Methylobacillus flagellatus KT uid58049

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|91774369|ref|YP_544125.1| protein-methionine-S-oxide reductase [Methylobacillus flagellatus KT]
    MTKVFKTDAEWREQLTPLQYEVTRHAATERAGTGEYAFHFEHGIYHCVCCGTPLFASDTKFDAGCGWPSYFEALDPDNIR
    EKADYAYGMVRTEVICNVCDAHLGHVFPDGPPPTGLRY
    CINSASLRFEPS

    >gi|91774383|ref|YP_544139.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT]
    MTRSNKKGLSKRGFFMLALALAASILLIQQYASKPRLAHPVETFASTTPFFAAHASDLQGMEQPLSQWQGQLLIVNFWAT
    W
    CAPCREEMPELAELAREYAGKLVVLGISLDSVEKMQVFAQDTPVPYPLLSAEDEGMTLSASLGNLNSVVPHTVIIGPDG
    KILKSYFGRVTKVLLLETLQPALDS

    >gi|91774384|ref|YP_544140.1| protein-disulfide reductase [Methylobacillus flagellatus KT]
    MKSALPRQLACMLTSILLLFTMPLTTSIVQAAPGSQLSDWLNQGRNAFLGTDTDHILPPEQAFKLQVEFIDASRLQAAFK
    IAPGHYLYKDRIKFELEPAGHSVSDLNLPQGEWKQDPTFGRTEVFHRDFTADMRMTPAATLSSNLILKATYQGCSEKGLC
    YPPVHQTIALDSLLATTHAGPGSIPAPQAEHDRAASLLASGQFWLIVAGFFGFGLLLSLTPCVLPMIPILSGIIVGSQRK
    HRLYAFWLSLAYTLGMALSYTAAGVAAGLSGQLLSATLQNAWVLGASALVFILLALSMFGLYELKLPAMLEHRLVNASNR
    LPGGHLIGVFAMGVLSALIVSPCVAAPLAGALLYVGQTQDVALGATALFALSMGMGMPLLLVGASAGAVLPKAGPWMIAI
    RQAFGVFMLAVALWIVSPLLPTSLQLLLWAALLIVPAIFMRALDRLHEAATAWQRFWKGIAIIMLLAGATLVIGAASGAK
    SPLQPLERLALGQAGPDTSLPFQRIKQVSDLEQALSQHPGKPVLLDFYADW
    CAACKEMEHFTFRDADVRAHLQAFVLLQA
    DVTVNDAEDQALLKHFGLFGPPGIIFFDGKGQEMTHHRVIGYQNSNQFLQTLNRVKSANDTIQ

    >gi|91774416|ref|YP_544172.1| HesB/YadR/YfhF [Methylobacillus flagellatus KT]
    MNAVTEEIPSPLIFTDNAARKVKELIDEEGSPDLKLRVFVSGGGCSGFQYGFTFEETINEDDTTVDKDGVTLLIDPMSLQ
    YLVGAEIDYQDSLQGSQFVIRNPNATTTCGCGSSFSA

    >gi|91774441|ref|YP_544197.1| UBA/THIF-type NAD/FAD binding fold [Methylobacillus flagellatus KT]
    MNDNQLLRYSRHILLPQISYEGQEQLVNSHALVIGAGGLGSPVALYLAAGGVGTLTICDFDEVDLTNLQRQIIHTTAAVG
    RNKAVSAAETIATLNPEVTVNPLQQRVDEASLRGLVQAADVVVDCTDNFTVRYAVNQVCVELRKPLVSGAAIGFEGQVTV
    FDMRHDDSPCYHCLFPDLGGDEGLR
    CAENGVFAPLVGMIGTTQAAETMKLLLGLGKSLQGRLLLLDTISMEWRTLKLSKD
    EACPVCNKPSI

    >gi|91774450|ref|YP_544206.1| rhodanese-like protein [Methylobacillus flagellatus KT]
    MTSHTDIDATELHALLASRKTILVDVRNDDEVARGVIEGAMHLPMMVIPSMGSLLCEHHDTALVFYCHSGIRSAQAAAFI
    AGMDRENVYNLRGGILAWANAGYTFVPKTD

    >gi|91774601|ref|YP_544357.1| glutaredoxin-like protein [Methylobacillus flagellatus KT]
    MDTQALIKNQVTSNPVVLYMKGSPKFPQCGFSGLAVQILQACGLKDFVAVDVLADPAIREGIKTYANWPTIPQLYIKGEF
    IGGADIMRDLYQQGELQKLLQEAQA

