Methylibium petroleiphilum PM1 uid58085

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|124265251|ref|YP_001019255.1| putative organic hydroperoxide resistance protein [Methylibium petroleiphilum PM1]
    MNKIENVLYRAQATATGGREGRAVSSDKVLDIQLSTPKELGGGGGPGTNPEQLFAAGYSACFLGAMKFVAGQKKQTLPAD
    TTVTGKVGIGGIPQGFGIEVDLAISIPGMAKADAEALVEAAHGV
    CPYSNATRGNIEVRLSVV

    >gi|124265311|ref|YP_001019315.1| hypothetical protein Mpe_A0118 [Methylibium petroleiphilum PM1]
    MTTSARGGNEDDWLVACLCAEWCGTCRDYRAVFEALAREQPALRCVWVDIEDDSDALAPLDLDIENFPTVLVARGAELRF
    FGTLLPHATTLARTLEAARGAALVALPAAQAEALVTTVRTIGQPVR

    >gi|124265314|ref|YP_001019318.1| 1-Cys peroxiredoxin [Methylibium petroleiphilum PM1]
    MPSLRLGDIAPDFEQQSTQGPLQFHAWLGDSWGVLFSHPADFTPVCTTELGLTARLKAEFSKRNVKVIALSVDPVDKHGA
    WIEDINRTQNAVVDFPILADADRKVSELYDLIHPNASTTATVRSLFVIDPAKKIRLTITYPASTGRNFDEILRVIDSLQL
    TEYHSVATPANWKDGDDVVIVPALQDAELIRQKFPKGYTAVTPYLRLTPQPNRA

    >gi|124265344|ref|YP_001019348.1| thiol:disulfide interchange protein [Methylibium petroleiphilum PM1]
    MNRRDFTTLSLATTCVGLLPAFGHAQGGPVEGKDYVKLSQRQPTQDPKKLEVVEFFWYGCPHCHAFEPMLETWVKKLPPD
    ITFRRLPVAFREVPFVLHQKLYFAIEALGLVDTLHRKVFTAMHVERNPLNTPEAIGDFVAKNGVDKAKFLDVMNSFSVQT
    KARQAAALSAGYKIDGTPAIGINGSYYTSGSLAGSNDRALAITDHLIAQIRKGG

    >gi|124265430|ref|YP_001019434.1| putative glutathione peroxidase transmembrane protein [Methylibium petroleiphilum PM1]
    MPTLATRSASATLSPRRRPWLGRSALRRLAIAALLCIVGSGAQAACPPLLDRSFPRLQDEKPQNLCQYAGKVVVVVNTAS
    Y
    CGFTSQYKGLEALHARYQSRGLVVLGFPSNDFGSQEPGSNQDIAAFCENTFGVRFPMFAKSSVKGSARNPLYADLAQRT
    GKTPAWNFHKYLIGRDGQVVLSFSSQTDPQDPVFVQEIEKLVDSQ

    >gi|124265487|ref|YP_001019491.1| putative thioredoxin protein [Methylibium petroleiphilum PM1]
    MIDITLQNFEAELIQASMQTPVLLDIWAPWCGPCKSLGPVLEKLEADYAGRFALAKLNSDDQPDIAGQLSQAFGVRSIPF
    CVMFVGGQPVDGFVGALPEAQIRSFLDKHVPSEDALAAEEEALEAEQLAAEGDNDAALAKLSDALAIAPGDDAIRADYVK
    RLLEAGRTADARRVYEPLAPKAIVDARASALGLWLDACEAAERARSPEALAAAIGADRRDFAARFELAQTLLAAQRPTEA
    MDELLEILMRDKAWSDERARKLYVAILELLSKPPPKVASPAEAKGTLEIAGKAAAVASDPVIDGYRRKLSMVLF

    >gi|124265511|ref|YP_001019515.1| hypothetical protein Mpe_A0318 [Methylibium petroleiphilum PM1]
    MKLMRYVAAAAAVLAIGIAATLALTGKQAVPDVAYTLLDGSQHRSEQWRGKVVLVNFWATSCVTCVKEMPDLAATHEKFK
    ARGYETLAVAMSYDPPAYVVNFTETRKLPFSVAIDHDGAIARGFGDVQLTPTSVLINKRGEIVKRYVGEPDFAELHRLLD
    KLLAEA

    >gi|124265599|ref|YP_001019603.1| hypothetical protein Mpe_A0406 [Methylibium petroleiphilum PM1]
    MADRTDNRPPAPYRELTLDISARLATLRTGVPDVMKGFGELGRAAMADGALDKKTKELIAVALSVAARCDPCIGFHMQAL
    AKLGASRQELDEALGVAVYMGGGPSLMYAAHAVAAYDEFARGPDI

    >gi|124265713|ref|YP_001019717.1| hypothetical protein Mpe_A0520 [Methylibium petroleiphilum PM1]
    MTQTTSSDVQQRIDQLVKSHRVVLFMKGSAQFPMCGFSGRAVQILKACGVTDLATVNVLEDDGIRQGIKDYANWPTIPQL
    YVNGEFVGGSDIMAEMYQSGELQPLLSTQA

    >gi|124265785|ref|YP_001019789.1| putative thiol:disulfide interchange protein [Methylibium petroleiphilum PM1]
    MKFKTAALAAATVAAIATTLALTAVAQVPQEAAIRKALGERLNSSAKIDEVNKAPIAGLFEVRIGNDVFYTDAEGAYLIR
    GEILDLKTKRNLTEERVAKLTAIDFASLPLKDAVVWKTGTGARKIAVFADPN
    CGYCKRFEKELSNVKDLTVYTFLLPILG
    GDSPDKANAIWCAKDASVAWRAWMVDGVQPPKLLGACASPVERNVELSRKHRVNGTPAIVFEDGTRVPGMLTAPQLEKQL
    ASVGKS

    >gi|124265907|ref|YP_001019911.1| putative transmembrane protein [Methylibium petroleiphilum PM1]
    MKFLLDNWYLVLAALASGGLLVWPLIARGGGPNRVSTAEAVMLINREKAVLIDVSEPAEYAAGHASNARNIPLAGLESGA
    KGLPTNKSLPVLVI
    CPTGARANRAVATLRKLGYEKASTVIGGLAAWREAQLPVEKSAA

