Methylobacterium chloromethanicum CM4 uid58933

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|218528096|ref|YP_002418912.1| glutaredoxin-like protein [Methylobacterium chloromethanicum CM4]
    MTDVNSTIKNEIDSQDVVVFMKGTPQFPMCGFSGQVVQILNYLGVPFKGVNVLDDMAVREGIKAFSNWPTIPQIYVKGEF
    VGGCDIAREMFQSGELQQFLSEKGVPVKSAA

    >gi|218528097|ref|YP_002418913.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium chloromethanicum CM4]
    MHDVIIVGGGPAGLNAALILGRARRTVLLCDASQPRNAATPLTWGLFTRDGTPPFDLRAKGRADLDRYETVECRDVAVTE
    AARDADGFTIIQADGTVERARRLILATGLAQDIPEIEGFETYWGTGVHS
    CPYCDGFEVRDRPLVVYGRGHGGCGLALELT
    GWSQDVTLCTSGHDGDLSDKDRDRLARNGVRVIEAEIERLEGDGSRPTCLRFRDGSQTACTALFLMPFACSPSPLITQLG
    CELDETRSVVPTREYEKTNVPGLYVAGDASRRVQFAVVAAAEGAMAAFAINAEFVAEATR

    >gi|218528256|ref|YP_002419072.1| Redoxin domain protein [Methylobacterium chloromethanicum CM4]
    MSRLELLVGDPAPAFPAAVFLKGTPFSAFEPGHVYVVECWATWCGPCLSTIPHLTQMQKDHPDVRFVGVAVWEDDIEAVR
    AFVTEKGDEMGYAVAFDVGEPAANGGWMPHHWLLPAYQNGIPTAFIVDREGRIAWIGHPAVMKEVLPSVVDGTFDIRAAT
    DRYAAWIRESMTREKSALQAAVQSHLKADDNAGAIQAYDAAIAECPRLESEVGLEKLRLLLRTPDSAALAYGSRLVTTFG
    SDFPFLKRATASEIVGALEDDTVLHQRQPLARFVIDLIRNLEAEKSEEDAYEACVRARCLAIAFLEEGQPAEALRQAEAA
    IVHGRTADLHERALDGLQSLVDRCAGSVATHSPKTPTVVCDGDVCRIV

    >gi|218528409|ref|YP_002419225.1| glutathione peroxidase [Methylobacterium chloromethanicum CM4]
    MTIRRRDCLAMLAVLAASRAHAAEAGPASAFAFDKPEGGGLPLSAYAGKPILVVNTATACGYAPQFVGLQGLWTRFGGRG
    LTVIAVPSPDFGNQEPLDGAAIADAARKNHGVTFPVTDKTHVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRDGTLRA
    AFATQVDPSDPRIVSAIVAELGQA

    >gi|218528426|ref|YP_002419242.1| OsmC family protein [Methylobacterium chloromethanicum CM4]
    MDADALRALQAPLKNKYRETPDSAVITLKAKGSLDDTSIACKVETGRALAVAGLHPATGGSGAELCSGDMLLEALVACAG
    VTVKAVATALEIPLKAGTVSAEGDLDFRGTLGVDKEAPVGFRSIRLKFDLDTDAPQEKLDQLLKLTERYCVVFQTLNHKP
    ELSVNASRS

    >gi|218528496|ref|YP_002419312.1| Heavy metal transport/detoxification protein [Methylobacterium chloromethanicum CM4]
    MDQSPIELTMRVDGMTCEGCAEAVRRTIRRLDPQADVSVDVGLGRVSATTVAQSLDVAQALTQAGYTATAMTG

    >gi|218528592|ref|YP_002419408.1| Redoxin domain protein [Methylobacterium chloromethanicum CM4]
    MNIEERHGEAFEFAEHLTVIGRKLRIGDTAPAFSLDRFDAVEGAIRTVLLSDTAGTVRLLNVVNSLDTPVCQVETRRWEK
    LRADLPNAVTVYTISMDLPFAQSRWNLSESVQHQLLSSHRSKQFGRDYGVLLKQWRLLQRAVFVIDSSDLIAHAEYVADQ
    MNEPNYDAAAVAVQNASGL

    >gi|218528601|ref|YP_002419417.1| methylamine dehydrogenase accessory protein MauD [Methylobacterium chloromethanicum CM4]
    MTMQFLIASNVLLWLALIGCAVLMLGLLRQVGLLHERSSPMGAMITDHGPDIGDAAPTFDLPDHSGALVRIGGPSALKRP
    TLLMFTAPT
    CPVCDKLFPLIKSIARAEKFSVVMISDGQPDEHQRFLAKHELGDIRYVVSAEVGMAFQVGKIPYGVLLDPE
    GVIRAKGLTNTREHLESLLEADKSGFASIQQFMTSRKHSHDAKAA

    >gi|218528863|ref|YP_002419679.1| methionine-R-sulfoxide reductase [Methylobacterium chloromethanicum CM4]
    MAGSDVIGTDPEIRTEEEWRAALTPEQYRVLREHGTERAGTSGLNAEKRAGTFVCAGCGAPLFESDTKYESGSGWPSFFA
    PLDDAVETTVDRSHWMTRTEVHCARCKGHLGHVFEDGPAPTGLRY
    CMNGVALGFEPEG