    >gi|91774619|ref|YP_544375.1| glutathione S-transferase-like protein [Methylobacillus flagellatus KT]
    MMTLYSGTTCPYSHRCRIVLFEKGMDFQVIDVDMANKPEDLAVINPHNTVPVLVERDLVLEQANIINEYIDERFPHPQLM
    PADPVMRARARLFLHNFEEQLFNHVADIETGSAKAADKARATIRDNLTQIVPLFSRQEYILGDEFSMLDVAIAPLLWRLG
    HYGIELPKQAAPLLKYAERIFSRPAYIEAMTPSEKAMRK

    >gi|91774736|ref|YP_544492.1| OsmC-like protein [Methylobacillus flagellatus KT]
    MLFDGSTLDGTKNEMKARVKWIENVCFMGESETGHAVVLDGAPEAGGRNLGMRPMEMLLIGMGACTSFDVVTILKKSRQP
    VTDCVAEISAERANDIPKVFTKIHVHFVVTGKGLNPAQVERAVKLSAEKYCSASIMLGKAAEVTHDFEIAEAEL

    >gi|91774740|ref|YP_544496.1| SelT/selW/selH selenoprotein [Methylobacillus flagellatus KT]
    MSMPKLPEVEIEYCTQCRWLLRAAWMAQELLTTFESDIRCVSLVPGTGGIFEVRLDGELLFSRKEQGRFPESKELKQLVR
    DRIDPARDLGHSDRK

    >gi|91774830|ref|YP_544586.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT]
    MTVFTMSQKLRKVLIPLAIVGLLAFLGFSLTQKPQAPDITFVTLEGKTIPLSSQQGKLVLVNFWATDCPGCIAEMPGLIQ
    TYNEYKDKGFEVIAVAMSYDGIQQVINYSHNNALPFPVSHDSSGDAAMQFNDVRVTPTSFIIDKQGRIIQKLIGELDFSA
    LRKLLDQHLGKAG

    >gi|91774862|ref|YP_544618.1| glutathione S-transferase-like protein [Methylobacillus flagellatus KT]
    MAQPILYSYRRCPYAMRARMALHYANIAVDIREIVLKAKPTHMLQVSPKGTVPVLVLPDGVVIDESLDIMRWALQHHDPE
    GWLGSPALLAQAESLIAENDGPFKHALDRYKYAIRFPEQPPEVYRAQGEIFLQQLESRLQQQSYLLGSHQGLADVAIFPF
    VRQFAMVDQPWFLSAPYPQVRAWLQAWVESERFAAIMQKYPIYTD

    >gi|91774905|ref|YP_544661.1| hypothetical protein Mfla_0550 [Methylobacillus flagellatus KT]
    MTSGIMIASNVLLWGAFLALAALMLGVIRQIGLLHERSAPLGAMMIDHGPDIGERSPVFSMTTIDGVPVTVGRAVSPGRP
    SLLMFTGPS
    CPICQKLLPIIRSVAATEGADVILISDGTQAEHREFLRNHPLDGEHYVVSAEIGMRYQVSKVPYGVLLDKD
    GVIQAKGLCNTREHVESLFETTRVGHSTLQNFLKHGVEDASKHVH

    >gi|91774990|ref|YP_544746.1| heavy metal translocating P-type ATPase [Methylobacillus flagellatus KT]
    MTNLQAIGVSCYHCGLPVPSGSEFYAAILGQRRRMCCHGCQAVAESIVDNGLEDYYQHRTELPQTAEELVPEELRQLELY
    DHPEVQKSFVHDESGDLLEASLILEGIT
    CAACIWLNERHLQQLNGVVSASINYSSHRARVRWDDSKIRLSQILAEIRRLG
    YHAHPFSAQQQEAVREQRRRQDFRGLAIAGLSAAQVMMVAVAFYAGPEQGLEPATEQLLRWFSLVITVPAMIYSAWPFYQ
    AAWRSIVNRRVGMDVPISLGLITGFIGSVWVTFQGQGTVYYDTLTMLIFFLLATRYLERHAREKSVEAAENLHRLIPPMA
    TRLDANQQPQIVPLHALQAGDTLLVKPGEAIAGDGVVIQGQSQVDEALLTGESRPVAKLPGAYVYAGSVNYESPLQVRVT
    GLGEQTVIAGIARLLDRAQAEKPRLARIADHVAMYFTSILLVAVVLIGAAWWWIAPERCFEIVLSVLVVSCPCALSLAAP
    AAFAAAGSHLVGRGVLLTRGHALETLARVTHVVFDKTGTLTMGRPRITATIPYHGYQAGTVLRIAASLEQASEHPLARSF
    MDMVPAGERAGGVDIRNHPGKGISGEVDGERYFIGNMALNPQLAYPEVAGVEPGSSVVWLSNAQQVVAAFVLADTMRPGV
    IELIDQLKSRNITVSILSGDTASSVQHFASIAGIGDWRAALTPEGKLTALREMQQRGEVVAMVGDGINDAPVLAGAQVSF
    AMGSGTQMARASGDIVLLGENLLEIDHAITTGRFTVSIVRQNFTWALVYNALALPFAAAGLIAPWMAAIGMSVSSLIVIL
    NALRLR