    >gi|124265908|ref|YP_001019912.1| glutaredoxin 3 [Methylibium petroleiphilum PM1]
    MSSSTVKMFTTQVCPFCIRAKALLKQRGVEQIEEIRIDLDPAQRDAMMQATGRRTVPQIFIGDTHVGGCDELIALDQRGG
    LMPLLQQQSPA

    >gi|124266199|ref|YP_001020203.1| hypothetical protein Mpe_A1006 [Methylibium petroleiphilum PM1]
    MATESRDLVVVITHGIDHELSSAGMVIALGGMTAGLKVSIFLTSSGVDIVRRGASDTTHVKPLEPLADMLRDFVARGGTL
    WA
    CTPCVKSRGYAQEQLIEGVVIAGSSVMHELIKRGAATLSF

    >gi|124266275|ref|YP_001020279.1| putative molybdopterin biosynthesis protein [Methylibium petroleiphilum PM1]
    MNDDQLLRYSRHILLDEIGIEGQQRLLDGHALVIGAGGLGSPALLYLGTAGVGTITVADHDTVDLTNLQRQIVHDMARIG
    MPKAESAARSIAAINPAARVRALTERADAARLDALVREADVVLDCSDNFATRHAVNRACAVHRKPLVAGAAIRFDGQISV
    YDVRDAASPCYACLFPEDSAFEEVR
    CSTMGVFAPLVGIIGSMQAAEALKLLAGIGPTLAGRLQMLDGRAMEWTEIRLARR
    ADCPVCGPHRGPAG

    >gi|124266310|ref|YP_001020314.1| thioredoxin reductase [Methylibium petroleiphilum PM1]
    MTTPLHARVLILGSGPAGYTAAVYAARANLEPVLITGMAQGGQLMTTTEVDNWPADVHGVQGPELMQRFLEHAERFKTQV
    VFDHINAVDFSKRPFTLTGDSGRYTCDALILATGASAMYLGLPSEEAFMGRGVSG
    CATCDGFFYRDQEVCVIGGGNTAVE
    EALYLSNIASKVTLVHRRDKFKAEAILVDKLMEKVAAGKIELKLFHVLDEVLGDSSGVTGVRLKNTQTGETQDLMLKGCF
    IAIGHRPNTEIFQGQLEMKDGYIITRTGLNGFATMTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRFLEQG

    >gi|124266403|ref|YP_001020407.1| periplasmic protein thiol:disulfide oxidoreductase DsbE [Methylibium petroleiphilum PM1]
    MLRSLRYILPLGLFAVLVVFLWRGLGLSPTEVPSPLIGKPAPAFTLARLDDANQTLRRDDLLGKVWILNVWASWCVACRE
    EHPTLMEFARSKSVPVIGLNYKDTRPAGLEWLRRFGDPYDASAFDADGRVGIDFGVYGVPETFVIDQQGLVRLKHIGPLT
    PAVIETRIRPLLKALNG

    >gi|124266414|ref|YP_001020418.1| peroxiredoxin-like protein [Methylibium petroleiphilum PM1]
    MTLILQVPRRQALRLCAGAALGAYAGLCVPAIAPSTTAPDFTLRSMDGPNLRLQEQRGRVVMVNFWATWCGPCRQEMPHL
    NRLYEKYRASGFVLIGVNVDDDVRKAADVAAKLGVSFPVLLDTDKKVSRQYDLSTMPSTILIDRDGRVKYVHLGYKTGYE
    DTYDKQVRELLKQ

    >gi|124266476|ref|YP_001020480.1| thioredoxin 1 [Methylibium petroleiphilum PM1]
    MASELIKHVSDASFDDDVLKSGTPVLVDYWAEWCGPCKMIAPILDEVAKDYGSKLQIAKMNVDENRDVPAKFGIRGIPTL
    MLFKGGQLAATKVGALNKSQLTAFLDGHL

    >gi|124266550|ref|YP_001020554.1| hypothetical protein Mpe_A1357 [Methylibium petroleiphilum PM1]
    MPTITLYGIPNCDTVKRARAWLEARDVGYTFHDFKKQGVPPDALARWVSATGWETLVNRKGTTWRQLDPAVRESVVDASS
    AQRALREHPSLVKRPVVEWPGGVTVGFDEAVFSARLSH

    >gi|124266681|ref|YP_001020685.1| hypothetical protein Mpe_A1488 [Methylibium petroleiphilum PM1]
    MRAFSNNRRRFTLSAAAVIALPTALTALPGAALAVSIGEAAPDFELKDTHGKTVKLADFKGRHVVLEWTNPGCPFVQKHY
    SSQNMQSLQKEFVGRNVAWLSISSTARGATDYLEPAALQAKYQGWGAAPTALLMDDAGGVGKAYGAKTTPHMYVIDPGGK
    LIYAGGIDDKRSADPADVKGARNFVKAALTESLAGKAVSTGTATPYGCSVKYAS

    >gi|124266682|ref|YP_001020686.1| putative ThiO:disulfide interchange protein [Methylibium petroleiphilum PM1]
    MPQPFGPLFVAALASAALLLGGAAHAAAVRTDHVTAELVAERGAVAAGQTLRIGLKLQHIPHWHTYWRNPGDSGLPTTLS
    WTLPPGSRMGEIEWPAPERLPIGPLVNYGYEGEVLLPLQYTAPPDARPGDTLRLQAQARWLVCNDVCIPEQATLDLRLPV
    AEAAAADNAAPAAHAALFAQAAAAQAGPLSAWTAEVQQAGRDLLLTLEPAGGDLPADAPEVHVFPYAEQLLEPASHALYR
    GPRGYALKLKLLEGATVPARLDGIAVAQAAPGASGTAVWGGPQRSVEFSAPLRPVATITVPAGARAAAEDRGPASLRGSA
    PVGLLAALGLAFLGGMLLNLMPCVFPVLSIKLLGLARQEGDARRLRMHALAYGVGVVCSFVALAAALLALRAAGSAVGWG
    FQLQEPGVVFALALLFFLLGLNLAGQFEFGLLMPQGLAQWRAQRPAVDAFGSGVLAVVAASPCTAPFMGAALGYAIAQPP
    AQALGVFAALGLGMAWPYVLLVLRPGWRARLPRPGPWMLRLKQGLAFPMFATVVWLLWVLGQQAGIDGSTRALVALVGLA
    FGLWLASVWRGVAARAGVTVLLVAVLAWGWPVSERAASPQAGNGTASNAGSPHTAWQAYDEAAIDAHLAQGRAVFVDFTA
    AW
    CVSCQVNKRLVLHTDETLQAFTRSNVALMRADWTHRDERITAALGRLGRNGVPVYVLMRPGREPLLLPEILTGGLVRE
    ALSTL

