Mesorhizobium loti MAFF303099 uid57601

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|13470333|ref|NP_101898.1| bacterioferritin [Mesorhizobium loti MAFF303099]
    MADLDVGDLAPQFDLPQDGGGSFSLAASAGKPVVLYFYPQDDTTSCTQEAISFSQLKPEFEKAGAVVIGLSPDNVKKHDK
    FKSKYNLTVDLAADEERKVIEAYHLWVEKSMYGRKYMGVERATFLIDRDGRIARIWRKVRVKGHAEDVLEAVRAL

    >gi|13470348|ref|NP_101914.1| HesB-like protein [Mesorhizobium loti MAFF303099]
    MRNHSAGLEPAWNGEGKRMGRFAVITMTEKAADRVREIVATRENAHGIRLGIKKGGCAGMEYTVDLVTEPNTKDDHIERD
    GAHVYVAPEAALFLFGTEMDFEQTTLRTGFTFHNPNQSSACGCGESVELKPADLKALAEARASA

    >gi|13470367|ref|NP_101935.1| hypothetical protein mll0053 [Mesorhizobium loti MAFF303099]
    MSGINDYIDNEVKGNDVVLFMKGTPGFPQCGFSGQVVQILDYIGADYKGVNVLDSAELRQGIKDYSNWPTIPQLYVKGEF
    VGGCDIVREMFQAGELQTFLVEKGVSVKGAA

    >gi|13470486|ref|NP_102055.1| outer membrane protein [Mesorhizobium loti MAFF303099]
    MKKALLLGTTGVAVVLAMLAFGFVAGSPQMAKAGTAQPVQTAADTKIDRAEVEGIIRDYLLKNPEVLLEVQDALEAKQKE
    EQRIASLGVIKGAKDQIFNSAFDGVVGNPNGKVTIVEFYDYN
    CGFCKRAIEDMRALTKSDPDLRFVLKEFPILGPDSQKA
    SVVSMAFHLMMPEKYGEFHNALLGGQGRATEAAAIKVALSLGADEATLREKMKDASIPEAFSKTYDLANKLAITGTPSYV
    VGNEVVFGALGQDVLAEKIKAAKAAL

    >gi|13470599|ref|NP_102168.1| thiosulfate sulfurtransferase [Mesorhizobium loti MAFF303099]
    MAQDSPFTVDADWLQARLGEPGLTIVDASWYLPAQKRDARAEYNAAHIPGARFLDQDAVSDPDAALPHTLPSPQHFAQYV
    GSMGVSADDTIVVYDGPGFFSAPRAWWMFRIMGVFQTYILDGGFDAWKTAGRPVTAEPTKIAPSVFHADFDAGRVASLAD
    MRRIVETSASQIADARGPGRFTGAEPEPRAGIRSGHMPGARNVPYSALSENGMLLSKDRLRKVIEEAGIDLSKPVVTS
    CG
    SGVTAAVVTLALETLGHTDNRLYDGSWTEWGGLSDTPVVTGPATPGPAKTGKE

    >gi|13470624|ref|NP_102193.1| dihydrolipoamide dehydrogenase [Mesorhizobium loti MAFF303099]
    MAENYDVIIIGSGPGGYVTAVRSAQLGFKTAIVEREHLGGICLNWGCIPTKALLRSAEIMHYSDHLKDYGLKLDGKVSVD
    TSAVVDRSRKVSLRLNGGVAFLMKKNKVDVIWGEAKLSKPGEVVVSKTAKTPMEPQPPVPKGVKGEGTYTAKHIILATGA
    RPRALPGIEPDGKLIWTYFEAMVPKEMPKSLLVMGSGAIGIEFASFYRTMGADVTVVELLPAVMPVEDAEVSKFAQKQFE
    KQGMKIILEAKVTKVEKGANSVTAHVEMKDGKVEKITADRMISAVGVQGNIENLGLEALGVKTDRGCIVVDGYGKTNVPG
    IYAIGDVAGPPMLAHKAEHEGVVCVEKIAGFPGVHAIDKLKIPGCTYCNPQVASVGLTEAKAKAEGKDIRVGRFQFAANG
    KAIALGEDQGFIKTIFDKKTGQLLGAHMVGAEVTELIQGFVVAMNLETTEEELMHTIFPHPTLSEMMKESVLDAYGRALN
    A