    >gi|218529031|ref|YP_002419847.1| Heavy metal transport/detoxification protein [Methylobacterium chloromethanicum CM4]
    MCCCMNKSKSTSATEAPAALKAIVVRVDDMACGHCAQVIKTSVEATLPGTEARPDPARKTVTVCGTTDLTAVRRAIASTG
    YTPSPMS

    >gi|218529067|ref|YP_002419883.1| arsenate reductase [Methylobacterium chloromethanicum CM4]
    MDAVIYHNPACGTSRNALVMIRNAGIEPHVVEYLKTPPSRALVRQMLARAGLSVRDVLREKGTPYAELGLADPVLTDDQL
    LDAVEAHPVLLNRPLVVSPKGVRLCRPSEVVLELLPPQQGEFVKEDGERVVDEHGRRVSAA

    >gi|218529107|ref|YP_002419923.1| heavy metal translocating P-type ATPase [Methylobacterium chloromethanicum CM4]
    MNQAAPTDPTSSPTTGNQALRYRVKGMDCPTCAGKIENAVSRLPGVADVRVNYGSQVLDLALDEGVTPRTELEGRVERLG
    YGVAPLPTAADLAKARAEGVAPPAGTMEDAEPPLWRSRKALLGILIGTLFAAGFIVERIAPGLAGEYAYWPGALVGLAYY
    GRRAVVAATAGTPFSIEMLMSVATAGALAIHAAEEAAIVVLLFTVGEMLEVVAAGRARAGIKALAALVPKTARLVDEADG
    TIREVPAASLAIGQVVVVRPGDRVPADGVITDGSSSLDESPITGESVPKAKEVGDTVYAGSVNADGALQVRVTKTAADNT
    VARILHLVEEAQASKSPTARFIDRFSAVYTPIAFAFAAAVAVLPPLLGADWGTWVYRGLALLLIACPCALVLSTPAAIAS
    GLAAGARRGLLVKGGAALEVIGRVRTVAFDKTGTLTAGRPRVTDILVFAPDASERSLLGLAAAVENGSSHPIARAILDRA
    NEDGVPLRPTRDARATPGKAVQATVMGQTVLVASPRHAADSLRLGPEADRAVAGLETSGKTVVIIIRGTEALGAIAVRDE
    PRADAAAGIAALRKLGVRSVMLTGDNRRAAEAVASELGLDVKAELLPQDKLAEIAALKEEGPVAMVGDGINDAPALASAS
    VGIAMGGGTDAALETADAAVLNDRVGDVAALVALSRATLGNIRQNVAIALGLKAVFLVTTIAGITGLWPAILADTGATVL
    VTANALRLLRA

    >gi|218529109|ref|YP_002419925.1| copper-translocating P-type ATPase [Methylobacterium chloromethanicum CM4]
    MSDAPQGHHPDPGGHGHAARGPAHGHDHGHHAGVAANGAGAYRVRDPVCGMMVDPHATKHRAEHDGHPYYFCSNGCRTKF
    EADPVRYVDPGSAAAKADPVPEGTIYTCPMHPEVRQLGPGN
    CPYCGMSLEPAMVGADAGPSEELVDMTRRFWVGLVLTLP
    VFVLEMGGHLFGLTERLGQQTSNWIQFALATPVVLWAGWPFFVRGYRSVVSRNLNMFTLIALGTGVAWLYSVVATLAPGL
    FPEALRGHGGAVPAYFEAAAVITVLVLLGQVLELRARESTGGALRALLDLAPKTARRIRPDGTDEEVQLDAIGVGDRLRV
    RPGEKVPVDGAVVEGRSSVDESLVTGESMPVTKEVGASVIGGSLNQSGALVVEATKVGRDTMLARIVQMVAEAQRSRAPI
    QRLADQVAGWFVPAVIGVAVLAFVAWIAFGPEPRFTFALLAAVAVLIIACPCALGLATPMSIMVGVGRGAQAGVLVKNAE
    ALERMEKVTTLVVDKTGTLTEGKPAVTRIVRAAGFNEATVLRLAASVERASEHPLAVAIVKAAEERGITLAPMADFDSPT
    GKGALGTVEGRRVALGNAAFLREQGVDVSAYATEADDLRRDGATAIFAGIDGRVAGVIAIADPVKATTAAALTALRDEGI
    RVVMLTGDNRTTAEAVARRLGIEQVEAEVLPDQKAAVVERHKAAGQVVAMAGDGVNDAPALAAADVGIAMGTGTDVAIES
    AGLTLLKGDLLGIVRARRLSRAVMGNIRQNLFFAFIYNAAGVPVAAGILYPFLGILLSPVIAAAAMALSSVSVIGNALRL
    RAARLG

    >gi|218529221|ref|YP_002420037.1| thioredoxin reductase [Methylobacterium chloromethanicum CM4]
    MAHTHARLVIIGSGPAGYTAAIYAARALVEPLLISGFQPGGQLMITTDVENYPGFADAIQGPWLMEQMRLQAEHVGTKIV
    SEYITSVDLNVRPFRLEADSGDTYTCDALIIATGAQAKWLGLPSEAKFQGFGVSA
    CATCDGFFFRGKDVTVVGGGNTAVE
    EALYLANLAKSVTVIHRRGEFRAERILQERLFKHANVTVKWHHAVEEICGSDTPPSVTHLRLKDLRTGAIVEQPTDGLFV
    AIGHQPATGIFEGQLPMRHGGYITVTPGTTATDIPGVFAAGDVTDDVYRQAITAAGMGCMAALEAEKFLANLDVGESPAK
    AAAE