    >gi|124266689|ref|YP_001020693.1| thioredoxin reductase [Methylibium petroleiphilum PM1]
    MDPQINPAITATANSHDGPIETDAVIVGAGPVGLFQVFELGLLEIKAHIIDSLAYPGGQCIELYPDKPIYDIPAVPVCTG
    KELTDNLLKQIEPFGATFHLGQEVTLVNKRDDGRFDLETSKGTRFITKTIFIAGGVGSFQPRLLKVDGLDQFDGSQLHYR
    VRNPSAFAGKNLVIVGGGDSALDWTLNFVQDGPNKAESVILVHRRDGFKAAPASVAKMKELCDAYEMQFIVGQVTGFEAT
    EGQLRSVKVTGGDGVTRVVPLDMLLVFFGLSPKLGPIAEWGLNIERKQVVVDTEKFETNVPGIFAVGDINVYPGKKKLIL
    SGFHEAALAAFGAAPYIFPEKRIHLQYTTTSPKLHKVLGVETPVFD

    >gi|124266731|ref|YP_001020735.1| putative bacterioferritin comigratory oxidoreductase protein [Methylibium petroleiphilum PM1]
    MTPALNKALPEFEAQATGGVKFTPQAYLGQTVILYFYPKDNTPGCTTEAMQFRDRHKDFVKAGAVVFGVSRDNMASHDKF
    KQNLELPFELIADTEEKLCHMFGVVKNKIMYGKKVKGIERSTFLIDPAGVLVEEWRGIKVAGHVDEVLKSVKALKKAA

    >gi|124266757|ref|YP_001020761.1| DsbA oxidoreductase [Methylibium petroleiphilum PM1]
    MKRMKIDFVSDVVCPWCAIGLNALEQAIQRLDGELSVELHVQPFELNPQMPPEGEEIVAHLTRKYGITPEDCARNSEMIR
    LRGETVGFRFGRRSRTYNTFDAHRLLHWAGLEGRQRELKHALLRAYFTDGENVADPGLLVSVAGEAGLDPQRAQALLASD
    EFAAEVREQEQLWLDRGIHSVPSIVIDGRHLVQGGQPVEVFEQVLRELAGRA

    >gi|124266797|ref|YP_001020801.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Methylibium petroleiphilum PM1]
    MTRLTLKGTPVYTEGHLPVVGHEAPKFTLTGKDLVDVGLEQFGMQRKLLNIVPSLEMPTCAASLRRFNDHARQTPGTVVL
    SISHDLPFATQSRIDAAQLDRVVALSLFRSPHFARAYGVDIVSGPLKGLTARAVLVLDGHNRVLHAQLVREITDEPDYAL
    AAAALTRSC

    >gi|124266833|ref|YP_001020837.1| P1 ATPase/HMA domain-containing protein [Methylibium petroleiphilum PM1]
    MNTAALSDIKLQVTGMTCASCVMRVEKSLKAVPGVRQASINLATEQAVVSADPAVTADTLAAAVRKAGYDLATTETTLLV
    EGMT
    CASCVSRVEKALRKIPGVSGATVNLATEKANIQALSTVSVAALKAAIEKAGYSAKDVQDAKSQPAARLPAWWPVAV
    SGALTLPLVLPMLLQLFGIDWMLDGWLQLALVTPVQFWLGWRFYRAGWKALLAKTGNMDLLVALGTSAAYGLSVYLLFKH
    AAHGMPHLYFEASAAVITLVLLGKWLEQRAKRQTADAIRALNALRPTTARVRRGEVELDLPVEHVVVGDLVIVRPGDRVA
    VDGEIVEGRSHIDESLITGESLPVAKGVGDKVTGGAINAEGALTVRTTAIGAETTLARIIRMVESAQAAKAPIQRIVDRV
    SAVFVPVVLVIALLTFLGWFGFTGDWEHALINAVAVLVIACPCALGLATPTAIMAGTGVAARHGILIKDAEALEVAHAVT
    VVAFDKTGTLTEGKPLLAAVVAAVGSTRDDVLRLAAALQKSSSHPLAVAVMDQVRHERLLVPEAHDAQALPGRGVQGAVR
    GQTLALGSTRMLRELGLEEGGLHAEAQRLERQGQTVSWLVQSDVAQRRLLGLLAFGDTVKPAAAQAVSRLHQLGIRTVML
    TGDNRGAADAVAKELGIAEVRAEVLPGDKAAIVKELRDAGEVVAFVGDGLNDGPALAAASVSYAMAGGADVATETAGITL
    MRGDPRLVADSLDISRRTYSKIKQGLFWAFGYNVLGIPLAALGLLNPVIAGAAMAFSSVSVVLNALTLRRWHGVANEHSA
    QPTNQQPRIVAALGEQR

    >gi|124266839|ref|YP_001020843.1| disulfide isomerase-like protein [Methylibium petroleiphilum PM1]
    MSPLLPWVSACIGSRHRAPRTRRCAPSRPGWCACTRRCSAPKGAPVTIVEFFDPACETCRAFYPIVKSLMAKYPDDVRLV
    IRYAPFHQGSDQVVKLLEAAKRQGKFLPVLEAVLQAQPTWADHGRPNPDLTFEIAKAAGLDIERAREDMAQPAMQTLLAQ
    EVEDLTALQVQRTPTFFVNGRSLPSFGPDQLAALVAEEVAKAKR

