVSFPVLAKVAVNGPGADPLFVYLKRARPGLLGTRSIKWNFTKFLVGRDGSVIGRYPPRTRPAALEGAIVAALR
    AAA

    >gi|220925209|ref|YP_002500511.1| Rhodanese domain protein [Methylobacterium nodulans ORS 2060]
    MTIVDWDREAVKRGLADGTVLLIDVREPDEFAQGHIPGSVSHPLSGFDLDRLQALIAEDGRRPVLSCAAGVRSARALAYA
    QSRGVPLTEHYAGGFKDWLGAGEPIE

    >gi|220925268|ref|YP_002500570.1| Glutathione S-transferase domain protein [Methylobacterium nodulans ORS 2060]
    MATLHHSTFCPHSRFIRLVLAEMGMEPVLAEERPWERREEFLMLNPAGTTPVLVEAGGLAIPGPGVIAEYLDETRGLGLS
    GRRLLPEAPGARVEVRRLLDWFLSKFDQEVTGYLVTEKIHKRFMTSNLGGGPPDMNAIRAARTNVRYHLKYIGYLIARRK
    WLAGDHLTYADLAAAAHLSCVDYLGDVPWDEDEMARNWYARLKSRPSFRSLLADRVPGMAPADHYADLDF

    >gi|220925521|ref|YP_002500823.1| arsenate reductase [Methylobacterium nodulans ORS 2060]
    MDVIIYHNPACGTSRNTLAMIRNAAIEPHVIEYLKTPPTRALLQQLLARAGLCVRDVLREKGTPYAELGLGDPTLIDEQL
    LDAIEAHPILLNRPLVVSPKGVRLCRPSEAVLDLLPPQQGEFVKEDGERVVDEYGRRVATA

    >gi|220925554|ref|YP_002500856.1| arsenate reductase [Methylobacterium nodulans ORS 2060]
    MDVIIYHNPACGTSRNTLAMIRNAAIEPHVIEYLKTPPTRALLQQLLARAGLCVRDVLREKGTPYAELGLGDPTLTDEQL
    LDAIEAHPILLNRPLVVSPKGVRLCRPSEAVLDLLPPQQGEFNKEDGERVVDEHGRRVVTA

    >gi|220925656|ref|YP_002500958.1| thioredoxin reductase [Methylobacterium nodulans ORS 2060]
    MSITHEKLIIIGSGPAGYTAAIYAARAMVEPLLISGFQPGGQLMITTDVENYPGFAQAVQGPWLMEQMRLQAEHVGTRIV
    SEYIAKVDLKQRPFRLEADSGAVYTCDALIIATGAQAKWLGLPSEAKFQGFGVSA
    CATCDGFFFRGKEVVVVGGGNTAVE
    EALYLANLASKVTLVHRRDAFRAERILQERLFRHPNIEVVWNHTVEEICGRESPAPSVTHVRLKDVRTGLISERKADGVF
    VAIGHQPATAIFEGQLPLRAGGYLTVTPGTTSTEIPGVFAAGDVTDDVYRQAVTAAGMGCMAALEAEKYLANLAIGETPR
    QAAAE

    >gi|220925781|ref|YP_002501083.1| glutaredoxin 3 [Methylobacterium nodulans ORS 2060]
    MQPVTIYTTSWCPYCTAAKSLLREKGAAFTEIDIEVKAGARREMIGKAGGRTSVPQIFIGSTHVGGCDDLYALDRAGRLD
    PLLAG

    >gi|220925808|ref|YP_002501110.1| hypothetical protein Mnod_5980 [Methylobacterium nodulans ORS 2060]
    MALAALLLASGAAAAPPPEPAGYREDDFRSPTPATLQGARVVTTEEAEALWRAGVPFIDVMPRPPRPAALPPGTIWRDPP
    HESIPHAHWLANTGFGALAPETEAYFRGALDRLTGGDKARPLVFFCLRH
    CWMSWNAAKRALSYGYTQVIWFPDGSDGWSD
    AALPLERLQPVPP