    >gi|218529298|ref|YP_002420114.1| protein of unknown function DUF395 YeeE/YedE [Methylobacterium chloromethanicum CM4]
    MDGFTPLSATLGGVMIGAAAALFLLLNGRIAGISGILGGLLAPPSRETGWRAAFLAGLVPAPLVYAGFGGSLPPVTVDAS
    FPLLVIAGLLVGFGARLGAG
    CTSGHGVCGIGRGSPRSLAATGTFMAVAILTVFVTRHLLGA

    >gi|218529306|ref|YP_002420122.1| OsmC family protein [Methylobacterium chloromethanicum CM4]
    MSASAAPTTVTTYLRPIDRDGLMQFAEKGRCNPGSRGTNKVHTVVDGQYRTLSYVGDHQPVVVDEPLHLFGENTAPAPGE
    IMLSALGG
    CLAVGITAVATWKQVRLSRLELHLEGDIGNPAAWGAGGAEKLPEDMGFQEIRVAVTIEGDASREELDEIVRH
    ANVYSPVANSMRNPIAFKIGLAG

    >gi|218529334|ref|YP_002420150.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium chloromethanicum CM4]
    MARLLSADLSEPIDCLIVGGGPAGLTAALYLARFERRFLVVDAGDSRASWIPTSHNIPVFADGISGQEILLRQREHLARY
    RSEVTHGTVTALRRVEGGFAASVEEAGGISREVRARRVLLATGADDVEPDLPDLPDAVRRGLVRY
    CPICDGYEARGKRIA
    VIGHGDRGLGEAVFVARTYSRDVTLLTLGQGMHLDAGERERVEKHDIKVVHEPVTSLDVEDARITRLCTASGDEHRFEVL
    YSALGLKLRSELALELGAEHDETGALLVDEHNRTTVPGLYAAGGVVRGLDQVVVAMGHGAMAATDIHNRCELPTEEEVDG
    ADSSA

    >gi|218529358|ref|YP_002420174.1| OsmC family protein [Methylobacterium chloromethanicum CM4]
    MSDKHSIRIRQIEAYAFRIDFGESFVPLLTDEPEPIGGGTGPSPEQVLIAAVSNCLCASLAFALGKYRQEGGGVSAEAIG
    RVARNAEGRLRLVGIEVDIALGAPAESMDRLDRVLAQFEQF
    CTVSESVKAGVPVAVAVRDGQGNRLK

    >gi|218529758|ref|YP_002420574.1| DSBA oxidoreductase [Methylobacterium chloromethanicum CM4]
    MSLDRRRFLASSLGLAIVGPAAAQSYGQTFKVENDEGRPVANMRLPGEITGQIQELRGVTYVGPREAEVTLYEFFDYNCP
    WCRKAAADVTALAASDPALRIGLVHNPILSPMSAQAAKVSLAVQRKLGSAAAFAFYGQLLATKGQIDGLKALEIGAKAGV
    TRAELEQIADSDEVREAMRAHMTVAANLGLTATPSYVLGNTGVLGHPGVKSLAKMIGAMRRCDQIACG

    >gi|218529889|ref|YP_002420705.1| UBA/THIF-type NAD/FAD binding protein [Methylobacterium chloromethanicum CM4]
    MARMALNSEEIERYARHLVLREVGGPGQARLKAGRVLVIGAGGLGAPLIQYLAAAGIGTIGIVDDDTVSLSNLQRQVIHG
    TPDIGRPKVESAAETVARLNPHVRVETHACRLTPENAPALLAGYDLVADGSDNFATRYAVSDACFAGKKPLVTAALGAFD
    GSLTTIRAHETGPTGEPNPTYRCLFPSPPPPGSVAP
    CSEAGVLGALAGVMGSLMAMEVIRALADFGEPLVGRLLMVDARS
    MRFETLAYAWDPDNPLNGVRTGPAAEPAGHPLPPR

    >gi|218529905|ref|YP_002420721.1| dihydrolipoamide dehydrogenase [Methylobacterium chloromethanicum CM4]
    MSYDLIVIGTGPGGYVCAIRAAQLGLKTAVVEKRATHGGTCLNVGCIPSKALLHASEAFEEANKHFSELGIDVGTPKLDL
    KKMQSFKQSGVDGNTKGVEFLLKKNKVDTYHGRGRIAGAGRVEVISDDGGNQLLETKNIVIATGSDVTRLPGVEIDEKTV
    VSSTGALELAEVPKRLVVIGAGVIGLELGSVWRRLGAEVTVIEYLDRVLPGMDGEVGKQFQRILAKQGMVFKLSTKVTGV
    ETGKKGRATVTVEPAQGGEPEKLEADVVLVAIGRVPYTEGLGLETVGVATDDKGRIEVDSHYATNVTGIYAIGDVIAGPM
    LAHKAEDEGVAVAEILAGQSGHVNYGVIPNVVYTFPEVASVGKTEEELKKDGIAYNVGKFPFTANGRAKANGTTDGFVKI
    LADAQTDRVLGVHIVGADAGNLIAEVAVAMEFAASAEDIARTCHAHPTLTEAIKEAALAVDKRAIHV

    >gi|218530056|ref|YP_002420872.1| methionine-R-sulfoxide reductase [Methylobacterium chloromethanicum CM4]
    MNRRQTLRAGASLLGLLAASRLTSVMAGPASAAGFEVEKSEAEWRARLSPAAYQVLREHGTERAYTSPLNGEKRPGRFTC
    AGCDLPLFSSKTKFESGTGWPSFFETLPGAVGTQVDSAYGMRRTEVHCRRCGGHLGHVFEDGPKPTGLRY
    CMNGVSLRFE
    PAADGPA