    >gi|124266856|ref|YP_001020860.1| PBP/HMA domain-containing protein [Methylibium petroleiphilum PM1]
    MKLVPILMAGLLASAGTAAAGSRTVTLDVTKMDCAVCPITVRKALEKVPGVENAKVDFKSKRAIVAFDPAKTSPEALARA
    TADAGFPSSVNQGQ

    >gi|124266957|ref|YP_001020961.1| methionine-S-oxide reductase [Methylibium petroleiphilum PM1]
    MSSTDDKPRKVQKTEAEWRAQLDPMQFEVTRHGATERAFTGKYADHWQEGVYHCVGCNAPLFDSGTKFDAGCGWPSYFQP
    LRGEIIDRVVDRSHGMVRVEVRCQDCGAHLGHVFPDGPEPTGERY
    CINSASLGFEPRK

    >gi|124266958|ref|YP_001020962.1| hypothetical protein Mpe_A1768 [Methylibium petroleiphilum PM1]
    MQDVSLPELDRPDATPLGLHWRNRYAALGPVFHTRLAAQALPQPHWVATSDSAARLLGWPGDWAERADWQALEVLSGGRT
    WPGSEPLATVYSGHQFGVWAGQLGDGRALLLGEIDTPNGPMELQLKGAGRTPYSRMGDGRAVLRSSIREFLCSEAMHFLG
    IPTTRALAVVGSPLPVRRETVETAAVVTRVAPSFVRFGHFEHFAHHGLPEALRTLADFVIDQHHPACREAANPYAALLET
    VARRTATLLADWQAVGFCHGVMNTDNLSILGLTIDYGPFGFLDGFDPGHVCNHSDHQGRYAYSRQPSVAFWNLHALAQAM
    LPLIAMGGEVTEATGDLALEAIEPYKHTFSEAMAARLRAKLGLAGERDEDVALADDWLQLMATERADHTITWRRLAQWSP
    AEPQAVRDLFLDRPAFDAWADRYARRLALDGRAEAERRLQMDRANPKYVLRNHLCENAIRAAQGGDFGETQRLLKVLERP
    FDEQPEHSAYAEFPPDWAQTLEVS
    CSS

    >gi|124267199|ref|YP_001021203.1| dihydrolipoamide dehydrogenase [Methylibium petroleiphilum PM1]
    MSKTFDVVVIGGGPGGYIAAIRAAQLGFNTACIDEWKNDKGGPAPGGTCTNVGCIPSKALLQSSEHFEHAGHAFADHGIG
    LKDLSIDVAKMLGRKDTVVKQNNDGILYLFKKNKVSFFHGRGSFVKAGDAGYEIKVSGATEDTLIGKDIIIATGSSARAL
    PGAPFDEESILSNDGALRIPSVPAKLGVIGSGVIGLEMGSVWRRLGAEVTVLEALPTFLGAVDEQIAKEAQKAFMRQRLK
    IELGVKISEVKKDKKGVSVSYTSAKGDAKTLEVDKLIVSIGRVPNTTGLNAEAVGLKLDERGAIVVDDDCRTNLPKVWAI
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFNTIPWVIYTSPEIAWVGQTEQQLKAAGRAYKAGTFPFLANGRARALG
    DTTGMVKFLADAATDEILGVHIVGPMASELIAEAVVAMEFKASAEDIARICHAHPSLSEATKEAALAVDKRTLNF

    >gi|124267281|ref|YP_001021285.1| alkyl hydroperoxide reductase, F subunit [Methylibium petroleiphilum PM1]
    MLDAALKTQLKSYLEKVEHPIDIVASVDEGDKSQELLALLNDIAELSARITLSVRRDDAERKPSFSLNRPGARIGLRFAG
    LPMGHEFTSLVLALLQVGGHPSKAAAEVIEQVRGLEGDYLFETFFSLS
    CQNCPDVVQALNLMAVLNPNIRHVAIDGALFQ
    AEVEQRQVMAVPTIFLNGQVFGQGRMGLEEIVAKLDTGAVKREAAKLSAKAPYDVLIVGGGPAGAAAAIYAARKGIRTGL
    AAERFGGQVLDTLAIENFISVKETDGPKFAVALEEHVKAYDVDIMNLQRAEALIPGKPGELTEVRFAGGAALKASTVIIA
    TGARWRDMNVPGEQVYRTKGVTY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGVVAHVTLLEFAAELRADAVLQRKLH
    SLPNVKVITQAQTTEVTGDGHKVNGLTYTDRASGEVHQLTLEGVFVQIGLLPNTDWLKGTVELSRHGEVIVDARGQTSVP
    GVFAAGDVTTVPYKQIVIALGEGSKAALSAFDHLIRSTAPALA

    >gi|124267282|ref|YP_001021286.1| alkyl hydroperoxide reductase protein [Methylibium petroleiphilum PM1]
    MSLINTEVKPFKATAYHNGKFVPVSNENLLGKWSVFVFYPADFTFVCPTELGDLADHYAEFKKLGVEIYGISTDTHFAHK
    AWHDTSDTISKVQYPLVGDPTAALARNFEVLIEEEGLAYRGTFVINPEGKIKIIEVHDNGIGRDATELLRKVKAAQYVAA
    HPGEVCPAKWTEGAETLKPSLDLVGKI

    >gi|124267311|ref|YP_001021315.1| NADPH-glutathione reductase [Methylibium petroleiphilum PM1]
    MKSYDFDLFVIGAGSGGVRTARMASERGLRVAIAEVSRLGGTCVNVGCIPKKLFVYAAQFTEAFQQARGYGWRVPEAAFN
    WSTLRDNKDAEIERLNGVYRALLVDSGCQLIEGHATIKGAHTVAVDGRSWSTERMVIATGGWPFVPNVPGREHAITSNDF
    FLLEHFPKRAVIVGGGYIALELASIAAGLGAQTRLVYRGALFLRGFDEDIRRVAAEEMMRRGVFLNFGCEISAIEKQADG
    SLLVTFSNGRRESTDCVLYATGRLPNVAGLGLENTRIRQQAHGAIVVNEHLQTDEPSIYAIGDAVGRTQLTPVALAEGMQ
    LVRHLLGDEGPQVDYEMVPSAVFSLPAIATVGLTEAQARLRYKDVVVYKSSFRALKQTLAEGNERTFAKLLVDHDSDRVV
    GVHMVGADAAEIIQGMAIALRAGATKQVFDTTLGVHPTSAEEFVALRKPSHEPFITTGP

