Methylacidiphilum infernorum V4 uid59161

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|189218086|ref|YP_001938728.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component [Methylacidiphilum infernorum V4]
    MNNFDVVVIGSGPGGYVAAIRAAQLGLKVAIVEKDKTLGGTCLNVGCIPSKALLSLSEYFHFARQKFASNGLMVEELSFD
    LEKMMEKKERIVQKLVRGVDFLMNKNGIEQFHGVGSLSDPQTVIVKDEKRGELKIKAKNIILATGSRPATLPFLASFDDQ
    IVDSTSALSFKSVPKSLAVIGAGAVGLELGSVWNRMGSKVYVIELFPRICPLMDYDVSKHLESFLKNQGMEFFLETRLLG
    IKKDSGEVVLELASQSKTLSLNVEKVLVAVGRIPHCQELQLEEIGIRRTKKGYVEVNSRWQTTQAHIYAIGDVIEGPMLA
    HRAQQEGIAVAQLIADQDPFPVDYSAIPSIIYTFPEAGGVGFTEEELQAWGRQYKVGHSRFASNGRALAGDVAEGFVKIL
    VDVKTDRILGIHAVGPSVSELISLSTVLIMKKIRAGEFMQVPLAHPTLSEVLREATFSAYKRAIHS

    >gi|189218158|ref|YP_001938800.1| SAM-dependent methyltransferase [Methylacidiphilum infernorum V4]
    MNSLENIQSIDIGLYFCHTRNMKTSEATQDFVRQFYAQVAKTTGGCCGKPAVASTKAEELGYSHEELQSVPEGAEMGLGC
    GNPLSSASLKEGETVLDLGSGGGFDCFLAARQVGESGKVIGVDMTPEMVARAQANALLGHYTNVEFRLGKIEHLPVGDAT
    IDVIISNCVINLSAEKQKVFSEAFRVLKPGGRLAISDVVATGPLPEAMKQDPELLGC
    CIAGALTVPEIEEGLAAAGFEKI
    DVKIKPESRQFIQHWASELKAEDYVVSATITAIKPMPKQSPVRS

    >gi|189218169|ref|YP_001938811.1| Highly conserved protein containing a thioredoxin domain [Methylacidiphilum infernorum V4]
    MNALCKEKSPYLLQHADNPVDWHPWTEESLLKAKHLDRPIFLSVGYSTCHWCHVMAKESFENPIVAQLLNSFFIPIKVDR
    EERPDIDQFYMEFVQAFTGQGGWPMNVWLTPNLEPFFGGTYFPLESKWGKPGFVDILKKIAELWQYNRSLLEQQGQEIFH
    KMREVIQSSFEPKSPPNLAIASRKAVEQLWGSFDRTHGGFSPSPKFPRPSLFYFLFRAGSLADFSEDYKKKSLQMALYSL
    QKMSGGGIHDQLEGGFHRYSVDEKWRLPHFEKMLYDQATLGLSYLDAYQATDDPLFKDTFESLVEYLLSHLHHPSGGFYS
    AEDADSLNASGQEEEGAYYLWTFQELQQTLEPIVGKDRSKILAHFFGATEQGNLPGGLISEEALAKKNILLMEKPLSDLA
    HELGISLEEAREIVLKAKEGLKKERLKRSKPFLDDKIICAWNGYTLSALAKAYMVIGDGRLINEAKKTATFLLENLWDPS
    SKTLYRIYRNGRGTPGFSSDYASLALSMLHLFEADQDEKWLSLAKLFQELLEEKFVDPYRHNYMVEAVEISAKSIQTREE
    YDGAEPATLSLAAHSLLKLYTLTGEEKWRKRLEELFSYAWPILERFPTALPYLLGVYCEYRAPLVEIILVGEKKNEETKR
    LFHSLSKLLIPNRLLVVLDPQEKLPSLLKSPDFYTTLTRHYEGLPLIYICTNGQCHLAQTERDKALEILKPFAVLFPEKS
    YQPI