    >gi|91775159|ref|YP_544915.1| iron-sulfur cluster assembly protein IscA [Methylobacillus flagellatus KT]
    MAISLTETAAKRVQKFLANRGKGVGLRLGVKTTGCSGMAYTLEFVDEIQVEDLVFESHGVKVIVDPKSLVYIDGTELDFA
    KEGLNEGFKFNNPNVKDECGCGESFTV

    >gi|91775190|ref|YP_544946.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT]
    MLQPNSPAPDFSLLDADIEPITLSALRGHNVVLYFYPKDNTPSCTLQAIEFSDLEDEFKRHDTIVIGISRDDCISHATFR
    DKHGLAVCLLSDEDGEVCRQYGVWQEKEKDGIRKMGIVRSTFVIDRTGVVRLAQYGVTAKGHAAEILKFIKSL

    >gi|91775290|ref|YP_545046.1| heavy metal transport/detoxification protein [Methylobacillus flagellatus KT]
    MHTFKVNDMSCNHCVQAITQAAQAVDPQAKVTVDLAGKAVHIDSSADIARFRDAISEAGYTPE

    >gi|91775291|ref|YP_545047.1| heavy metal translocating P-type ATPase [Methylobacillus flagellatus KT]
    MTKQPPLEKLDFAITGMTCAACAGRIEKSLNKLPGVQLANVNLATEKAHVEAVGADLAQQVEQAVSKLGYQARLIRPDAP
    IAPVEDIQGGWKVGIAALLTLPLVLPMVGMLLGQHWMLPGWVQWLLATPVQFWLGARFYRAGWKAAIHLSGNMDLLVAIG
    TSAAYGLSVYLLWQHSPHLYFEASSAVITLVLLGKWLESRAKRQTTEAIRALQALRPDTARVRRNGLEQDVPLAEVMVGD
    QVLVRPGERVPVDGVICEGDSHLDESMLTGESAPVKKGVGGKVAGGAVNLDGVLLVEVTAIGAETTLSRIIRMVEDAQIA
    KPAIQRLVDKVSAVFVPLVLLIAVLTLASWAWYNGQWEQAVLNAVAVLVIACPCALGLATPTAIMAGTGVAARYGILIKD
    ADALELAHRIDTVAFDKTGTLTVGKPRVIKVASMPGRALELLRLAAALERGSHHPLAVAVLEHAQAAGVEAASAAEAMAL
    PGSGLMAKVDGRRVWLGNQRAMEQAGVAVDSMQGEVEPLMNRGCTLSWLAAENDAGQPELLGLMAFGDELRPEAVAAVQH
    LHALGIKVLMLTGDNHASAQRISQQLGLDEVYAEQLPDSKAAVVAALRRQGRVVAMVGDGINDAPALAAADIGFAMSSGT
    DVAMHTAAVTLMRSSPLLVADTIAISRRTYSKIRQNLFWAFIYNLVGIPLAAMGMLNPIVAGAAMALSSASVVTNALTLR
    RWRPAAEERH

    >gi|91775334|ref|YP_545090.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT]
    MLQPNSPAPDFSLLDADIEPITLSALRGHNVVLYFYPKDNTPSCTLQAIEFSDLEDEFKRHDTIVIGISRDDCISHATFR
    DKHGLAVCLLSDEDGEVCRQYGVWQEKEKDGIRKMGIVRSTFVIDRTGVVRLAQYGVTAKGHAAEILKFIKSL

    >gi|91775434|ref|YP_545190.1| heavy metal transport/detoxification protein [Methylobacillus flagellatus KT]
    MHTFKVNDMSCNHCVQAITQAAQAVDPQAKVTVDLAGKAVHIDSSADIARFRDAISEAGYTPE