    >gi|220925870|ref|YP_002501172.1| DSBA oxidoreductase [Methylobacterium nodulans ORS 2060]
    MPPLPRLLPALALTGALALAAAPTRAEAPMTDAQRQAIEGVIRDYLLKNPEVLQEAMAELEKRQQEAQRQAQASALKETR
    DILHNAATSYTAGNPNGDVTLVEFFDYN
    CGYCKRALGDIQALMKSDPKLKVVLKDFPVLGPDSVEASKVALAAKQQLKGD
    KLFEYHTRLLETRGRVNGERAIAVAREMGLDIARLQKDMQSPDVQTALQENVGLGDKLGLSGTPAFIIGEEIIPGAVGAE
    PIRKTIAGVRQCGHATC

    >gi|220925878|ref|YP_002501180.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacterium nodulans ORS 2060]
    MPLNPGDPAPDFSLPATGGETISLTCLKGRKAVLYFYPKDNTSGCTLEAKAFNDLRDAFAAADTVVIGVSPDPMKSHDKF
    RDKYGLGFPLASDEEKAMLQAYGVWVEKSMYGRKYMGVERTTVLIDRDGRIAEVWPKVKVPGHAEAVLKAAKAL

    >gi|220926166|ref|YP_002501468.1| Rhodanese domain protein [Methylobacterium nodulans ORS 2060]
    MATGPFVSTDWLAERLDAPDIVVVDGSWYLPAMNRDAEAEYRAGHIPGAIRLDIDALSDETNPLPHMLPRPEVFASRMRI
    MGIGDGMTIVVYDGMGLFSAPRVRWMFKVFGARDVAVLAGGFPAWVAGGHPVEEGEPRSRDRRHFTVRLDHSAVADVADV
    QRALAGAAQVVDARSASRFAGEEPEPRPGVRPGHIPGALNVHYAALQEGGRFKDEGALRQIFREAGVDLDRPVVTT
    CGSG
    VTAAIISLALETLGRPPRALYDGSWAEWGSRQDLPVATGR

    >gi|220926289|ref|YP_002501591.1| dihydrolipoamide dehydrogenase [Methylobacterium nodulans ORS 2060]
    MSDTYDVLIIGAGPGGYVTAIRAAQLGFRTAVVDREHLGGICLNWGCIPTKALLRSAEIFHYMQHAKDYGLSAEKIGFDA
    TAIVKRSRSVSGRLNGGVGMLLKKNKVDVIWGEARIDAAAKGNAPGRVTVAESQRAEAPKGAKGPGIYQAKHIIVATGAR
    PRVIPGIEPDKRQIWTYYEAMVPEAMPKSLLVMGSGAIGIEFASFYRTMGAEVTVVELLPQILPVEDAEIAGLARKRFEK
    QGIRILTDAKVTKVQKGKDAVTATVEADGKSQTITAETLISAVGVVGNTENLGLEALGVKTERGIVATDGLGRTNVPGIY
    AIGDVAGPPMLAHKAEHEGVICVETIKGLPTHPMDKGKIPGCTYCQPQIASVGLTEAKAREQGFDIRIGRFPFMGNGKAI
    ALGEPDGLIKTIFDKKTGQLLGAHMVGAEVTELIQGYVVAMQLETTEEDLMHTVFPHPTLSEMMHESVLDAYGRVIHV

    >gi|220926594|ref|YP_002501896.1| uncharacterized peroxidase-related enzyme [Methylobacterium nodulans ORS 2060]
    MNSRTNAPIGRYPVPTLSDMPSDIRDRLLAVQEKSGFIPNVFLVFAHWPDEFRAFFAYHDALMDRPGNLTKAEREMIVVA
    TSNANQCQY
    CVVAHGAILRVRAKNALIADQIAVNYRKADITERQKAMLDFAMKVALEAYAVGEDDFATLAQHGLDAEDAW
    DIAAIASFFGMSNRMANVTSLRPNDEFYTLGR

    >gi|220926681|ref|YP_002501983.1| Redoxin domain protein [Methylobacterium nodulans ORS 2060]
    MTIQVGDHLPQATFRVMTADGPAAKTTDDVFKGRRVVLVAVPGAFTPTCHRNHLPGYVARRAEILSRGVDAIAVTSVNDV
    FVLDAWSKAAGAEGIEFLADGNGDFAKAIGLDMDGAGFGLGVRSKRYAMLVDDGVVRALNVEDSPSKAEVSGAETLLKSL