    >gi|189218205|ref|YP_001938847.1| Thioredoxin domain-containing protein [Methylacidiphilum infernorum V4]
    MIFDVQDFQKEVIERSKTKPIVVDFWAAWCGPCRMLSPILEELAEEAKEKWDLAKLNVDEWGEVAMAYGVSGIPDVRIFI
    AGEEKDRFIGLQPKAAIQSWLEKNLGQEKKKIKWKEAIDLFEQGRFHESFLAFERDQQKPENPQESLICARLLLLANPQK
    ALDVLPPSAGLEDPTLFEAIKFLALLLLGKSTDDWTDGKEKREFMEGLEALKKMDVEKGLSIGIGLLHQNKNVGEGLVLK
    TVRSLFHYLGPRHPLSLKYSRAFSTAVNI

    >gi|189218370|ref|YP_001939012.1| Thiol-disulfide isomerase or thioredoxin [Methylacidiphilum infernorum V4]
    MFFYENARGVGKIKFLKERAIDFSSPGFYNLYDMSSNPFFLNKRSKRFFSLFYYFLLFFFAFFPLRYLLASENLRWLTNY
    TQALAEAKRENKMVLMNFTGSDW
    CPWCQKLDKEVFSTPEFKNYAQKNLVLLEVDFPQHKSQPAELKKQNEDLANQYNVDS
    FPTLVLLSPQGEEVSSFGYIPGGPQPFIEKIEKLRQKAISKN

    >gi|189218416|ref|YP_001939057.1| Fe-S cluster assembly scaffold protein, HesB/SufA family [Methylacidiphilum infernorum V4]
    MSDRKDANLHVQLSPQAIVKVRQLTCSRPGHVLRLSVSRGGCAGYEYQLEITLPKKEDILIQVEDVRIAVDPASSPLLSG
    TTLDYKDSLTQGGFRVINPQAKSTCGCGSSFQP

    >gi|189218466|ref|YP_001939107.1| Mercuric ion reductase, contains HMA domain [Methylacidiphilum infernorum V4]
    MSKRIIVQIEGMHCADCARRLKEALGNIEGVEEVDIPDWRTKKGTLVIDENLNIDDILKGIERSGYRGTVTGQEPFESIK
    EREKKDYDLLIIGGGSAAFAAAIKAAELGANIGIVEESTIGGT
    CVNVGCIPSKFLIRAAEIYHWASHPRFAGLKAAPLSL
    NWKELVDQKEKLVNSLRQSKYIHLLDVYPQISLIRGKARLAQGNRVIVGDKSYSSRKILIATGSSPSIPPVPGLKETG
    CL
    DSTTALDLKTLPASLAVIGAGAIGLELGQMFSRFGVKVVLLEALPAIAMAEEPEIRDSLHRYLEEEGIEIFTHTQILQVE
    KKGSKHKRLSVQKEGKVIEMEVEQILAATGRVANTNGLGLEEVGVKVTNRGAILVDEFLRTTNPEIYAAGDCASLPQFVY
    VSAYTGGVAAENAISGKNRAIDLSSLPRVTFTDPQIASVGLTEDQAKEAGYSTIVALLPIQEVPKAIVSLDSRGLVKLVA
    EEKTGRLIGAHVLAAAAGDVIEEAVLALRHGLTYQDIIEALHPYLTMAEAFKLAALTFKKDVGRLSC
    CAT

    >gi|189218470|ref|YP_001939111.1| Fe-S cluster assembly scaffold protein SufA [Methylacidiphilum infernorum V4]
    MKIAITPNAKGFISRMIRMCGGSKNAGMRLTVGEGGCSGLNTEFSVEEKPWEGDLVWEDGIKLFIPQECAPYFDDAIIHF
    VETPMETRLIVLSGKRAQNSCGCSSSPQTG