    >gi|218530057|ref|YP_002420873.1| peptide methionine sulfoxide reductase [Methylobacterium chloromethanicum CM4]
    MTRERFRPRTSRLVGGLAGLALLAGAAWPLAPAFAEEGGQRLPEAAMTAKEGSGLRTATFAGGCFWGVQGVFQHVKGVTN
    AVSGYAGGTRASARYDEVGTGRTAHAEAVQVTYDPALVRYDELLQIFFSVALDPTEVNRQGPDTGPQYRSALFPADAEQA
    KVAKAYIAQLDGTKVFSKPIATKVESGAFYPAEDYHQDYMSLHPTNSYIAVNDAPKLRDLKALFPERANAQPVLVGRPPA


    >gi|218530068|ref|YP_002420884.1| Thioredoxin domain [Methylobacterium chloromethanicum CM4]
    MTNRRHVLVLAAAFLAGNLPGSGQAADPTAYDQSAFEAAQAAGRPILVQISAPWCPICRAQKPILAALSADPRFKTLAVF
    TIDFDAQRDLVRRFGAQMQSTLIVYKGGTEVARSVGETQPEWIEQLLEKAL

    >gi|218530256|ref|YP_002421072.1| hypothetical protein Mchl_2298 [Methylobacterium chloromethanicum CM4]
    MSNAPGPASARPRITITYCTQCQWLLRAAWMAQELLSTFRDDLGEVALRPGTGGVFVIELEADVIWERVRDGGFPDVKVL
    KQRVRDRLDPGRDLGHVDRAGREG

    >gi|218530480|ref|YP_002421296.1| Thioredoxin domain [Methylobacterium chloromethanicum CM4]
    MLEANAAAGAPVDGLIKDTTTAGFRQDVIAESMNQPVIVDFWAPWCGPCKQLTPVLEKVVRASGGRVKLAKLNIDEHPGV
    WQQIGQQLGLQSIPAVIAIDRGRPVDAFMGAVPESEVRAFVDRLAGPSEIDQVLEEAAAVASAGDLPAASELYAAVLREE
    PENLKAIAGLAKTQLELGETESAKQVLAMAPPDKADDPLFAGVRAALELAEQAGTLGDLAALQKRIEADPNDFQARFDLA
    LGLNAAGKREEAVDQLVAIARADRSWNEDAARKQLLQFFEAWGLMDPAAIRGRRQLSTLLFS

    >gi|218530529|ref|YP_002421345.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Methylobacterium chloromethanicum CM4]
    MSESFDVDLFVIGGGSGGVRAARIAAGHGARVMLAEEYRVGGTCVIRGCVPKKLMVYAGRFTDEFEDAAGFGWHLETPRF
    DWAVLKRSRDAEVARLEGIYGRNLAGAGVEVVADRAVIEDPHTVRLVHADRTVRARFILIATGATPVREPLIPGAELAID
    SNGVFELETQPERILVVGGGYIAVEFAGVFASLGSKTTLLHRGQSLLRGFDPEIADALGEAYAKRMDLRLGQTVERLERE
    GSAIRATLNGGESLTVDCVLVATGRRPNVAGLGLERVGIDLDERGAIPVEADSRTRVPSIYAVGDVNGRAALTPVAIREG
    HAFADTVFGNKPWCVDHRLIATAVFSTPEIGVIGHNEDVARRCYGEIDVYKASFRPMKATLSGRDERVIMKILVDRASDR
    VVGVHVLGTDAGEIIQAVGIAVTMGATKADFDRTIAVHPTLGEELVTMRTPFVVKHPVGVG

    >gi|218530532|ref|YP_002421348.1| OsmC family protein [Methylobacterium chloromethanicum CM4]
    MTDRHASAHWEGDGKTGKGKITTQSGVLSDNPYGFNTRFENEPGTNPEELIAAAHASCFTMALAFQLQSAGLKATSLDTK
    AVVTLVQDGDGFKVTKSALTLKAVIPGIDQAKFDELAGNAEKG
    CPISKLLNAEITLDKTLSPS

    >gi|218530615|ref|YP_002421431.1| Glutathione S-transferase domain [Methylobacterium chloromethanicum CM4]
    MATLYHSPFCPNSRFIRLVLAEMGMEPTLVEERAWERRRDFLIVNPAGTTPVLVEQTGLAIPGAGVIAEYLDETRGLGLA
    GRRLLPDTTQARVEVRRLLDWFLVKFNSEVTEYLVTEKIDKRFMPSAAGGGPPDMNAIRAARTNVRYHLQYVGYLIGQRR
    WLAGNDLTYADLAAAAHLSCVDYLGDVPWDEDEMAKDWYARVKSRPSFRALLADRAPGMPAAAHYADLDF

    >gi|218530662|ref|YP_002421478.1| OsmC family protein [Methylobacterium chloromethanicum CM4]
    MTVDVKYRTTASATGGRDGSARTEDGNFQVQLSTPKELGGAGGPGANPEQLFAAGYSACFIGALKVAGGQLKLKVPADTT
    VTAQVGIGPRSEGGFGITADLKVSLPGLDRADAERLVEAAHQI
    CPYSNATRGNVDVGLTVA