    >gi|220926934|ref|YP_002502236.1| dihydrolipoamide dehydrogenase [Methylobacterium nodulans ORS 2060]
    MSSTEVRLPDIGDFKDVPIIEVIVKPGDTIGVDDTLIVLESDKATMDVPSPVSGTVAEVKVKPGDKVSEGDLILMMTEAA
    GAGQPKPGITEKAAPAAPAGAPAGARAASGLPSHAPGEGQAGYGSSAVGGGDGATPPAPQAAAPVSGEEMRAEVLVLGAG
    PGGYTAAFRAADLGKSVVLVERWASLGGV
    CLNVGCIPSKALLHAAKVIDESHAMAAHGISFSSPAIDVDKLRGWKDGVVK
    RLTGGLGGLAKQRKVTVVTGTGRFVSPHQVAVEHEGRTRIIGFEQAIIAAGSEPIQMPFIPHDDKRVIDSTGALELDGIP
    KRLLVIGGGIIGLEMATVYHALGAKVTIVELMDQIIPGADKDIITPLMKRISKQYEAIHLKTKVTGVEALPEGLKVSFEG
    GSAPATDTFDKVLVSVGRRPNGKLIAAEAAGVIVDERGFIPVDKQMRTNVPHIFAIGDVVGQPMLAHKATHEGKVAAETA
    AGKNAFFDAKVIPSVAYTDPEVAWVGLTENEAKAKGIKVGKGVFPWAASGRSLSLGRDEGLTKVLFDEASDRILGCGIVG
    PSAGDLIAEAALAIEMGADASDIGLTIHPHPTLSETIGMAAEAFEGTITDLYMPKRPAH

    >gi|220927037|ref|YP_002502339.1| Redoxin domain protein [Methylobacterium nodulans ORS 2060]
    MSAPRLAVTPLRLALGGGALAAALALGAALYAARSGGNSDVCAAAAATAARVAPLARGEVAALQVDPAPRPAPALAFTGP
    DGEPRSLEDLKGRTVLLNLWATW
    CAPCKAEMPALDRLQGALGGPDFEVVALNVDTRNPDRPPAWMRENGIARLAYYSDPA
    GRALPVLQKSGEVVGLPTTILIDRAGCEVGVMKGPAEWASEDALALVRAALGRLQPG

    >gi|220927112|ref|YP_002502414.1| cytochrome c biogenesis protein transmembrane region [Methylobacterium nodulans ORS 2060]
    MRHVPSLLVAIAALAALPAAAQAPRINPKYADLVRAELVAEPGAVAAGQPFTVGVRLVMKPHWHVYWRNPGDSGLAPEIA
    WALPPGFAAGAIAWPVPARIPVSELVNFGYEGKTLLTATLTPPATLDTRSVTLRAKVSYLVCERECIPGEANVSATLPVA
    PPGTSVRPDPRQRDLFEAARAQLPQPSPWPSRVTAAGDTLTLHLDAPGLKGEAIRDVAFFPYSETVIEHAAPQDVSVDAG
    GLHLGLKRSSLNPSEPVERLDGVLALTEDTGSGPVRHAFALGEAPAQAVAAVSPPVSAPAAPEAPAGLWQAAFLAFLGGI
    LLNLMPCVFPVLSIKVLGLVRQAGESPGRVRLHGLAYTAGVLASFLGLAALLVGFRAGGAQIGWGFQLQSPLVVASLAYG
    LFALGLSLSGVVHLGGRFVGIGDGLTRRAGLEGSFFTGVLATVVATPCTAPFMGVAVGFALTQGATLSLAVFAALGLGLA
    LPFLLLTLWPAAIRRLPRPGPWMETLRGFLAFPLYATVAWLVWVLSQQVGPGGLFLALIGLVLVGFCAWMLERARQAGPW
    GRSLAQGAAVLGVLALGILVAALDRDRAQAVPVAVAGGPEPFTQARLDGLLAEGRPVFVNMTAAW
    CITCQVNERTSLSTA
    AVRQAFRARDVVYLKGDWTNQNPEITRVLEAHGRSGVPLYLLYRGPGDAQVLPQILTESTVLAALESLAPPRRAAALDAP
    ASAKE