    >gi|189218477|ref|YP_001939118.1| Rhodanese-related sulfurtransferase [Methylacidiphilum infernorum V4]
    MESNEDVLVYDTGHIPGAVHIDWRKDLQDPLIRDYISTEKFAQLCSRNGITIDTTCIFYGDKSNWWACYALWAFELFGHT
    KAKILNGGRDKWIKLGLPITKEKPTYEKTFYPVPPQRKDGEIRVFYDEVLSFLKTRGPLIDVRSPGEFSGELLHMPEYPQ
    EGVLRGGHIPGAKSVPWKTAVNEDGTFKSFAELQEIYEKQAGLDPEKETIVY
    CRIGERSSHTWFVLKYLLGHKKVKNYDG
    SWTEWGNKVAAPIER

    >gi|189218481|ref|YP_001939122.1| Fe-S cluster assembly scaffold protein [Methylacidiphilum infernorum V4]
    MNQTVKDREKEHQLGDEINGNHGVELSGSAVQKIRSLIEEEKDTELKLRIFITGGGCSGFQYNFAFDKQIEEGDILYEKG
    GVWLVIDPQSHMYLKGSVIDYEENLEGARFVIHNPNAGSTCSCGSSFSANCSQGV

    >gi|189218482|ref|YP_001939123.1| Fe-S cluster assembly scaffold protein [Methylacidiphilum infernorum V4]
    MAITITPRAQEKLAKSLLGKKEFVGLRLAVLRAGCAGFTYQMDYVREVESGDFVYAFAGGQLVVDKDSLKMVDGLVLDYV
    KDPFRERFVFNNPNATGSCGCGESFSLSR

    >gi|189218502|ref|YP_001939143.1| Fe-S cluster assembly scaffold protein [Methylacidiphilum infernorum V4]
    MGMKSTVTYTKGSEKLCAISEKAAEKLKELLSQSSRKEGALKISVVGGGCAGLQYEMDLVDGPEEKDILIESRGVKLVID
    PKSALFISGSILDYSEELQNEGFVVKNPNALSHCSCGKSFAV

    >gi|189218656|ref|YP_001939297.1| Protein-disulfide isomerase [Methylacidiphilum infernorum V4]
    MTKLATSPVVLLLLLASFFFSPFAAKARQNAEPIPPSPLPPLSAEARAKILKPLSIDWIQGEPSAPVIIIEYLDLECPVC
    AAYYPLLQELKKKYGDKIAWIIRHNPSMTHPEAFPASMAAEAAGRQGKFWEMVGLLLTNQKEWSFRPTCSEWFIHYAQKL
    GLNEEQFKKDLQGVEGIPLRKRILADCLSAIRVGVDGNPCFFINGEKITNPSNFQEFVTLIEAELIKKKSNISQLNP

    >gi|189218666|ref|YP_001939307.1| Bifunctional enzyme, contains ThiF/HesB family NAD/FAD binding and Rhodanese similarity domains [Methylacidiphilum infernorum V4]
    MKSFLPRIERTFSEAELSLEEIKRYGRHLIMPEVTLEGQKKLKAAKVLAVGTGGLGSPLLLYLAAAGIGTIGIVDFDVVD
    HSNLHRQIVHKTKNVGKPKIESAIETIAEINPNVQVIPYEMALRSENALEIIKDYDCVVDGTDNFPTRYLVNDACVLLGK
    PNVYGSIFRFEGQSTVFWAEKGPCYRCLYPEPPEPGMVPS
    CAEGGVLGVLPGVIGVLQAIETVKLILGIGKPLIGRLLHF
    DALAMRFREYVLRKDPDCPLCGENPTINKLIDYEAFCGLHRQQPVDFTNGIPSITVEELKRALDGEENFLLIDVREEHEY
    QIARIPQSKLIPLGQLHAKLHELDSSKKIVVY
    CKMGGRSLKACRLLYNAGFKNIWNVQGGIDAWSQLIDPTVPRY