    >gi|124267313|ref|YP_001021317.1| dihydrolipoamide dehydrogenase [Methylibium petroleiphilum PM1]
    MAMIDIKVPDIGDFKDVAVIELLVKPGDTVAADQSLITVESDKASMEIPSSHAGVVKALKLKVGDTVNEGSVILSLDAAS
    AAAEPAASSAAAAAPAVAAPAAAAVAPSAASYAGGADVECDLLVLGAGPGGYSAAFRGADLGLKVVLVERYATLGGV
    CLN
    VG
    CIPSKALLHVAAVMDEVSHFEALGVSFGKPSVDLARLKAHKDKVVGKLTGGLAAMAKMRKVTVVTGSGEFVDPHHLKV
    VPSKDGAPQTIRFKQAIIAAGSEAVKLPFLPKDDPRIVTSTGALELRQQPKKMLVIGGGIIGLEMGTVYSTLGAKLDVVE
    MLDGLMQGADRDLVKVWQKMNAPRFDKLMLKTKTVGAEATKDGVRVQFEGLDGTKSEGVYDLVLQAVGRTPNGKKIGAEK
    AGVLVGERGFVPVDIQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVAAGAVLGDAKLATSSFNARVIPSVAYTDPE
    VAWVGLTEDEAKARGVKVKKGLFPWTASGRAIANGRDEGFTKLLFDEATHRIVGGGIVGTHAGDMIGEIALAIEMGADAV
    DIGKTIHPHPTLGESIGMAAEVAHGSCTDLPPAKR

    >gi|124267320|ref|YP_001021324.1| hypothetical protein Mpe_A2133 [Methylibium petroleiphilum PM1]
    MSRSAAVLLFSLVALGSGPALAQYKIVEPDGRITYTDRPAPSAAAKVQPIRGGAAVAGTPSGLPYELAQIAERYPVTLYS
    GSD
    CSGCVAGRDMLRQRGIPYTEKTITGEADIAAFRQIESSAELPVLRIGGQQLRGYSEAEWRGYLDAAGYPKQSRLPPT
    YRGWEPTPLVGQTTAPRAAPAPRPAAEAPAALPPALEAAPNGIRF

    >gi|124267329|ref|YP_001021333.1| methylated-DNA--cysteine methyltransferase [Methylibium petroleiphilum PM1]
    MPPRSFAAQARADTPLGPITLAATERGLAGLWFDGQKHHPGTIDAPVDAGQRWIVQALDELADYWRDGSAPFTIALDPQG
    TPFQQSVWEALRGIAAGRTLSYGGLAQQLGRASAVRAVGAAIGRNPVAVIVP
    CHRVLGTSGSLTGYAGGLERKAALLRLE
    GTLL

    >gi|124267385|ref|YP_001021389.1| selenophosphate synthetase [Methylibium petroleiphilum PM1]
    MVERELGRRAHVDHGVEAGEVVDGSRAVAHRRAARFGLIDTCIMESIRLTSFSHGGGCGCKIAPGVLADILSRAPAGLIP
    PDLLVGTETADDAAVYRLNEHQALVATTDFFTPIVDEPYDFGRIAATNAISDVYAMGGTPILALALVGMPLDKLPPAVIG
    RILEGGASVCREAGIPIAGGHSIDVLEPIYGLVALGLVHPERVRRNADARPGDVLVLGKPLGVGVLSAALKKGRLDAAGY
    AEMLRLTTQLNRVGSELGALDGVHAMTDVTGFGLAGHLLEVCRGSGLAAEVDLASVPWIDIARGFAQEGIVTGASARNWA
    GYGDHVDLGPQVEPWQRALLSDPQTSGGLLVSCAPGAVDAVLAAFWRAGFAAAASIGRLQSGAARVRFA

    >gi|124267447|ref|YP_001021451.1| hypothetical protein Mpe_A2260 [Methylibium petroleiphilum PM1]
    MAVTLTPAAARHVTRYLGKRGKGVGVRLGVKTTGCSGLAYKLEYADEAAPEDVIFEDQGVKVLVDPKSLPYIEGTQLDFV
    REGLNEGFKFNNPNERDRCGCGESFRI

    >gi|124267530|ref|YP_001021534.1| arsenate reductase [Methylibium petroleiphilum PM1]
    MSTVTIYHNPDCGTSRNTLALIRASGIEPTVIEYLKTPPDRETLKALIARMGMGVRDVLRIKGTPYKELGLDAAHWSDDQ
    LIDQMLAYPILINRPIVVSRSGVRLCRPSDTVIDLLPQRPAGENRKEDGTPLLVDTPIAGSDPDLALALQEAVLPTDDLA
    EPGRSFFAYATVSGERVGYGGFERLGRDVLVRSLVVLPHARHRGIGGGMFALLLRRAFDEGGRDAWLLTTTAAPFFERAG
    FKPIERSAAPAAILATRQAASLCPSSAVLLGRRMSL

    >gi|124267581|ref|YP_001021585.1| hypothetical protein Mpe_A2395 [Methylibium petroleiphilum PM1]
    MRMPSFARRHPWIGLLIVVTIGVASWMLLRAPHPATEPMSLAAAGSEAPKPAGPPWLYGRADARFTVVGYADLECPYCRA
    YFPALKRWIDAHPEVNWQWHHLPLSMHEPAATAGARLVECAGETGGHATFWQAVAWLYSNTRGDGHGLPEGLRYPDLTPA
    MQGCLDSDRPDAVIRAQAVEAAQQGIAATPALQLRDRESGKTLLLHGPVEGDALLSAIDLLAAGSTTAAEPAHSPDMPAG
    VAGDMPR

    >gi|124267612|ref|YP_001021616.1| hypothetical protein Mpe_A2426 [Methylibium petroleiphilum PM1]
    MTELPWSRRAILAAAAGGLLPMPAAAQQPGASPAIDWPTIALVDGTVLQPADWNDTAAVVVFWSTTCPFCRRHNEHVEKL
    HRASAGRRLRVLGVAVDRDAGVVRRYLADRGYGFPVSMSAQRLRPLFTSRNVIPMTCAVGRSGRLLQSIPGEMFEEDVLD
    LLRLADRPDRTAGMQDTSRCAT