    >gi|218530742|ref|YP_002421558.1| Rhodanese domain protein [Methylobacterium chloromethanicum CM4]
    MTTSPFVTVEWLHQRLNAPDVVVLDASWYLPAQGRDAAAEYQAAHIPGAIRFDLDAMSDTDSALPHMLPRPEVFSSKMRA
    LGVGDGAQVVVYDGMGLFSAPRVRWMLQTFGMREVKILEGGMPAWVAAGYPTEDGEGRPRDRRHFTARLNNGAVADAGDI
    ARALAGGTTQVVDARSGPRFRGEEAEPRPGVRPGHMPGAKNLHYAALQANGRLRDEASLRAAIAEAGVDLDRPVVTT
    CGS
    GVTAAIVALALETLGKEPRALYDGSWSEWGADPARPVETGPA

    >gi|218530769|ref|YP_002421585.1| Redoxin domain protein [Methylobacterium chloromethanicum CM4]
    MTIQVGDHLPQATFRVNGPDGPQAKTTDDVFKGRRVVLVGVPGAFTPACHRNHLPGFVAKREEILARGIDAIAVTSVNDI
    FVLNAWQQQSGAEGIEFLADGNAEFAKAIGLEMDGSGFGLGPRSQRYAMLVDDGVVRILNVEDTPSKAEVSGAEALLKVL


    >gi|218530788|ref|YP_002421604.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Methylobacterium chloromethanicum CM4]
    MNAQTPQATPPGTRERPRRSLLALLPVLVFAILAVAFLVRLRSGADPAALPSALIGKPVPAFALDPVPGLQADGRPVPGL
    SSADLKGQVTVLNIFASW
    CAPCQIEHPMLMRLAQEPGIRLVGIDYKDPGDAGRRWLERNGLPFAAVGADASGRAGIDLGV
    YGVPETFIIGPDGRIRDKLVGILTPENYASVLERIRAAGRTAPVTN

    >gi|218530868|ref|YP_002421684.1| heavy metal translocating P-type ATPase [Methylobacterium chloromethanicum CM4]
    METILESHTTPLAPVDAERPSRLTLPVEGMSCASCVGRVERSLRALPGVTDVAVNLATGRASLALPDGMPPARAVEAIRE
    AGYDVPESVTAVSVEGMS
    CASCVGRVERALMALPGAVSASVNLATGRAELHHAAGTVSLSDVEAAVRQAGYEPRALAAAT
    DVSHADRQEREAAALRRDLIVAAVLSAPVVVLDMGSHLLPGFHHAVTGLLGAGGFAWMQAVLATLVLAGPGRRFFRIGVP
    NLLRGHPDMNALVALGAGAAYLFSLVSTAAPWWLPAGSAHLYFEASVLIVTLILLGRTLEARAKGRAGAAIARLIDLSPK
    TARRVEGATEREVPAADLTIGDRVRVRPGERVPADGLVASGASFVDESMITGEPVPVEKSTGARVVGGTLNTTGSFDFTV
    DRTGADTALARIVRMVEEAQGGKLPIQALVDRVTLWFVPAVIAVAVLTFLAWLVLGPAPALGHALVAGISVLIIACPCAM
    GLATPVSIMVGTGRAAERGVLFRQGAALQALRDARVIAFDKTGTLTEGRPRLTDLVTAPGFPRENVLALAGAVEARSEHP
    VARAIAAAARDAGALPDAEAFEAVPGHGVSARIEGRAVALGNRRYMERLGVTTAALESEASRLAQEGKSPIFAAVDGRLA
    ALVAVADPVKPEARAALDALRGRGLTVAMLTGDARATAEAVARSLGITEVEAEVLPEGKVAALRRLREAHGPVAFVGDGI
    NDAPALAEADIGIAIGTGTDIAVESADVVLMSGALTGLVEAVILSRATLANIRQNLFWAFAYNAALIPVAAGGLAAFGGP
    QLSPVLAAGAMALSSVFVVGNALRLKRAGGTA

    >gi|218530968|ref|YP_002421784.1| dihydrolipoamide dehydrogenase [Methylobacterium chloromethanicum CM4]
    MSETYDVLIIGAGPGGYVAAIRSAQLGFKTAVVDREHLGGICLNWGCIPTKALLRSAEIYHYMQHASDYGLSAKEVSFDA
    AAIVKRSRGVSGRLNGGVGMLLKKNKVDVIWGEASIESGAKGNEPGQVTVKETKRAEPPKGAKGAGTYAAKHIIVATGAR
    PRVLPGIEPDKNQIWTYYEAMVPEKMPKSLLVMGSGAIGIEFASFYRTMGADVTVIELLPQILPVEDAEIAGLARKRFEK
    QGIKILTSAKVTKVEKGADSVTATVEDDKGKTQQLTAEKLISAVGVVGNIENLGLEKVGVKIERGVVVTDGLGRTNVPGV
    YAIGDVAGPPMLAHKAEHEGVLCVETIKGLHTHPMDKAKIPGCTYCQPQIASVGVTEGKAKELGLSIKVGRFPFAGNGKA
    IALGEPDGLVKTIFDAKTGQLLGAHMVGAEVTELIQGYVVAMTLESTEEELMHTVFPHPTLSEMMHESVLDAYGRVIHT