    >gi|189218735|ref|YP_001939376.1| Thiol:disulfide interchange protein [Methylacidiphilum infernorum V4]
    MIVMITFFKEKDHLKCLFHTLMHGINPKRLLFVLFLPFSLFFVQLGMAATSSSARSRHVEVSLLSELDAVSPGSHFYVAL
    RMKMDEGWHTYWLNPGDAGSATKIDWTLPVGVHAGPIQWPSPSVISLPPLTSFGYEGECWLLIPMDISQEQQLGSSVNIK
    AFVQWVECAQSCLPGSAELNLTLPVESSPRVDESLKEGFQKAKYEIPRSPPESVSISFMDTGKNLIIFFQNKSGKILNFE
    SAHFFPFQNGIIQYSAPQQLRLRKEGVSLEIARPSNNASALTEPLSGIFTAKLSGLKGIEKINWDIRARKYIPPKVETQK
    TGASPYFNKKFFSYLGLSFIGGLILNLMPCVLPVISLKVLNLVGAAKEGGGSSIAHGLSFVLGVLFSFWIVVGLLILLRQ
    KGLELGWGFQLQSPPFVAFMALFFFLISLNLLGVYEIGVSLVSAQSLVEKAKGLLGSFLNGMLATLVASPCTAPFMGSAV
    GFALSQPPLVIILVFSSLALGMAFPVFVLSIFPGLLRLLPKPGPWMVSFKQFLAFPILGAVIWLIWVYGKLRGVDGVLDI
    LLALLFVGLGSWIYGKFSGPFHPLGVRVLSILLSLAILLSSFYYVVVEIERSFSTKVAKKEEWVPFSESKLEEYLQQDVP
    VFVDFTASW
    CLTCQVNKKVALENPEVKKKFEELGVIRMEADWTNRDPKITEALESLGRSGVPTYVFYGLGSASPLLLPEV
    ITPKMLLDVLNKIEKEKKQKEAQAKSGEFFQ

    >gi|189218927|ref|YP_001939568.1| Glutaredoxin [Methylacidiphilum infernorum V4]
    MELVSEQKVILYVKEGCPWCEEAEELLRQLHISYERIDVLKDRAAYQRMKKISGQSRAPTMEWGNEILADFGGKELLEFL
    KRKKLLL

    >gi|189218991|ref|YP_001939632.1| Peroxiredoxin [Methylacidiphilum infernorum V4]
    MKPLSPLEVGAPIPDVSGVDQDGQSVQLKEIGQKGIVLFYFYPKADTPGCTREACNFRDHYQMLINHGIKIFGISMDNQE
    AQKRFKEKYHLPFPLLADPEGKIVDQFGVTKRNGHASRQSFLAKDGKIVWRNLKVNPDNHVQEVLEELKKLKENTPQNP

    >gi|189219014|ref|YP_001939655.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component or related enzyme [Methylacidiphilum infernorum V4]
    MNDLDLIVIGGGPAGYVAALRAAQLGKKVALIEENKLGGVCSNWGCIPTKALLKTAELLETCRKADFFGIEISGLKFDYA
    KVIARSRQSANRMSAGVEYLLKSRGVRWIKARAKIGKNKQIKVFYPDEKTEELGSPYILI
    CTGCRPKTIPSIKVDGKMIL
    TSREALESTRLPKKIIIVGGGAIGIEFAYFYKCMGSDVVVVEMTPTILPGTDSEISMALHKSLTKKGITLLNSTSVEKCW
    VIKDKLHVRLKGAVNDSIESDAMLIAIGVAAQPNEILEAGLDLKTINGFIAVDNRYQTSIEGVYAAGDVIGPPLLAHAAF
    REGWEAVECMFLGKKSTRPHFVPSCVYCQPQVAMVGITEEEAKKENIPYKSAKYPYNANGKAVASGEIDGFVKLIVSSLD
    GEILGAHIIGQDASELIGEFSLAKTLESTALELHLAIHPHPTLSEMIGEVALQVEGIGLHL