    >gi|91775435|ref|YP_545191.1| heavy metal translocating P-type ATPase [Methylobacillus flagellatus KT]
    MTKQPPLEKLDFAITGMTCAACAGRIEKSLNKLPGVQLANVNLATEKAHVEAVGADLAQQVEQAVSKLGYQARLIRPDAP
    IAPVEDIQGGWKVGIAALLTLPLVLPMVGMLLGQHWMLPGWVQWLLATPVQFWLGARFYRAGWKAAIHLSGNMDLLVAIG
    TSAAYGLSVYLLWQHSPHLYFEASSAVITLVLLGKWLESRAKRQTTEAIRALQALRPDTARVRRNGLEQDVPLAEVMVGD
    QVLVRPGERVPVDGVICEGDSHLDESMLTGESAPVKKGVGGKVAGGAVNLDGVLLVEVTAIGAETTLSRIIRMVEDAQIA
    KPAIQRLVDKVSAVFVPLVLLIAVLTLASWAWYNGQWEQAVLNAVAVLVIACPCALGLATPTAIMAGTGVAARYGILIKD
    ADALELAHRIDTVAFDKTGTLTVGKPRVIKVASMPGRALELLRLAAALERGSHHPLAVAVLEHAQAAGVEAASAAEAMAL
    PGSGLMAKVDGRRVWLGNQRAMEQAGVAVDSMQGEVEPLMNRGCTLSWLAAENDAGQPELLGLMAFGDELRPEAVAAVQH
    LHALGIKVLMLTGDNHASAQRISQQLGLDEVYAEQLPDSKAAVVAALRRQGRVVAMVGDGINDAPALAAADIGFAMSSGT
    DVAMHTAAVTLMRSSPLLVADTIAISRRTYSKIRQNLFWAFIYNLVGIPLAAMGMLNPIVAGAAMALSSASVVTNALTLR
    RWRPAAEERH

    >gi|91775472|ref|YP_545228.1| thioredoxin reductase [Methylobacillus flagellatus KT]
    MATKHARLLILGSGPAGYTAAVYAARANLKPVLITGIAQGGQLMTTTEVDNWPADADGVLGPELMARFQKHAERFNTEII
    FDHIHTTHLTEKPIRLVGDAGEYTCDALIIATGASAKYLGLPSEEAFAGKGVSA
    CATCDGFFYRNQEVAVIGGGNTAVEE
    ALYLANIASKVTLVHRRDKFKAEAILVDKLMERVKEGRIVLETFQTLDEVLGDDSGVTGIRLKDVNSGATKEIALKGVFI
    AIGHKPNTDIFEGQLEMEGGYIVTKAGREGNFTATSVPGVFAAGDVQDHIYRQAVTSAGTGCMAALDAERYLDQLS

    >gi|91775514|ref|YP_545270.1| thioredoxin [Methylobacillus flagellatus KT]
    MKNDLHLVCPHCQSINRVPTAKLSEHPNCGRCQQPLFTGEPIELTTATFARHLERSDLPLLVDFWAPWCGPCKMMAPQFE
    QAASLLEPKVRLAKVNTEAEPHLAAQFGIRSIPTLILFRGGHEVARQAGAMGAQDIMRWVASQLPR

    >gi|91775538|ref|YP_545294.1| thioredoxin-related [Methylobacillus flagellatus KT]
    MAVQHLNKRNFKQTMEHNPFVIVDFWATWCEPCVVFKPVFEAASEAYPDVVFAMVNVDDEPEISSYFHVKQIPALMAVRD
    QILVDAQVGKMSRSELENAIQSWAGFDVTDIRRHFSEKALP

    >gi|91775539|ref|YP_545295.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT]
    MLKTLSILLMIGLAAFIILRPAHAASVPQPGSPAPGFTLLDAKKAQHRLTDYAGQWLVLYFYPKDDTPGCTKEACSFRDD
    LFQLEKLGAKVIGISVDDPESHAKFADKYSLPFPLLSDSDGKVADSYGALTNLGIIKIAKRYTFLIDPQGNIAKTYLKVD
    TSRHSQEIIDDLKQLKTAQPH

    >gi|91775549|ref|YP_545305.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacillus flagellatus KT]
    MLDANIKTQLQAYFDKLTQPIEITASVDGSDKSRELLELLDDLKSLSSRITVQQSDDDTQRKPSFSLNSPGKNLSIRFAG
    LPMGHEFTSLVLALLQVGGHPPKAEPEVIEQIRNLEGEFNFETYISLS
    CHNCPEVVQALNLMAAINPNIRHVMIDGALFQ
    KEVDERKIMAVPTIFLNGQEFGHGRMGVQEILNKIDTGAVKKEAEKLSAKEPFDVLIVGGGPAGASAAIYSARKGIRTGI
    VAERFGGQVMDTMAIENFISVKETDGPKLAAALEEHVKSYDVDIMHLQRAAALVPAHENGGLAEVRLESGATLKAKAVII
    ATGARWREINVPGEKEYRGRGVAY
    CPHCDGPLFKGRSVAVIGGGNSGVEAAIDLAGIVKDVTLIEFNNELRADAVLQKKL
    FSLPNVTVITGAQTTEINGDGEKVNGLTYIDRQTGESHRIDLAAVFIQIGLVPNTDWIKDTITLNKFGEIEVDDKGQTSE
    PGIFAAGDVTTVPFKQIIIAMGEGSKAALGAFEHLIRH