    >gi|218531160|ref|YP_002421976.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacterium chloromethanicum CM4]
    MPLETGNAAPLFSLPGAGGETISLESLRGHKIVLYFYPKDDTSGCTLEAQNFNAQSEAFAAAGVKVVGVSPDSVKSHDKF
    RAKYGLTFPLASDEAKSMLEAYGVWVEKSMYGRKYMGVERTTVLIDREGQIARVWHKVKVPGHVEEVLEAVKALA

    >gi|218531226|ref|YP_002422042.1| Peroxiredoxin [Methylobacterium chloromethanicum CM4]
    MSNLYDHAPRDARGGPHPLSQYRGKVLLVVNTASKCGFTPQYQGLETLWRRHRARGLVVLGLPCNQFGAQEPGDAAAIEQ
    FCSLTYDVTFPVLAKVEVNGPGADPFYVDLKREKPGLFGTQAIKWNFTKFLIGRDGRVIGRFSPSTKPEALDGAIERALA
    EPGE

    >gi|218531333|ref|YP_002422149.1| alkylhydroperoxidase like protein, AhpD family [Methylobacterium chloromethanicum CM4]
    MTPRVENPYDHAPAAIKAMLAVETSLRTGGLERSLIDLVKLRASQINGCAYCIGLHTTEARRHGESEMRIVLLNAWREAA
    LYSPRERAALAWTEALTRLSEAGAPDALYADLRTSFTEAEQVQLTLQIGAINLWNRLQVGLRGVHHPDPSRDAA

    >gi|218531433|ref|YP_002422249.1| DsbA oxidoreductase [Methylobacterium chloromethanicum CM4]
    MITRRDALKLTGLALGTAALLPRLTFEALAQSADTAALMQPGPLGDVWLGPADAKVTIIEYASMTCSHCAHFHATTWPVL
    KERYIDTGKVRFTLREFPLDPLATAAFMLARCDGEAKYYPITDLLFDQQQNWAFVRKPQSPVDALEQLLRQAGFSKEKFE
    ACLKDQKTYAAINAVKTRGLDTLKVESTPTFFINGEKRAGALSIEEMEKIIKPILGA

    >gi|218531480|ref|YP_002422296.1| electron transport protein SCO1/SenC [Methylobacterium chloromethanicum CM4]
    MRSPMRPSRSVLLPLAAFVAGLVAISVALVMTLVPQHPQSGPSGIGGPFTLVNQDGATVSERDFAGKPYLMFFGFTHCPD
    VCPTTLQQISDVLAALGPKADRLKVAFVSVDPERDTPASLKTYLSSFDPRIVGLTGSPEQVAATVKTFRAYAKKVPGSSG
    DYTMEHTALVYLMDARNAFVGAVNLNRPAAETAAELSKRI

    >gi|218531533|ref|YP_002422349.1| glutaredoxin 3 [Methylobacterium chloromethanicum CM4]
    MQPVTIYTTAWCPYCSAAKSLLREKGVSFHEIDVEKTAGSRATMVQRAGGRTSVPQIFVGDRHVGGCDDLYALERAGDLD
    PLLAA

    >gi|218531537|ref|YP_002422353.1| peptide methionine sulfoxide reductase [Methylobacterium chloromethanicum CM4]
    MLLFRKRPEMPAPSEVLPGRPNPLPTAERHFVNGNPLKGPYPEGVETIVLGLGCFWGAERKFWELPQGVHVTAVGYAGGT
    TPNPTYEEVCSGLTGHNEVVLVAYDPAVLPLEAVLKTFFESHNPTQGYRQGNDVGTQYRSGIYTGSEAQAATARAVRDSY
    AQALDARGYGPITTEIVPLETFYFAEEYHQQYLAKNPGGYCGLGGTGVSCPVGVGVAAE

    >gi|218531543|ref|YP_002422359.1| Redoxin domain protein [Methylobacterium chloromethanicum CM4]
    MKATPKILAAGGALAAVLVGGLALYGTGSNLGNLAASGPCAEAAPVAARLAPLARGDVAAFDASAPPKPAPAVAFKGPDG
    APTDLASLRGKLLLVNLWATW
    CAPCKAEMPALDRLQAELGGDSFQVVAINVETRNLDKPPAWFKANGIAHLTYYGDPEGK
    VLPVIQSAVGSTGLPTTMLIDAKGCTLGVMKGPAEWSSEDGKRLIRAALAKPS

    >gi|218531632|ref|YP_002422448.1| iron-sulfur cluster assembly accessory protein [Methylobacterium chloromethanicum CM4]
    MADINLTARAAKRINEIMGAEPPGSSLRISVNGGGCSGFSYAFDITSAREGDDVVIERDGATVLVDPVSLEYMGGATIDF
    VNDLIGQSFKIENPLATASCGCGTSFAI

    >gi|218531724|ref|YP_002422540.1| OsmC family protein [Methylobacterium chloromethanicum CM4]
    MTATAAKEIVQTFEKVFEPIDRDKLHALSEKGRADPSVVKTVRARTVAEGRRFRHLNYIRSLDPHIVDEPPALLGDDTAP
    NPTEALLAALGT
    CVAVGLQANAIARGWTVKGIEVESEGDINITSVWGTGDLSEKPVGLTAVRLKVHLDVEGATAAELDEL
    VAHAGQWSPVLNTVKNPVSVTLARA