    >gi|189219046|ref|YP_001939687.1| Methionine sulfoxide reductase with associated domain [Methylacidiphilum infernorum V4]
    MFLMNSFQYGKMGKSLLIFLIFLGGTVFGFKVFLKDKKEQKVQLYFIDVDGKLVGPLPSQRIQIDDMRWRYLLGAETFRI
    TRRAGTEAPFCGDLVDHKQKGIYKCSSCGLPLFSSSTKFHSGTGWPSFFAPLAKENITQRVDLSFGMIRTEILCTRCGAH
    LGHLFEDGPRPTGLRY
    CVNSASLVFVPQWVFDKTTPDGRKLQRAAFAGGCFWGIQDFFKKVEGVVWTVSGYAGGTVPFPT
    YEEVCSGKTGHAETVYLLYDPTVVSYSKLLSLFWQVHDPTSADRQGPDVGPQYRPIIFYYDEEQHKEALRSKESLEKELK
    GRKVLTAILPAAPFYPAEEYHQDYLEKHHLPNSCLRR

    >gi|189219055|ref|YP_001939696.1| Thioredoxin reductase [Methylacidiphilum infernorum V4]
    MSMEETIIIGSGCAGWTAAIYLARAKLSPLLVTGTEPGGLLTTTTIVENYPGFPMGIQGPELMEAMRKQAERFGTRVRYL
    SVVTEVEFTQKIKRVKIDEEWIETKSVVIAVGARPRKLSVPGEAELETKGVSY
    CATCDGALPVFRNQPLVVVGGGDSACE
    EALYLTRFASSVYLVHRRDTLRASPIMAERVFNEPRIKPIWNSAVEEILDHKQNKVTGVWLRNLKDGSKNFLECRGVFVA
    IGHVPNTQIFEGKLEMDERKLIKVFQGTKTTVPGVFACGDCVDGLYRQAVTAAGMGCMAALDAERYLRGIEA

    >gi|189219097|ref|YP_001939738.1| Organic hydroperoxide reductase [Methylacidiphilum infernorum V4]
    MHPLPHHYKVVSSGGPFGNLIVKGIDEEFPPIELNAPVQYGGPKNTWSPETLLPAALSSCLILTFDSVAEASRFRWHKIE
    CEADGTLDRKEGIRYFVSFSLKVKLFVPQGTDIQKAQKLLHKAEEN
    CLITQSLKGSVFLESEIIEE

    >gi|189219105|ref|YP_001939746.1| NAD(P)H-nitrite reductase [Methylacidiphilum infernorum V4]
    MKKEKLVVIGAGMAAVRFLDELVERGGSQKYDITLIGKETRVGYNRILLSSLLAGEIDFSGLELKSPEWFSKQGISVRAG
    CEALLIDTANRKVWTDKEKIPYDKLFIATGSTPFIPPLSGLYDSHNNRLDGVFSFREIED
    CQSILKQIPGAEQAVVIGGG
    LLGIEAAYGLYKKGMQTVLVHLMGHLMEKQLDTLAATLLKRELEKLGIRILLRTKTTRLQKIGRRIRIEFENGNEIAADI
    VVIATGIVPNSSLAKKSGIAVNKGIIVNSQMESVSHPGIFAAGECIEFEGQTYGLVNAAWQQASIAARSLLDPSWRSSYT
    GTLPIARLKVAGIDLLSFGQIEPAGNEDVVLYTHSQQAVYRKLFIKDKKLTGGIFLGPSHRSLEALHFYEKNLPLNCEPQ
    EFLFEAPTKTREEAIEDKPDDFQVCNCNGVTKREILESIKKGCSTLKEVMAISRAATGCGSCKPLVQRLWEKTAKEPAAE
    DPTVHYYVPCIPLTKRELIEEIKKRDLRGVSAVFAALAAGKEDAQSKPALASLLKMVWGKDYKEEPDSRFVNDRVHANIQ
    KDGTYSVVPRMYGGITTAEQLRKIADVAEKYQVGMIKLTGGQRIDLLGIKKEQLPAIWKELGMSCGHAYTKAFRTCKSCV
    GTDFCRFGVGDSTTLAIAIEKKFQGIESPAKMKLAVSGCSRNCAEATTKDIGVVAIGTGWEIYVGGAAGSKVRAGDLLAV
    AKDQPEVLRLIGRFIQYYRENAKYAERSYSFVERLGIEHVRKAVVSLSEEEARRLDREVEQAIEAYIDPWQAAQQEQYPH
    QFESSSPIPGSFANQ