    >gi|124267665|ref|YP_001021669.1| putative cation transport P-type ATPase [Methylibium petroleiphilum PM1]
    MPATTLTLAAPALALPPTELSGRQRVALDDDTALAACTTWQEAADGRREARTRLVLQGLHCAACAGLIEAALERVDGVRA
    ARVNGASERAEVDWDPARTRASALIEAVQRAGYQAYLADAEDALRARQAESRQALWRLFVAAFCMMQVMMAAAPGYFAAP
    GDIAPDLAALLRWSAWVLTLPVLLFSARPFFSGAWQSLRQRRIGMDVPVALGIAVTFVASSAASFDPGGIFGHEVYFDSL
    TMFVCFLLAGRWLEARSRERSTRSLDALLRRLPDSVERLAADGSVAWVPAARLAAGDRVRVAVGQAFPADGCLIEGRTQA
    DESLLTGESRPLVRGVGDAVIAGSLNLGAPVLMRVTQVGHGTRHQQIVALMQRALTERPSTVRWADRVAAPFVGGVLLLA
    AAAFGVWMHVDPSRAVWVAVSILIVTCPCALSLAAPSALIAATGALARRGVLVQRLDALETLAQIDVACFDKTGTLTEDR
    LALAQVVWPDGDDLQAWQRRAAALAAHSRHPLSQALVRATPSEDAASWPWHGAREQAGQGLEALDADGRRWRLGSAAWVG
    VVPPTDLARPAVWLAPQDGTAAPPHARFEFDEVLRPDTAGLLQSLREQGIRLRLLSGDRAGAVQAVAQRLGLADARHDAT
    PQDKLASLRALQRQGHRVLMVGDGLNDGPVLAQADVSVALGHGAALAQQRADIVVLGSRLGEIAHARGVARRCAAVVRQN
    LAWAAGYNAVCVPLALLGWLPPWAAGLGMALSSLVVVGNALRLAR

    >gi|124267710|ref|YP_001021714.1| dihydrolipoamide dehydrogenase [Methylibium petroleiphilum PM1]
    MTPVRDVDVAILGAGSAGLSAYRAAREHTDRVLLIDPGPLGTTCARVGCMPSKLLIAAAEAAHAVDDATRFGIDVQGVRI
    DGARVMARVRAERDRFVGFVLDDIERIAPDHRLDGVARFLDPHHLQVDGPGGALTVRADRMVIATGSRPRLPPEWRSALG
    DRLIVNDDVFDWQDLPRSVAVVGTGAIGLELAQALHLLGVRVRLLGRGPTVGPLSDPALAALAASHFDATLPLQRDATVQ
    RVERLGDEVAVHWRSASGTQSEHFDVLLAAIGRRPNTDALGFEHTGLDCDADGVPLRDPTTMRIGHSHIFIAGDAGDDRP
    LLHEASDEGLIAGHNAGRYPDVQAGRRRTPLAVVFCEPQIAMAGRSHRELTAAGTRFATGTVSFENQGRSRVIGRNVGAL
    HVYGERGTRRLLGAEMLGPAAEHLGHLLAWSIGRGETVDEALAQPFYHPVIEEGVRTALRQLRQALDRPEPAPCEGCAPG
    D

    >gi|124267740|ref|YP_001021744.1| disulfide bond formation protein B [Methylibium petroleiphilum PM1]
    MSVATARLHHASVFHRLPRGVLALVALACITAVGGALVAQHVFGMLPCPWCIFQRVLYLAIAVVALIGWAAPVCAVTVVT
    SGLVLALSVGGIASAVFQHQVAAKDSS
    CAFTLADRFLSATGLETAVPWLFQVTATCAEAASARLLGQPFEVWSGLLFALI
    GLTAALLLWHRRLRA

    >gi|124267821|ref|YP_001021825.1| 3-mercaptopyruvate sulfurtransferase [Methylibium petroleiphilum PM1]
    MNRVASTLPMPLIDAEALRERLAAGAPTVVVDTSFDLADPAAGERSYREGHLPGAHYLHLDRDLADHTPATDGRFRGRHP
    LPTREAFAATLTRLGITPATPVVVYDRQGAMFAARAWWMLRWLGHREVTVLDGGLAAWRAVGGALESETPAAVAARPAYG
    PAASLVPTVDAAALQAGLGRVRLIDARAPERFRGDVEPLDPVAGHIPGALNRPFKDNLDAEGRFLAPAALHAAFLPLLAG
    RPPAESVQQ
    CGSGVTACHNLLAMERAGLPGAALYPGSWSEWCADPARPVARG

    >gi|124267839|ref|YP_001021843.1| hypothetical protein Mpe_A2654 [Methylibium petroleiphilum PM1]
    MNALTVSVVLLWAAVLVLGVMLWALSRQVGILYERVAPMGALVTDAGPPVGAPSPSFALTSLQSEPVTIGGIQAGPTLLF
    FLSPT
    CPVCKKLIPVLKALLRDEGRRLRIVLASDGEATAHRRFVREYGLDALPYVLSTELGMSYRVSRLPYAVLLDTQGV
    VAAKGLVNSREQFDSLLNAHEMGAPTIQHYLSGTSAAA

    >gi|124268099|ref|YP_001022103.1| cyclohexanone monooxygenase [Methylibium petroleiphilum PM1]
    MDKASSSSGSAGRGAPTTLDVVVVGAGFAGLYALHLLRKKGYSVRVYEAGDGIGGTWYWNRYPGARCDIESIEYSYSFDE
    QLQQEWDWPARYADQADILKYINHVADRFDLRRDIQLETRVTSAHFDEKASRWTVTTNRGETVSAQFCIMATGCLSTPKQ
    VDVEGIDDFAGQ
    CYHTAAWPRGGVDFSGRRVGIIGTGSSGIQAIPHIAKQAKHLTVFQRTPNFSIPAWNHPLDDEQRRVQ
    KAEYADLRQREWNSILGISRFPVNPNRALDATPEEREREYEARWAMGGLSFYTSYVDLLVDPRANETLAEFARRKIRQKV
    KDPKVAEMLVPKGYPFGTKRLCADTDYYETYNRDNVTLVDLRATPFQKFSASGVTTQDGRFHELDALITATGFDALTGTL
    CNMDIRGRGGEVLGDKWKGGPRTALGIMSARFPNMFVTTGPGSPSVLFNMILGNEYHVEWIVRAIEDVRKAGRVAIEPTQ
    AIEDFWCQHVTDVGNQTLFTQADSWYMGANVPGKPRQILLYLGGFPAYKATCEDIVAKGYEGFAMV