    >gi|220927122|ref|YP_002502424.1| DSBA oxidoreductase [Methylobacterium nodulans ORS 2060]
    MPLSRRSLLAALLTAAPAARATEGQWFPLTGDDGRPVANTRLPGELASEIAELPGITWVGSAEPAVTLYEFFDFNCPWCR
    AAARDLSGLHAASPTLRIGLVHNPILSPRSAQAAKVALALQRRAGSGAAFALYGALLGRSGPIDGPRALEAARDLGHDRA
    ALEAEADSDLVGRALAGQMRLAANLGLSATPSYVVGTTALLGHPGGRTLARVLAAVETCDSVLCGAESPG

    >gi|220927201|ref|YP_002502503.1| copper-translocating P-type ATPase [Methylobacterium nodulans ORS 2060]
    MCCTDTALAYVEAHASWSEANTRPSLPRDYAAFVARETDGTSRAAFAVEGVRCAACMSAIERGVGALPGVAAARLNVTDR
    RLSVTWAPGAAPEVGAVLAALDGLGYRGHPFDPRQRRDPAAARETERLIRALAVAGFASMNVMLLAISVWAGNVSDMTPE
    NRDLFHWLQAVIALPAAAYAGRPFYEGAFRGLRAGRVTMDFPITLGVVLTLVMSVVETAMGAAHAYFDGAIMLLFFLLIG
    RVLDQTMRRRTQTLAENLAALRSENAAWIGADGSVREVLLADLSPGDAVLVRPGERVPVDGIIAQGRSELDRSLVTGETA
    PVAAGPGDTVHAGSLNASGALTVRVTAATRGTLLDEVEGLMRRALEAKSRALVLADRATRLYVPVVHAAAVLTFAGWLGL
    GAGFHAALMTAVAVLIITCPCALGLAIPAVQVVAAGALFRDGVLLNSGDALERFAAIDTVAFDKTGTLTLPEPVLAGHYD
    PAALALGARLARSSRHPMAAALSAAVPDALPCPGAEEAAGLGVRAMVDGVPVRLGSPRFCAAEDEAAQALARDPEASAIC
    LRAGEAAPVVFRVRQAPRPDAREVLQALRRSGYRVLILSGDRPEAVAAVADALAVAEWQGGLTPQEKIRRIEALGREGSR
    VLMVGDGLNDAPALAAAHASLSPVTAAHVSQAAADALFLGRSLAPVLAVLRSGRTARRLMLQNLWFSAAYNLVAIPLAAA
    GLLTPLIAALAMSGSSVVVTLNALRARRAPALPEAARR

    >gi|220927385|ref|YP_002502687.1| DsbA oxidoreductase [Methylobacterium nodulans ORS 2060]
    MITRRDALTLTGSALGAAVLLPGLSLRSLAQSPSVDALLQPGPLGDVWLGPADAKCTIIEYASMTCSHCAAFHKTTWPAL
    KERWIDTNKVRFTLREFPLDPLATAAFMLARADNSARYYPITDLLFDQQPAWAFVQKPLDALEQMMRQAGFSREKFEATL
    KDQKLYDGINAVKERGMNVFKVSATPTFFINGQKFQGELSIEGMEKVIKPIVGA

    >gi|220922814|ref|YP_002498116.1| electron transport protein SCO1/SenC [Methylobacterium nodulans ORS 2060]
    MSLSPALRRAAIPLLAFALGLAALGLVAVTMLGRPAVTASGVGGPFTLVNQDGKTVSEKDFAGRTHLVFFGFTHCPDVCP
    TTLQQISDVLAALGPKGRDMKVLFITVDPERDTPEALKQYLASFDPRIVGLTGSTDAVAGAVKAYRAYSRKVPLKDGDYT
    MEHTALVYIMDGANNFVGSLNLMRPASDAAAEVARRL