    >gi|13470733|ref|NP_102302.1| thiol oxidoreductase FrnE [Mesorhizobium loti MAFF303099]
    MSEANAVTVDVVSDVVCPWCFIGQKRLDKAVAAAGDVDVHIRWRPFQLDPTIPPQGKDRREYMLAKFGSDERIREIHARI
    EPLGEAEGISFAFDAIKVAPNTLDAHRLIRWAGAAGEAVQNRLVRRLFQLNFEEGVNIGDHAVLVEAAREAGMDASVVAT
    LLPTDADVEAVRTEIATASRMGISGVPCFLLEGKYAVMGAQDVDTLADAIRQVAAAKARGELDKVG

    >gi|13470737|ref|NP_102306.1| glutathione reductase [Mesorhizobium loti MAFF303099]
    MAGYDYDLFVIGGGSGGVRAARVAATLGKRVGIAEEYRFGGTCVIRGCVPKKLYVYASQFPEHFADAAGYGWTVPEASFN
    WQTLVANKDREISRLEAIYKKNVEGAGGETFPSRAMIVDPHVVHLLDDDRTVTADQILIATGGRPAAHPALPGHEH
    CIFS
    NEAFDLKELPKAIMIEGGGYIAVEFANIFHGLGVDTTLVYRGKEILSRFDMDLRRTLHETMEKKGIKILCHAVSERVHKR
    PDGRLDALLTSGQTLTVDQVMLAIGRIPNTENMGLEGIGLEMTQAGAIKVDEYSRTNIDNIWAIGDVTNRVQLTPVAIHE
    AMCFVETAFKGNPTAPDHDTIATAVFSQPEIGTVGLSEDEAVKRFADVEIYRASFRPMRHTLSGRDEKMLIKLVVDGASR
    KVLGAHILGPDAGEMAQLLGIPLKAGLSKDDFDRTMAVHPTAAEELVTMYKPTYRVKDGQRVQ

    >gi|13470747|ref|NP_102316.1| hypothetical protein mlr0536 [Mesorhizobium loti MAFF303099]
    MKKGYRELLDEANAEIEVVSPEEAAGLLEDEGTIFVDLRDPREVERDGGIPGAKHVTRGMLEFWIDPESPYHKPFFASGK
    SFVFF
    CAGGWRSALATKTAQDMGLVPVKHILGGYTAWKAAGLPVEPGEKKK

    >gi|13470952|ref|NP_102521.1| thioredoxin reductase [Mesorhizobium loti MAFF303099]
    MTGIISTDVLIVGAGPVGLFAVFELGLFDMKCHLIDILDKPGGQCAELYPEKPIYDIPGWPSISAQGLVDKLLEQIHPFK
    PDFTYNRMVSSLEKLEDGSFRVTTDENEVFEAKVVVIAAGGGSFQPKRPPIPGIEPYEGKSVFYSVRRMEDFRGHDLVIV
    GGGDSALDWTLNLQPVAKSVTLVHRRPEFRAAPDSVNKMYAMQEMKQLEFRVGQVTGLTGADGQLSSATIKGGPDGDIEV
    PCTRMLPFFGLTMKLGPIAEWGLNLHENLIPVDTEKFQTSVPGIFAVGDINSYPGKLKLILSGFHEVALMAQAAKRIVSP
    GERIVFQYTTSSTSLQKKLGVVG

    >gi|13471190|ref|NP_102759.1| hypothetical protein mlr1094 [Mesorhizobium loti MAFF303099]
    MGADAKTAMKVDMTEAAARRIAEIVSGEAGKTALRVSVEGGGCSGFSYKFDLVDTRNDDDVAIEKDGATVLIDDLSLVYM
    GGSVIDFVDDLMGQSFQIRNPNAVASCGCGTSFSI

    >gi|13471439|ref|NP_103005.1| glutathione-S-transferase [Mesorhizobium loti MAFF303099]
    MSGESEMTDKLILVSHPLCPYVQRAAISLTEKGVPFERIDIDLADKPDWFKAISPLGKVPLLRVQRNGDETTIFESAVIL
    EFLEETQANPLHPADPYARARHRAWIEYGSAILNAIGRLYSAPTEAGFLAESRALTGMFDRLEAELADDALRSGPWFAGD
    RFSLVDAVHGPVFRYLDAFDRIGDFSILDGKPRVQAWRQALNDRPSIRHAVAPDYPQRLHAFLQAKGSFLSSLIRRNDPA
    TALRQALPA