    >gi|91775550|ref|YP_545306.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT]
    MTTSLINTEIKPFKATAFHNGEFITVTDADLKGKWAAVVFYPADFTFVCPTELGDIADNYDELQRLGVEVYSVSTDTHFT
    HKAWHDTSDTIRKIKFPMIGDPTGAISRNFGVLREDQGLADRGTFVIDPNGIIQAIEVTAEGIGRDAADLVRKIKAAQYV
    ASHPGEVCPAKWKEGEATLAPSLDLVGKI

    >gi|91775575|ref|YP_545331.1| thioredoxin-related [Methylobacillus flagellatus KT]
    MKPAWNPEPHRSDLDAMTGWLLLEFGANWCGFCQAIQPMLGKALAQFPGLRHERIEDGRGKRLGRSFKVKLWPTLVLLHN
    GVEVGRVVRPQRPEEISQLLTQATESCASTKR

    >gi|91775593|ref|YP_545349.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Methylobacillus flagellatus KT]
    MATVTLKGNPVQIGGNLPQKGETAPDFQLADAKRNLVSLADFAGKRKVLNIFPSIDTPTCATSVRTFNKQASGLANTVVL
    CISADLPFAQSRFCGAEGLENVITLSTFRDTAKFSKDYGVQILDSSLAGLTARAVVVLDENNQVLHSELVAEIANEPNYD
    AALAAL

    >gi|91775904|ref|YP_545660.1| 1-Cys peroxiredoxin [Methylobacillus flagellatus KT]
    MATLRLGDTAPDFTQDSSIGPISFHEWLGDSWGILFSHPADYTPVCTTELGATAKLAEEFKKRNVKPIALSVDPVESHKG
    WITDINETQGAEVNFPIIADADRKVSELYDLIHPNASTTATVRSVFIIDPNKKIRLTLTYPASTGRNFNEILRVIDSLQL
    TEYHSVATPANWEDGDDVVIVPSITDPEVLKQKFPKGYKAVKPYLRLTPQPNK

    >gi|91776042|ref|YP_545798.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT]
    MAVLVGKPAPDFTAAAVLGDNSIKEDFNLYEHIKGKPAVIFFYPLDFTFVCPSELIAFDHRLEEFKARGIEVIGVSIDSH
    FTHLAWKNTPVDKGGIGKVGYPLVADIRHEIAKAYDVESDGGVAYRGSFLINKEGIIVHQVVNDLPLGRDIDEMLRMVDA
    LQFFEAHGEVCPAGWKKGKAGMSASPEGVAKYLAENAASL

    >gi|91776140|ref|YP_545896.1| hypothetical protein Mfla_1788 [Methylobacillus flagellatus KT]
    MLTFDNRFLRELPGDPETSNQLRQVYGACWSRVMPTSVSSPKLLAYSHEMLEALELSEEEIRSPAWVDALAGNGLMPGME
    PYAACYGGHQFGHWAGQLGDGRAISLGEVVNRQGQRWELQLKGAGVTPYSRMADGRAVLRSSVREFLCSEAMHHLGIPTT
    RALSLVQTGDVVIRDMFYDGHPQAEKGAIVCRVSPSFIRFGNFEIFAMRDDKQTLQKLVDFTIDRDFPELRNYPEEERLA
    EWFAIICVRTARLIAQWMRVGFVHGVMNTDNMSILGLTIDYGPYGWVDNFDPGWTPNTTDAAGRRYCFGRQPDIARWNLE
    RLAQALYTLKPEREIYDEGLMLYDQAYNNEWGAVLAAKFGFSAWRDEYEPLLNEVFGLMTQAEIDMTEFFRKLALVDAAQ
    PDLGILQSAAYSPALWETFKPRFSDWLGQYAQATLADGRDPAERREAMNRVNPRYVLRNYLAQQAIDLADTGDTSMIEAL
    MDVLRKPYDEQPGKERFAALRPDWARHKAG
    CSMLSCSS

    >gi|91776163|ref|YP_545919.1| protein of unknown function DUF395, YeeE/YedE [Methylobacillus flagellatus KT]
    MVTWAHITPLESLAGGVLIGLAAALLLIMNGRIAGISGILGGLLNASWSANAWRLCFLAGLVGSPWLYSLWSAMPEATAP
    RDIHVLVLAGILVGFGTRLGSG
    CTSGHGVCGMARLSPRSMIATLVFMAAAMLTVSIYPPW