    >gi|218531871|ref|YP_002422687.1| DSBA oxidoreductase [Methylobacterium chloromethanicum CM4]
    MKLFRSVSVFALAGGLVLGAAVGARAEDAAPFTDAQRKAIEGIVKDYLVKNPDVLQEAIAEGERRAQETQKLAQAAALKE
    SREALTNSPHGIVAGNPNGDVTVVEFFDYN
    CGYCRKAFTDVQTLIKSDPKLRVVLKDFPVLGAESLEASRIALAAKLQLK
    PEKMFDFHAKLLETKGRINGERAIAVAKEFGADVERLKKDAQGPEVKAALTENVGLGDKLSLSGTPAFVIGDEILPGAVG
    VEPMRKTISDIRQCGHASC

    >gi|218532053|ref|YP_002422869.1| Peroxiredoxin [Methylobacterium chloromethanicum CM4]
    MISNIERPDLATERPACPPVMGDPAPGFRARTTMGERTLEDYRGRWLVLFSHPADFTPVCTSEFLAFSRAHPRFQMLDCD
    LLGLSVDSLSSHLAWAHNIEERFGVCVPFPMLEDPSMAIARAYGMLPPGAVSSATVRTTFVIDPDGIIRASTTYPMTVGR
    SVEEILRLVAALQVTDEADVVTPEAWRPGDPILVAPPLTFHGAAARPEGEAGDWYFRTGTL

    >gi|218532080|ref|YP_002422896.1| arsenate reductase [Methylobacterium chloromethanicum CM4]
    MPEAFDIVIYHNPACGTSRNTLAMIRNAGIEPHVVEYLKTPPSRALITRMLARAGLSVRDVLREKGTPYAELGLDDPALT
    DAQLLDAIEAHPALLNRPLVVSPKGVRLCRPSEAVLDLLPAQQGAFVKEDGERVVDEHGRRVSAA

    >gi|218532239|ref|YP_002423055.1| FeS assembly scaffold SufA [Methylobacterium chloromethanicum CM4]
    MSSFKVITLTDRAADRLKAIMADAETPIAGLRVGVKNGGCAGMSYTMEYAEERKAGEDVIEDRGVTVFIDPKAVLFLLGT
    EMDFQTTKLSSQFVFNNPNQTSACGCGESVAITPVNPERLTAGATA

    >gi|218532307|ref|YP_002423123.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium chloromethanicum CM4]
    MRYDAIIVGGSFAGLSAALYIARGRRKVCVVDAGAPRNRFAAASHGFFAQDGENPLAMIATARAQLAGYPNATFVTGEAV
    SARAAGDGFAVSLAGGQRLAASKLVLAFGISDILPDLPGLAERWGVSVLH
    CPYCHGFEFSGRVLGVLSAGALSVHQAELV
    AEWGPTTLFLNGQPAPDAEACARLAARNIGIEPGPIRALAGEGRALSALVMADGRTLPLEALFAGPRYRLNSPLAEQLGC
    AVDEGMLGPVIRTDAMKETTVPGVYAAGDAARSPHSVAWASADGVTAGVALHQTLVFPRLAA

    >gi|218532336|ref|YP_002423152.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacterium chloromethanicum CM4]
    MRDLSCDVAVIGAGTAGIAAHRAALDAGVRSVLIEQGPGGTTCARVGCMPSKLLITAAEAAQEARAAHRLGIRVGEVRVD
    GPAVLARMRRLRDRFVESVFEGIDAFPDETRLTGRALFEGPDALRIDDHTRLRFKAAVLATGSSPSVPEPLKGLGDRVLT
    TDTVFEIEDLPASLAVLGAGPVGLELAQAMARLGVATSVFDPGDSLGGLRDPDLKRAAREIFSEAFDLHLGAKVESGEIA
    GEGARLGWDGAGGKGDKTFDRVLAAAGRPPNVSGIGLEHTGATLNDKGGPVHDSRSLLCEGAPILIAGDANADRPVLHEA
    SRQGRIAGRNAARLARGEGAERPERWVALTMVFSDPQIAVIGGGFDPQADHRVGRADFCDQGRARVMDRAQGGIRLYAEA
    DGRLAAAELIGPEAEHLGHLLAYAVQDGLDVRRLRDRPFYHPTLEEGLDTALSNLGDHLK

    >gi|218532534|ref|YP_002423350.1| thiol:disulfide interchange protein, putative [Methylobacterium chloromethanicum CM4]
    MLRLLLALLLTLAAPGLAGAQGAMTAVKAKDLVRARLVAESEALVPGRTVTLGLHMAMKPGWHVYWRNPGDSGLPPEMAW
    RLPEGFTVGPVQWPVPERIPVQTLMNFGYEGAVTLLVPLKVPESARAGETARLAGTLSYLVCEEICIPGSAELSLDLPVA
    ASAEPDSGQAALFARARAALPEALPEALPEAAPGSYRTTREGDRLVLHLDRPGLAGVTGAAFFPYAEGALDNAAPQDLAV
    DAAGLRLTLTPGDAGQPPEALAGVLALTEDGTRKAYALGPEPAPAPTAAATVPAAPETPPAPAEEETLTLWSAAGLALVG
    GLLLNLMPCVFPVLSIKVLSLVRQAGESTTRVRLHGLAYTAGVLASFLGLAGLLIALKAGGAGIGWGFQLQSPVVVALLA
    YGLFAMGLSLSGAVHLGGGIVGLGDGLTRRAGYQGSFFTGVLATLVATPCTAPFMGAAVGFALTQSPLAALTVFASLGLG
    LALPFLGLTLVPQALRLLPRPGAWMDVLKGALAFPVYATVAWLVWVLAQQVGPNGLLAGLTGLVLVALAAWAWERARGAG
    RLGTGFGRVAALAALAAALGLVAVLNGDRATARTALAQGEEAFTQSRLDALRSEGRTVFVDMTAAW
    CITCQVNERTVLAR
    EGVQAAFRGGQVVYLKGDWTNQNPEITRLLERHGRSGVPLYLVYRGQGEAQVLPQILTEGIVLAAIGQKDVAAAQ