    >gi|13471615|ref|NP_103181.1| hypothetical protein mll1641 [Mesorhizobium loti MAFF303099]
    MKQRMQFFAKAPEIMKAVSALNKAVDECGLEISLLHLIKLRASQINGCSFCVEMHSREARRDGETEQRLYLVAAWKESPL
    FSERERAAFAWTEAVTLIANNGVSDELYARTLEHFSEEELVKLSVALGMINTWNRLCVPFQAIHPMPAAKAA

    >gi|13471673|ref|NP_103240.1| hypothetical protein mll1719 [Mesorhizobium loti MAFF303099]
    MATTRLLSDTEVEKIPAVKAVFDDIRATRKSDFVNNFWRGLANDPVSLKRVWEQLKAVMLADSAIDPLTKEMIYIAVSTA
    NGCSY
    CVHSHTAAARAKGMTDAQHGELVSIIGLAGQTNHLVTAMQIPVDPQFEVK

    >gi|13471707|ref|NP_103274.1| methionine sulfoxide reductase A [Mesorhizobium loti MAFF303099]
    MATSTERAVLAGGCFWGMQDLIRRYPGVISTRVGYSGGDVANATYRNHGTHAEAIEINFDPAVISYRTLLERFFQIHDPT
    TRNRQGNDVGMSYRSAIYYTSDEQKRVAEDTIADVDASGLWPGKVVTEVAPAGAFWEAEPEHQDYLEKYPNGYTCHFVRP
    GWKLPVREKAVS

    >gi|13471775|ref|NP_103342.1| O6-methylguanine-DNA methyltransferase [Mesorhizobium loti MAFF303099]
    MFITLAKNLKSTPLPVTDNPRWARIVARDKSADGEFWYSVATTGVYCRPSCPSRRANPANVQLHDTLAQAKATGFRACRR
    CNPDGPSLEAGNAAMVADACRRIEQSEEEPSLGELADAAGRSAGYFHRVFKAITGLTPKDYAAAHRAARVRQGLEDGASV
    TVAIYDAGFNSSGRFYEKSTGMLGMTPTRYRAGGANEDIRFAVGQTSLGAILVASSRKGVASILLGDDPDALVRDLQDRF
    PRARLIGGDRDYEALVARVVGFVESPQLGLDLPLDVRGTAFQQRVWQALQDIPVGGTVSYAEIAERIGSPRATRAIAAAC
    AANAHAVAIP
    CHRVIRKDGALSGYAWGAERKHALIEREAGGSARAHRSSRA

    >gi|13471777|ref|NP_103344.1| O6-methylguanine-DNA methyltransferase [Mesorhizobium loti MAFF303099]
    MNPIQTHMPTTARNTATLDTVAYAVGQSAIGKILAARSAIGVCAILIGSDAEALEQDLADRFPGKVLVEDEAALRGDLAA
    IARFIETPGAGLGLPLDMRNGTPFQQRVWEVLRAIPCGATITYTALARRLGRPNGARAVATACAANAIALGIP
    CHRVVRA
    DGTLSGYRWGIERKRALLDKEAAI

    >gi|13472004|ref|NP_103571.1| hypothetical protein mlr2160 [Mesorhizobium loti MAFF303099]
    MTSYLVSLLGGALIGLSSVILLILNGRIAGVSGIVGRAVQGIGVWTNGAFVAGLLLGPVVYFAAFHHWPTVTVTASLPLV
    MLAGLLVGFGSRMGSG
    CTSGHGVMGLARLSPRSIAAVLTFLASGIVAVAFLRGAVL

    >gi|13472010|ref|NP_103577.1| arsenate reductase [Mesorhizobium loti MAFF303099]
    MTITIYHNPDCGTSRNTLAIIRQSGEEPQVIEYLKTPPSRARLVELLEAMAMTPRQLLREKGTPYAELGLGDPKWSDDEI
    LDFMLAHPILINRPIVVTPLGVVLARPSEAVLDILPNPDIGPFTKEDGEVVVDASGKRVV

    >gi|13472213|ref|NP_103780.1| antioxidant protein [Mesorhizobium loti MAFF303099]
    MSLRIADTAPDFAAETTHGPISFHDWLGNSWGILFSHPKDFTPVCTTELGYMAKLKPEFDKRNVKIIGLSVDPVERHAGW
    ADDIAETQGQAPNFPMIGDPMLAIAKLYDMLPATAGDSAEGRTAADNQTVRHVYVIGPDKKIKLMIAYPMTTGRNFDEIL
    RVVDSMQLTAKHRVATPVNWRPGDDVIIAGSVSNDEAKVLYPDGWKQPKPYIRIVPQPHSNA