    >gi|124268118|ref|YP_001022122.1| methionine-S-oxide reductase [Methylibium petroleiphilum PM1]
    MNTSANLETATLGGGCFWCTEAVFQEVDGVVAVESGYSNGHVNDPSYEQVCGGETGHAEVIRVQFDPQRIGFRELLEIFF
    VVHDPTTPNRQGNDVGTQYRSGIYTHSDEQARIAHEVIAELQASGGVRGKVVTEVKPELNYWPAEAYHQNYFVQHPGQGY
    CAFVVAPKVEKFRKTFASRRKV

    >gi|124268308|ref|YP_001022312.1| hypothetical protein Mpe_A3124 [Methylibium petroleiphilum PM1]
    MECTVRWQPEAGMAFNAETGSGHLLSMDGAPDGGGRNLAPRPMETVLAGTGACAAYDVVLILKRGRHDIRGCEVKLNAER
    ATADPKVFTKIHLQFVVRGRGLPAAAVERAVALSHEKYCSASAMLGKTAAMTTGVEIVEV

    >gi|124268337|ref|YP_001022341.1| putative HesB-like protein [Methylibium petroleiphilum PM1]
    MSAVAEHIATQMPAPIVFTDSAAGKVKELVEEEGNPELKLRVFVQGGGCSGFQYGFTFDEIVNDDDTKMEKNGVMLLIDA
    MSLQYLVGAEIDYKEDLEGAQFVIKNPNATTTCGCGSSFST

    >gi|124268356|ref|YP_001022360.1| putative lipoprotein [Methylibium petroleiphilum PM1]
    MMMRRLAVLTVCAALGLLAACDPADKPAEPFKGIDITGADYARDFALSDVEGHPRTLADFKGKATVVFFGYTQCPDVCPT
    TMAELAAVKKQLGADGDKLQAVFITVDPERDTPEILKAYMSSFDPSFVALRSTPEQTQAVAKSFKAFFRKVPGKAADSYT
    MDHTAGAYVYDPQGRLRLFVRYGQPIEAWVADLKQLLA

    >gi|124268388|ref|YP_001022392.1| thioredoxin family protein, putative [Methylibium petroleiphilum PM1]
    MNPPPIASARRRRLVFGLGAGAGVAAGVWLALRQQAPALDPTVTALWASSFDRPEGGTLAMQSLRGKPLLINFWATWCAP
    CVRELPEIDRFHRDFQSKGWQVVGLAVDGPTPVREFLGRLKLGFPIGLAGFEGSELSRQLGNEQGGLPFTVAFDASGRPV
    QRKLGETRYEDLAAWARELG

    >gi|124268456|ref|YP_001022460.1| osmotically inducible protein C [Methylibium petroleiphilum PM1]
    MAVPAIAAHHSAGAVAMIEKNASVHWEGRGKEGQGQVSTETGALQAYPYGFGSRFEDDRRGSNPEELLGAAHAACFTMAF
    SFACDKAGFATTAVDTRAAVRLAKQGEGFVIDRIALQLDAAVPGIDEAMFQQLAQSAKEN
    CPLSKALASVPSITLVATLR
    R

    >gi|124268599|ref|YP_001022603.1| disulfide reductase [Methylibium petroleiphilum PM1]
    MPPVTPIRFLRTLLLWLTALLPLFAAAAEDFLPPEQAFRFDARVLDGKSIEIGFVVADGYYLYREPFKFEAQGGGVVLGA
    PEIPSGTVKFDETFEKDVETYRGRVAIRLPVDAAPASFQLVVTSQGCADQGLCYPPMQSVADVRLAGFGGDGSVRVPADG
    RGLDGALAASRASASMAGASRSGDAAIDHALRSGRFWLVVFAFFVAGLLLSFTPCVLPMLPILSSLIVGQGGQAVARSRG
    LLLAGAYSLGMALVYTALGVAAGLAGEGLAAALQNAWVLGAFSLLLTLLALSMFGAYELQLPAVLRDRLAASSGRLQGGR
    LAGVFAMGGVSALIVSPCVAAPLAGALLYISQTRDVLLGGSALFSLAAGMSVPLLLLGASAGALLPRAGAWMESVKRFFG
    LLLLAVAWWMLSPVVPAPLAVAGWGVLLIGAAVFLHAFDRLPEIAGADLRLVKGLGLALAVAGATQIVGAAAGAQDALKP
    LQPFVVGISPAAAAALPGNAIAATHDGVSFRRVSTVEELDAAVRGAGRPVMLDFYADW
    CVSCKEMERFTFTDPAVQARLG
    KALLLQADVTRNSESDRALLKRFQLFGPPGIVFFDAGGRELETRVIGFQNAQRFQQSLQSAGL

    >gi|124268617|ref|YP_001022621.1| AhpC/TSA-family protein [Methylibium petroleiphilum PM1]
    MLKVGDKLPEGALQEFIEVEGEGCSLGPNTFEIGKLTAGKTIAVFALPGAFTPTCSAQHVPGFVKHADAFKAAGVDEIWC
    LSVNDAFVMGAWGREQGTGGKVRMMADGSAAFTQATGLTLDLNARGMGLRSQRYSMLVVDGTVKTLNIEAPGKFEVSNAE
    TLLAQAGAL

    >gi|124268666|ref|YP_001022670.1| rhodanese-related sulfurtransferase-like protein [Methylibium petroleiphilum PM1]
    MTPTPNPHARIARRALLQAAACAALTLPAAARAQALPAAPKVDLETARTAAAAGQALLIDIREPDEHAATGVAPGALRLP
    LSQIKERQSEIPRDPARPVLLI
    CRTQNRSSKLAAMLQAQGYTNVSYVDGGMKEWTGRHFPTEAPPPR