    >gi|189219145|ref|YP_001939786.1| Rhodanese-related sulfurtransferase [Methylacidiphilum infernorum V4]
    MKNYAHPEVLVETSWLQEHLNDPGIRIIESNEDPLLYDTGHIPNAVNIDWRADLNDPLIRDYISAERFAQLCSQKGISPE
    TTCIFYGDKSNWWACYSLWVFRLFGHTAVKILNGGRDKWIKEGRPLTKEKVAFPPSSYPVPTVRHDGEIRAFYDEVLRFC
    KEKRGPLIDVRSPGEYTGELIHMPEYPQEGALRGGHIPGAKSVPWKTAVNEDGTFKSAEELSKIYEEGCGVSDDKPTLVY
    CRIGERSSHTWFVLTYLLGHKNVKNYDGSWTEWGNKVGAPIER

    >gi|189219153|ref|YP_001939794.1| Thiol-disulfide isomerase or thioredoxin [Methylacidiphilum infernorum V4]
    MASQLIQNVTSKDFDNEVLKSPQVVVVDFWAEWCGPCHMLSPVLDELAKELDGKVKFVKVNVDQEPNLAYQFSIQSIPTL
    LIFKGGQVKGKQIGVTSKSHILNKIKEVEIS

    >gi|189219213|ref|YP_001939854.1| dihydrolipoamide dehydrogenase [Methylacidiphilum infernorum V4]
    MATELSVDVAILGAGGGGYPAAFFLDKSGFKVLMVDPIGNLGGNCLAEGCVPSKAVREASLVRATAKKYPFFGLSGMVPQ
    VDWKAILAHKDKVQNTRYALHKEEINRSNILFYKGVGKIVDEKKIEVITDKENFLVFFKFLIIATGSRPHSLPIAGSDLA
    VNSHDLFKLNATVPFPSKPIIIGGGYIGVEVASMLENLGAKPSILESTELLVGGLDRELSLFLAEKLKTRIHIELGAKVE
    SIEKDRDKFKVVYQKNNQAHTLEGDLVIMATGRECLTPEGIEKLGFPSSKPLPVTSFLQLYDFPHIYAPGDINGKSMLFH
    SAVLQSIIAAHNIAAGGQPVSRMDWKSVPYTVFTEPEIAGVGLTEEEALHLYGQHVEIVKYDYAVDSRAEILGETEGFIK
    LLFDGENKRLLGAHIAGVEASQLIAPLALAIREGLDAEALAHVAFPHPMISEGINKAARTFSP

    >gi|189219254|ref|YP_001939895.1| Glutaredoxin-related protein [Methylacidiphilum infernorum V4]
    MNIVYVMSNLRIVAYLKPSCGWSNGVRAILKKYNLPYEDKDIINFPEYREEMIMKSGQPFSPCVEVNGEMLADISGQELE
    EWLIAKNYVQRIDQPVDVPIDQACSGEHYHSYPIRVNFEL

    >gi|189219344|ref|YP_001939985.1| Glutaredoxin family protein [Methylacidiphilum infernorum V4]
    MAEKLFIYVKSSCSTCRRAVALLEELKVDYEKRDYFIHPLSKEKWAELLKKLDVGFPEILRTKEEVFSELGLGKRQLRQG
    ELVELILKHPELIQRPIVEYGTRAILGRPPEKIKEFLHSLR