    >gi|91776180|ref|YP_545936.1| thioredoxin-related [Methylobacillus flagellatus KT]
    MPVLQLTKANFKHTIESNDFVIVDFWAPWCQPCVAFTPVFEAASEQNPDIVFGMVNTEDDPEISEYFEVEKIPGILVIRE
    QAGIHAQVGEIGAPALDKIIEWARAYDMTQVREYYAQQEAAAAK

    >gi|91776214|ref|YP_545970.1| disulphide bond formation protein DsbB [Methylobacillus flagellatus KT]
    MCNKLFAGRRGYFLGFVASFGLVGLALFLQQKYNLEPCPLCISQRIAFMALGILFLLAALHNPGRVGRKVYGLLHVIAAA
    TGIGIAARHIWIQANPDKVMAE
    CGAGFDYIMETFPLKKALDLIFKGTGECSAIDWTLFGLTIPQLSLIAFVGLGLFAVLL
    AFHKKA

    >gi|91776220|ref|YP_545976.1| hypothetical protein Mfla_1868 [Methylobacillus flagellatus KT]
    MKLYGIPNCNTVKKARAWLEERGIAYEFHDFKKSGISEDTLKEWLSQVEWEKLVNRAGMTWRGLSEAEKAAVTDDASAIR
    LMQEKTSVIKRPVLVKDNQVICLGFTEAAYAKLFDA

    >gi|91776258|ref|YP_546014.1| hypothetical protein Mfla_1906 [Methylobacillus flagellatus KT]
    MRRLLFISLLMASNHVAAETDLDFKLPTLDGTRFVELRQVAKPVLVNFWGVDCPPCVAELPMLDQFAVERPDWSVLLVNT
    DGAAMAQRFLEQHPVKSTVLRPGMNVTGLMRKAGNKIGALPFTVVLDSRQAICFRKTGALSPEDMARIAALCH

    >gi|91776428|ref|YP_546184.1| dihydrolipoamide dehydrogenase [Methylobacillus flagellatus KT]
    MSKIIEVLVPDIGNFDSVDVIEVLVKAGDTIAKEDALITLESDKASMDIPSSHAGVVKEVKVKVGDKVAKGSLILLLEEA
    GTDQASTTADAAPAAKEESKPVPAATPAAPEPATGDSDINTEVVVLGSGPGGYTAAFRAADLGKQVVLIERYSTLGGV
    CL
    NVGCIPSKALLHTAKVITEAEETSLHGVSFGKPKIDLEALRAWKANDVVGKLTAGLAQMAKQRGVTVVQGVGKFTSPHQI
    AVTAADGKVTTVGFQNAIIAAGSQATKFPGAPEDERIMDSTGALALADVPKRLLVIGGGIIGLEMGTVYEALGSKVSVVE
    FMDGLIPGADRDLIRPLQKRMEKRFERIMLSTKVANIEAKKDGIHVSFEGENAPKEIEVYDRVLVSIGRRPNGKNIGAEN
    AGVAVDDRGFITVDKQMRTNVPHIFAIGDIVGQPMLAHKATHEAKVAAEVIAGHKVEFQAMVIPSVAYTDPEVAWAGVTE
    TEAKAKGLEIEKASFPWAASGRALSIARSEGATKLIFDKETHRVIGAGIVGTNAGELLAEAVLAIEMGADAHDLGLTIHA
    HPTLSETICFAAEIKEGTITDMLPPKKR

    >gi|91776437|ref|YP_546193.1| peptide methionine sulfoxide reductase [Methylobacillus flagellatus KT]
    MAESVAIFAGGCFWCLEPVFSQLQGVRQVVSGYIGGNVVDPTYEEVCTGATGHAEAVQIIFDPLEIDYEVLLEIFFLAHD
    PTTLNRQGHDVGTQYRSAVFCQSQDQLVAVHRLLERFARENTFGAPVVTEVSTNGKFYAAEEYHQQYYARNSSQPYCQAV
    AAPKIAKIREKYADRIKLP

    >gi|91776495|ref|YP_546251.1| putative thiol:disulphide interchange protein [Methylobacillus flagellatus KT]
    MSKKWIAMLAASLFATHAWADEAGLKKAIEATYPKVKVDSVVKTPYAGLYEVFLDGQIIYTDDKFSFLIAEGRLVEPKSK
    RDITGERMDELTRVDFASLPLDQAVKVVKGNGSRKLVVFSDPD
    CPYCKRLEQKELSNINDVTIYTFLFPLEQLHPDAANK
    SRAIWCAPDRAKAWNDWILNGQLPKAQGTCDTPIEKVAELGRKLNVTSTPTLIFADGKRMLGAYPAKDIEKAMAAAPGSK
    K