    >gi|218532573|ref|YP_002423389.1| transcriptional regulator, AraC family [Methylobacterium chloromethanicum CM4]
    MLAEPEIAPPDAAPLTEAEMRAAVAARDGGFDGRFVYAVRSTGVYCRPSCPSRAARSENLSFHAGSAEAEAAGFRACRRC
    RPDEPALSEQQAEKITRACRLIEAAETPPSLDALARAASLSPFHFHRIFKSVTGVTPRAYAQAHRAARAADSLAEGRTVT
    ESVYAAGYGAPSRFYAGGAERLGMSPSAYRKGGAGERIFFAIDACALGLVLVAATVRGVCAILLGDDADALRHDLTARFP
    KASIVAGDADFAATVAAVVHLVAAPGGTFDLPLDIGGTAFQQRVWQALRRIPVGTTATYAEIARAIGEPAAVRAVAMACG
    ANALAVAIP
    CHRVVRSDGALSGYRWGTARKTALLAREGVKR

    >gi|218532783|ref|YP_002423599.1| thioredoxin [Methylobacterium chloromethanicum CM4]
    MATVKVTDASFEQDVLQSAEPVVVDFWAEWCGPCRQIGPALEEISADLQGKVKIVKVNVDENPGIASTYGIRSIPTLMIF
    KDGKLASQKVGAAPKGDLSRWIQASA

    >gi|218532850|ref|YP_002423666.1| Rhodanese domain protein [Methylobacterium chloromethanicum CM4]
    MKVVDLDRETVKQGLADGSLLLIDVREDHEFARGRIPGSVSHPLSSFDPEALKALIAADGRRPVFSCASGVRSVHAIAAA
    QQSGLDVSEHYAGAFKDWYAAGEPVES

    >gi|218533220|ref|YP_002424036.1| hypothetical protein Mchl_5348 [Methylobacterium chloromethanicum CM4]
    MTALFPFDNSYARLPSHFFGRVAPTAVEAPRLIRLNRALAVDLGLDPDRLESPEGVEVLAGQRVPEGAEPLAAAYAGHQF
    GQFVPQLGDGRAILLGEVVGRDGRRDIQLKGSGPTPFSRRGDGRAALGPVLREYLVSEAMHALGIPTTRALAAVTTGEQV
    IRETALPGAVLTRVASSHIRVGSFQFFAARGDVEGLRALADHAIARHDPEAARADNPYRALLDGVIRRQAALVARWLTVG
    FIHGVMNTDNMSIAGETIDYGPCAFLDTYDPATAFSSIDRHGRYAYGNQPRIALWNLTRLAEALLPLLSEDETQAVAEAE
    AALTGFAGQFEAAYHGGLNCKLGLATTRDGDPALAGDLLKTMAENEADFTLTFRRLGEAVPGPDGEPDPAAVEAVRSLFI
    DPTAYDRWAGGWRRRLKDEAGDAAARRQMMRAANPAFIPRNHRVEEMITAAVERQDFAPFETLLTVLARPYDDQPDFAQY
    AEPPEGGGRGYRTF
    CGT

    >gi|218533224|ref|YP_002424040.1| Glutathione S-transferase domain [Methylobacterium chloromethanicum CM4]
    MTARTLYYAPGACSLASHIVLEEIGAPYETIRLDLAKGDQRAPEYLAINERGRVPALYEEGWVLTENAAILRHLARSHPE
    AGLLPEDLRGQAEADEWMAWLSTGHHIAYAHVRRPERYSADEAAFPEIRAKGADTFGDLCTMTEVRLSNGGWALGERYSV
    VDAYLLVFWVWARGPTIVFDMPALFPAWTAHARRMAERPAVRAVFAREGLALPA

    >gi|218533444|ref|YP_002424259.1| hypothetical protein Mchl_5599 [Methylobacterium chloromethanicum CM4]
    MEIAGKHFAWAACVVACVYLATDRHWVPVQIQIVASAPIQTFAAPTNQSSTAGVAPATGFQSAPAAPQAFQPLAQVAQAP
    AQAAPPTPSVSFATIEDPTRARQVTDLLAKLEGIADVPAGTAPGQVATIFFDPR
    CPYCHAAFTALHGRVAARWVPVVVLG
    DPEAGTRMAAAILAAPDRVAALTNAFDAKLTPTVSASPEITAKLAENKEAFAAIFAAAPQLHPGVPTLFVPRPDGRLAIM
    VGYEPGDDAKVRAVLTGS

    >gi|218530069|ref|YP_002420885.1| rhodanese [Methylobacterium chloromethanicum CM4]
    MRVIARHAAFAALGLMLGAAGPADSPVNVPEPEGLYTGPPKGYTPATLKGATVIDLKGLEKLLPEGPVLIDVVLADRRPE
    GLPADRPWLPTHRSLPGAVWMPGAGGAPLAPEKEEAFLRRVAELTGGDRAKPVVTFCRPE
    CWGSWNAGKRLVAAGYSRVH
    WFPPGVEGWQDDHDTAVAKPDPAWTHADSARVPQR