    >gi|189219470|ref|YP_001940111.1| Cation transport ATPase [Methylacidiphilum infernorum V4]
    MGNGRSCAYIFKMKIKLRIEGMTCNNCVRHVRNALSRVPRVLSAHVDLEKSQAVVTAEEGCQVPQLIGAVEEAGYGAKLI
    EGEDEDSASKRWTRSLVLGIILTTILYLSQYLIRSPPLWLGNMLFALSVPSSWMAILYSRWNFFFGLYLFLLALPVQLVS
    GYSFYLGAYRQIRSGRLDMDTLVSIGSSSAFLLSTFGLFFPGIIEHYYFDEAAAIITLVSAGHWLEARVSRKANKTLKKL
    LELAPAYATVLEDNNIEKKVRASELVIGQKVILKPGERIPVDGEVVEGRGLVDESMLTGESKPVEKWPGEKVFAGTLNLH
    SRLIIRVSAAGEKTVLAHIAEVVLKAQESRANIQNFVDKVSSVFVIFVIGVAVITALGWGLSGLTKWETALIRAASVLVV
    ACPCAMGLATPAAIMVASNRLASLGILIRDGSALEKCGKIKEVIFDKTGTLTQPKLTVENPEYFFIDPLVADTLAYSLAS
    SSLHPASRAIIERFKDSSRLNLKDWQEKPGAGIQALYQDFTVRLGSLSWLRSLGIKTCDLQSLSSSGVGLAMNDKLIAYY
    PIAAPIKPTAKQVIEKLSAKGYTVYILSGDKREIALQLGLQLGIAPEHVIAEVRPEEKANVIRSFQQQGRSVAFIGDGIN
    DGPALAQADLGIAVLNASDIAKESADIVLLNADIEIIPLLLEISDKTLKTIKENLFWAFLYNTLAIPLAVMGKMSPSVCA
    GAMGLSDLFVIGNALRLYKR

    >gi|189219646|ref|YP_001940287.1| Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component or related enzyme [Methylacidiphilum infernorum V4]
    MKEPYELAILGAGSAGFAAASVASKAAIRVALIDEAEKLGGLCILKGCMPSKTFIESSNRFWEIQQAKNYGLNVENLSAD
    MLRIQKRKRTLVEEFAQGREEEMLSLPIDFIRGRASFISPHELVIKQKGGKERLISSKTFIIATGSVIDPLPIPGLAQTG
    FLTSDSALELERLPGSLTILGGGAVGCEFAQFFSRLGCKTTIIQRSPRLVKSFDPEVSECLREAFLSEGIGVFSDTQIEA
    VTKENGYKKVSFLYKGKKTEVFSEEILYALGRKPNVEKLGLEKIGIDIQVQPLSLNDKMQTAIPHIFVAGDASGNYGIVH
    IAREEGEIAAKNALEILAGKPPSNVVCRRLTMEVVFTDPQVAMVGLWPSNRKALCAKYFFKDHGKAIIEGKEKGFVKICA
    DPSSAEILFGTIIGPHASELIHQLSTCIYYRGTVEDLLKMPFYHPTLSEILSYPAEEIFSRLKEKKEKTHPATTR

    >gi|189219686|ref|YP_001940327.1| Thiol-disulfide isomerase or thioredoxin [Methylacidiphilum infernorum V4]
    MAVASVMLPLGTQAPAFALPDAISGKIYTLDDFKASPALLVMFICNHCPYVKHIRGHLVQMIAKYQKEGLAAVAINSNDI
    QRYPDDSPEKMKEEALQYGYTFPYLFDETQETAKAYRAACTPDFFLFDKDRKLVYRGRYDESRPNSPLEVTGADLSRAIE
    AVLRGEKVDTDQKPSIGCSLKWKPGNEPSWWNF

    >gi|189219838|ref|YP_001940479.1| Peroxiredoxin [Methylacidiphilum infernorum V4]
    MFFPAMKKNKGEGLKVGSEIPGINVFDTEGNPLSLRELCNQGIVLLYFFPKAFTPGCTLQACHLRDRLSDLQQHKIKVYG
    ISKDKPCIQKKFSQSYRLNFCLLSDLHGEACKTFGVPLFLGMPKRVSFLIKEGKLLWRDFHPHVGKTADDILEAIAASMY
    WPKD