    >gi|91776525|ref|YP_546281.1| rubredoxin-type Fe(Cys)4 protein [Methylobacillus flagellatus KT]
    MTSAVSKQGEPVVEWRKYICLACGLIYDEALGDPDSGLAPGTRFEDIPDDWSCPLCGVTKTDFELYVAQDMSTLACSTSF
    GFAAGRHQTGVVIVGAGNAGWQAARAIRALDQDMPITIVTA
    CSGDIYDKPMLSVAISKGIDPRSLIKESGQEAALKLGVR
    LMTLTDAISIDTAASILRTTRGSLKYTHLILAHGATPRKMDALPANICWQINNLQTYIDFRSRLDAIPAKSNILIAGAGL
    VGSELANDLALAGHSIFLTDPNPTPVGNLLNSEDARRLLDAWKYLPIAFIGEATVKQIIKQGDLKHVELSNGHALDVNFV
    IAATGLQTPGRLARTAGLQWNEGICVDPVTLDTNVANIHALGDCVSISGQAIRFIEPIHRQAKVIAAKIACCEPIYYTHS
    IPVIRIKTSSLYLSV

    >gi|91776527|ref|YP_546283.1| OsmC-like protein [Methylobacillus flagellatus KT]
    MSTCTIQEQESTFTKFLRPIDREGLLQFAEKGRNNPASRGTNKVHTVVDGKFRTLSYVGDHKAVVVDEPLHLFGQDTAPA
    PGEIVLSGLGG
    CLCVGITAVATYRNVKLSKLEIYLEGDIGNPAAWGAGGAEKQPHEMGFQQIRVKVDVEGDAPREVLEEI
    VKHANFFSPVANTMRNPIPFDISLA

    >gi|91776538|ref|YP_546294.1| glutaredoxin GrxC [Methylobacillus flagellatus KT]
    MANVLMYTTGTCPYCMSAERLLLSKGVQQINKVRVDLEPELRVKMMEQTGRRTVPQIYIDDVHVGGFDDLRALDMAGKLD
    AMLAK

    >gi|91776539|ref|YP_546295.1| rhodanese-like protein [Methylobacillus flagellatus KT]
    MEFFANNALWIGLAIGSGIMLVWPTIKRGAGAAISASDAVILINRSHAVVLDVRDDAEFAAGHIAEAKHIPLSQLPERIK
    ELNKFKERPVLVY
    CESGARASKAAAILAKNEFKQVQQLQGGIRAWQDAKLPLVKG

    >gi|91776602|ref|YP_546358.1| hypothetical protein Mfla_2250 [Methylobacillus flagellatus KT]
    MASLNPPVCDFGWKAPDFNLPGVDGRHWSLEEVKGVNGTLVMFICNHCPYVQAIRERLVADVRALREFGINAVAISSNDA
    VTYPEDSFEKMAEVAREFHFPFPYLFDESQQVAKAYGAVCTPDFFGFNAHLELQYRGRFDNQGRSMTPVENPTRDLFNAM
    KQIAETGRGPAEQVPSIGCSIKWREPAE

    >gi|91776641|ref|YP_546397.1| thioredoxin [Methylobacillus flagellatus KT]
    MSEHITHISDDTFDQEVLQSQLPVLVDYWAEWCGPCKMIAPILDEIAKEYAGRLKIAKLNIDENQNTPPKYGIRGIPTLM
    LFKDGNVEATKVGALSKSQLTAFIDSNI

    >gi|91776660|ref|YP_546416.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Methylobacillus flagellatus KT]
    MSTMLNQAIPDFELPSTSGKIFKLSDYIGKKLIIYFYPKDNTPGCTNQGKDLRDLYEAFKASNTDIVGISRDSLKSHENF
    KAKFSFPFELLSDSEEKACTLFDVIKMKKLYGKEVRGIERSTFVVDEQGVLIREWRKVKVDGHAQQVLEFIQSL