    >gi|124268719|ref|YP_001022723.1| copper-translocating P-type ATPase [Methylibium petroleiphilum PM1]
    MMNTAASPPLTLSIEGMSCASCVLRVEKALKKVPGVTEAVVNLATETAQVRAAPGTLPSVLEAAVHAAGYEAHAAPADGP
    PPTVAPSEAARGWPVAVAALLSLPLALPMLALLWGGHAMLPAAWQWALATPVQFWLGARFYRNGWHALRAGSGNMDLLVA
    LGTSAAYGLSVWQLLWGHATHGDPHLYFEASAVVITLVLLGKWLEARAKRQTTAAIRALQALRPETARVLRDGVETELPL
    TALVRGDLVVVRPGERLPVDGLVEEGASHLDESLLTGESLPVARAAGERVIGGALNGEGLLRVRATALGAESTLARIVRL
    VETAQAAKAPIQQGVDRVSAVFVPVVLGIATLTLLGWGLAGGDWSQATLNAVAVLVIACPCALGLATPAALMAGTGVAAQ
    HGILVKDAAALEAAQGLRAVAFDKTGTLTVGRPTLVEFKATTSAHDATLALAAAVQAGSEHPLARAVLSAARARSLALAA
    AQDVRAVAGRGVAARVGDRSLGLGSTRWMRELGVDLGPLEALAAEHQRQGRTVSWLADLGDAAAPSLLALLAFGDTLKPT
    AEAAVRHLQRLGLRTVLVTGDQPGAAQAVARALGIDEVRAEVLPADKAAVIAGLRSESGSVAMVGDGVNDAPALAAADVG
    VAMVNPDGGGTDVAMHAAGITLMRGDPALVADAISISRHTTRKIRQNLFWAFVYNAVGLPLAAFGLLSPVFAGAAMALSS
    VSVLGNALLLRRWKPEEDR

    >gi|124268831|ref|YP_001022835.1| hypothetical protein Mpe_A3647 [Methylibium petroleiphilum PM1]
    MLECRLRHSCGTQRVQALIALVVQHGLIVVFATTLAARIGVPLPAAPLLVVAGGLAVGGTLSLPALLAVAVVANVLGDAA
    WFVAGRHHGHRVLGLLCRISLSPDSCVRQSEALILRWGGSSLVAAKFVPGVSVVAAPMAGAVGMSAARFVAYDALGGAVW
    SLVFLGLGAVFSTQIQALLDVLARAGAAATALLLLAVAGFVLWRYLRRRRFRNAAAMSRITQAELQALIDEGAEPVILDV
    RSGAAAGLDLRHIPGAWRVELSEVATHASQLPRDREIVLYCN
    CPNEASAATAAQALRAAGLPRVRPLAGGLEGWAAMGRA
    VAEGRPPPLS

    >gi|124268869|ref|YP_001022873.1| glutathione peroxidase [Methylibium petroleiphilum PM1]
    MITTTIYDFEARSIDGRTVSLADYRGKVLLIVNTASACGFTPQFAGLQSLWQAYGERGLAVLGFPSNEFGGQDPGSNDEI
    ASFCQLNYGVSFPMMAKVEVNGAGAHPLYRWLTGEVKGLLGTRAIKWNFTKFLVGRDGRVLGRYAPTDKPESLTRDIEAA
    LAA

    >gi|124268937|ref|YP_001022941.1| transcriptional regulator Ada / DNA-O6-methylguanine--protein-cysteine S-methyltransferase [Methylibium petroleiphilum PM1]
    MNMSTQTEQRAAATVNDPRWAAVVARDGAADGRFFYSVRTTGVYCRPSCAARPARPENVAFHDTAEAARAAGFRPCLRCK
    PDQLPAAALQAARVAELCRYIETADAVPPLADLARRAGLSPYHLHRVFKAVTGLTPRAYATAHRARRLREALGRRGGTVT
    DAIYDAGFNSGGRYYETADGVLGMTATRYRAGGAGTAIRFAIGQCSLGAILVAQSERGICAILLGDDPDALARDLQDRFP
    QARLIGGEADFEDWVARVVGFVEAPGLGLDLPLDVRGTAFQQRVWQALRDIPPGRTASYAEVAARIGAPTAVRAVAQACA
    ANALAVAIP
    CHRVVRSDGALSGYRWGVERKRQLLALEQEAITP

    >gi|124262773|ref|YP_001023243.1| thioredoxin 1 [Methylibium petroleiphilum PM1]
    MAKIVTPAELEQLIASGKPVVADFFADWCQPCKMMAPTVDAAAEAFAGRAEVVKVNIEADDGLMPKYGLRGVPTFIVFRG
    GKQAAAKSGALGRSAFLDWAGAQIG

    >gi|124262886|ref|YP_001023356.1| disulfide isomerase [Methylibium petroleiphilum PM1]
    MQYITSTCNNSRIETQTQRSPLQPPMKRTILTLAAAAATLFAGAALADAKTDSILLNLKVKYPATTFTGVRATPLQGIYE
    VQMGRNLAYVDESGRTFLFGSMYDMEARSDLTAARKTELGIQDAPAPQQQRAEAPPIKWSDLPMADAMVRVIGKGERKLA
    LFSDPD
    CPFCRQLERELEKLDNVTIYTFLYPLASLHPGAPAKSENIWCAGEKARNKVWIDQMIGGKTPPAAKACATPLER
    NVALGDSLNVRGTPTMFTSDGRRISGAMPAARIDAWLNAGK

    >gi|124267842|ref|YP_001021846.1| hypothetical protein Mpe_A2657 [Methylibium petroleiphilum PM1]
    MLISTVEKEALSPYMRKIADDLYPRVDPLFMPHFERYMGLLGNAPEHAERFFPYYFGIWFDNGLGPRITELARLAIANGT
    QCQL
    CLAVRYTAEVGEADVAALPGVDASTLTPAERAVVRFATHFGNDHHKVTPEHFEDLQRHFSDEQITELLLWSAMALG
    LGRILKVAQLVDDSCPLPARDGSARTETIAAA