    >gi|189220134|ref|YP_001940774.1| Peroxiredoxin [Methylacidiphilum infernorum V4]
    MALSVGSLAPDFTLSSKFPEGIKQIHLKEELAKKNVVLLFFPMAFTPVCTQEMCTVSSSLNEYAKLDAQVFGISVDNPFA
    QEAWAKKEGITIPLLSDLNKEVCRAYDVLLPGLIGIGDVAARAVFVVDKAQRIVYREVTASPLELPRFEPIKEALQSILS
    R

    >gi|189220144|ref|YP_001940784.1| Methylated DNA-protein cysteine methyltransferase [Methylacidiphilum infernorum V4]
    MDSLISERDEKMTPVFSESALGPVQVVLLDGLPLELKRIDPKTPRLSELIEDSRRRFPLLFEQLYRTLVEGEIYFQQLHL
    ERLPSFYKRVLQRVKTIPKGTVKNYGEIATEIGSPHGSRAVGSALARNPLPLLIP
    CHRVVKKDGAIGSFSMGGSTLKAKL
    LEKEGIILAKNHKFWIKQQGT

    >gi|189220412|ref|YP_001941052.1| Rhodanese-related sulfurtransferase [Methylacidiphilum infernorum V4]
    MNIPDRHPQLQSYLEKIKKKVKSMSIQDTYQGLQSRRALVIDVREKEDWFMGHIPGALSIERADIEWEIEKVLADKDFPV
    I
    CYCGDGLRSQLAAYTLSEMGYSQVYWMEKGWKGWKEQKYPVSYSPSVELRDPLEKLGGICYLPRLYDKIKALHQKRLPP
    TEYLQDDWDKALLELLCIDSSLLEQLILFSSSEQEFLAELKKILGPSWPARHTIEEYNERCQLKKIQGGQRPQFWLWSRK
    QKK

    >gi|189218465|ref|YP_001939106.1| Lead, cadmium, zinc and mercury transporting ATPase [Methylacidiphilum infernorum V4]
    MKSTRLGILSLILASSCCAGPLLLAALGLGAGSAFFGKFHWVFLIGGAVLLLWAWKRYWFEQKSCKCETKKEETHRSQLI
    TLQLSTVFFLFFLAMNVFPYVFDLKGSEQSLPAAALSQGSLVAKIPIGGMS
    CASCELEISHSLKKIKGIKWVKVSFPSKE
    ATVIYDPKEVEMARILSAIRESGYEPGSPRLFKQPVDAH

    >gi|189219744|ref|YP_001940385.1| Cu2+-binding oxygen sensor (SCO1/SenC/PrrC family) [Methylacidiphilum infernorum V4]
    MNLQNKESPQSLIKTLVVLFVSLVAISFFLNLTSSYFQVKYWKERSNMPKIRQIPPFSLIRSDGVTITERELKGKVWVAD
    LIYTH
    CPGPCSTESLRMSQLQSILGKLEGVRLVSISIDPEMDNAQALRKYAEGFHADPTFWYFLTGKSQNIQDFVVKGLA
    LGMGENPQDKRQAEGRFYHSTQFVLIDQEGFIRKYYDGLNQKTPKDLSIDILLLLQEASKNNKGT

    >gi|189219630|ref|YP_001940271.1| Protein-disulfide isomerase [Methylacidiphilum infernorum V4]
    MVFKKAFFFLFCFLTFLALLYGHPAENRSARDGSFDGGAQKYLFPLLGDWIKGQVRAPVFLIEYVDFQCPVCKRYNETVN
    KLLKDYQGNLSVIYRHKPSQTHPYAFIAALSAEAAGLEGRFWPMVDLLFENQERWAGVADPIKLFKEYALALNIPEEKFM
    QNLRKPELRDKIFKDLQSSFILGMTRVPSFILGGERIPNPQSYEDFKILVEAALIKSKKRELVHEHADFRVVLDGKPIDF
    SAPKYQSRFGQEIDPYVHLHHGNGRVIHKHKRGITLGYFFKTLGMELSKDRFVLDTGEKFEVRNGKVLLLFVNGKLEPSL
    DAYEPRDLDRILIYYGPFVDKLIAKEISSVSDEACIYSLKCPQRGKPPDEECVGQLGSDCQ