    >gi|91776663|ref|YP_546419.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Methylobacillus flagellatus KT]
    MQLEKQTNSDLHRVVIVGGGAGGLELATRLGRTLGRKKKAHITLIDCTRTHVWKPLLHEIAAGSMNPDKHELDYIAQAHW
    HHFHFRLGRMDGLDRTKKEVTVAPYYDDGVEVIPRRTFKYDTLIIAVGSTTNDFGISGAREHSIALDTQNQAERFHRQLT
    NALMRAQTQAEPIQAGQLEVVIVGAGATGVELAAELHNTTRELAAYGLDKIDPDRDIKISIIEASDRVLPALPPKLSKAV
    DTELRKLGVHVYVGERVTEVTDKGVYTHSGRFIPSSLVVWAAGIKAPDFLRELDGLEVNRINQLVVKRTLQTTLDENIFA
    FGDCAACPWPGHDENVPPRAQAAHQQASMLVKTVKARVAGKSNLPEFTYRDYGSLVNLGRYSTVGSLMGAIAGGSMYIEG
    LFARLMYQSLYQMHLMALHGFFAVVLQILARLITRRTEARVKLH

    >gi|91776671|ref|YP_546427.1| rhodanese-like protein [Methylobacillus flagellatus KT]
    MPQIVVAALYKFVSLPDYQELQPGLLALCNAQGIKGTLLLAEEGINGTVAGSRAAIDALLTYLRQDSRMVDIDHKESFAD
    EMPFYRMKVRLKKEIVTLGVPGISPNKKVGTYVKPEDWNTLISDPDVVVIDTRNNYEYEIGTFKGAIDPATTTFRQFPEF
    VRKNLDPAKNKKVAMF
    CTGGIRCEKASSYMLEQGFKEVYHLQGGILKYLETIPEEESLWEGECFVFDQRVAVKHGLQVGD
    YDQCFACRHPISAADMASSKYVKGISCPRCYDRMSAEKRARIAERQRQIEIARQRGEEHIGDNARQYSLIHKLSKTKKIL
    PKT

    >gi|91776682|ref|YP_546438.1| methylated-DNA--protein-cysteine methyltransferase [Methylobacillus flagellatus KT]
    MFYHRYMEIKPPPSFDAVVTAPFGAIGIHVSNDYVTGIRLLSEQQRAFCSANPFVQHVARQVGQYLQDAASPLDFPYLLQ
    GTLFQKRVWQVMSTIPLGQAWTYGDLAERVKSGPRAVANACGANHLTLVIP
    CHRIVAKGGLGGFMQGDVKGLEIKRWLLQ
    HERADGYH

    >gi|91776900|ref|YP_546656.1| heavy metal translocating P-type ATPase [Methylobacillus flagellatus KT]
    MTSDQEHQCCNHANPSNSQPTVAKPDMGPAIETPHGSSSQSIFTIDNMDCPTEEALIRSKLLPMDGIEKLDFNLMQRKLT
    VTHTLDQPELIQQALIAISMHAVPIARTLGSSASAEMPAPNSHKRWWLLGLGGVAAILAEVIAWSTGTDKSWPVIALSLC
    AIASSGTGTYIKGWIALKNRNLNINALMAIAVTGAVIIGQWPEAAMVMVLFTLAEMIEALSLDRARNAIRGLLEMTPDKA
    HVLQEDGTWKEMEAATIMVGSIARVGPGERIALDGELTKGQSAVNQAPITGESMPVSKAIGDKVFAGTINETGSFEYRIT
    AAQTDSTLSRIIRAVEDAQGGRAPTQRFVDDFSKIYTPIVFILALSIAIVPPLAFSLPWLPWVYKALILLVIACPCALVI
    STPVTIVSGLAAAAKVGILIKGGVYLEEGRKLKSLALDKTGTITQGKPVVTDLVALSGEQKDSLKLAAALAERSDHPVST
    AVSVYWKAQAGAVVLDEVSDFEAITGRGVKGRIADQWFYLGNHRLVEELGICNATTESILSRLESEGKTAVVICSEATPL
    AVIGVADTIRETSRQAIIELHALGIRTLMLTGDNDLTANVIAKSVGIDDARGNLLPEDKLAVINAELASYETVGMVGDGI
    NDAPALAKSSIGFAMGAAGTDTALETADVALMDDDLRKIPQFIRLSMKTAAILKQNIFIALSIKVVFLVLAVIGAATLWM
    AVFADMGASLIVVFNGLRLLRSSSQNCP

    >gi|91777023|ref|YP_546779.1| DSBA oxidoreductase [Methylobacillus flagellatus KT]
    MKKLLAALMLLVSATALADPQLGNDFNQTAKTIKTDNPAKIEVLEIFWYGCPHCYHLEPSLASWVKKLPEDVYFKRVPGV
    PRPDWAPAGKAFYALEALNLTEKLHTQLFDAIHKARTINPAVEAQLIDWITKQGGQDRKKVEEAFNSFSTNNNVVRAMNT
    FRDSGATGVPALIIDGRYITSSSMAGGNQNVLKVADYLIENVRKEKSGGAK