    >gi|13472245|ref|NP_103812.1| metal-transporting P-type ATPase [Mesorhizobium loti MAFF303099]
    MTSPLRQTRFKIGGMDCASCAAKIATAVRRLDGVADVSVSVTGASMTVSHGGPLNDDKVLRQVAWLGYGIVKAEARTDGP
    AAKAHDHAAHDHEGHDHQGHDHEGHDHGGGQEITKEAAGASHLHSHAEPGQVWWRSRRAAMTLACAVALLAAYSICHLFP
    SAERWVFLAALLVGLVPIARRALMAALAGTPFSIEMLMTIAAAGAVMIGATEEAAAVVVLFLIGELLEGVAAGRARASIQ
    GLADLVPKTALVERGGGTVEVPAEQLAVGAVIVVRPGDRIPADGEIVEGSSDIGEAPVTGESTPKRKGVAEPVFAGTINS
    DGVLKARVTAAASDNTIARVVRLVEEAQEAKAPTERFIDRFSRIYTPGVLAVGALVAVLPPLVAGGDWNEWIYKGLAILL
    IGCPCALVISTPAAIAAGLATGARRGLLMKGGAVLEGFRRITAVAFDKTGTLTVGKPVVTDIVAFGRDERSVLALAAALE
    QGSSHPLAVAILDRARADKAPVPPAFAAKAISGRGVEGSVGGVAVFLGSGPAAGERADITQAQRLAVDSLNGQGKTVSVL
    VADGVVAGLIAMRDEPRPDAAAGIAALKAEGIRAVMLTGDNRRTAEAIAASLGIEARAELLPQDKQRIVGELQGEGLTVA
    KVGDGINDAPALAAADIGIAMGGGTDVALETADAAILHGRVLDVARMVRLSRAVMANISQNITVALGLKAVFLVTTISGI
    TGLWPAILADTGATVLVTANAMRLLRWRG

    >gi|13472284|ref|NP_103851.1| methylated-DNA-protein-cystein methyltransferase [Mesorhizobium loti MAFF303099]
    METTPSITAGHAVLETVIGFMGIAWSEKGLIRLCLPERSRESVERRLMRHAGVSASTAQPPWVVELIASIKAYAAGEDVD
    FSNVPVDLDGVDDFRLAIYDAARKLSYGETTTYGELAKRAGHAGLPRETGAALGANPVPLVIP
    CHRILAAGGKIGGFSAP
    GGSVTKEKMLAMEGVRVGPPPPAQVSFGF

    >gi|13472304|ref|NP_103871.1| thioredoxin reductase [Mesorhizobium loti MAFF303099]
    MTTKHAPVLIIGSGPAGYTAAVYAARAMLKPMLVAGLQQGGQLMITTDVENYPGFADPIQGPWLMEQMMKQAEHVGTDII
    NDIITEVDLNVRPFRAKGDSGTTYTADALIIATGAQAKWLGIPTEQDFMGFGVSA
    CATCDGFFYRGKDVAVVGGGNSAVE
    EALYLSNLAKSVTVIHRRSDFRAERILRERLLQKDNVRVIWDTVVDEITGRPGKAPLPPSVEGLKLKHAVTGAETHLKVD
    GVFVAIGHAPAVELFVGKLKQKPNGYLWTAPNSTRTDVPGVFAAGDVTDDVYRQAVTAAGLGCMAALEAEKYLAGIEVHR
    EAAE

    >gi|13472464|ref|NP_104031.1| mercuric reductase [Mesorhizobium loti MAFF303099]
    MTAKTFDAIIIGAGQAGTPLAGRLNAAGMSVALIERKLVGGTCVNTGCIPTKTMVASAYAAHLARRATDYGVTLGGPVGV
    DYKAIKARKDKVSGASRTGLESWIAGMDKCTLYRGHARFESANTVRVGDDLLTADKIFLNTGGRASVPDLPGIHDIDYLT
    NSSMMDLEVLPRHLIVVGGSYISLEFAQMFRRFGSEITVIEKSPRLTGREDEDVSATILSILENEGITVHVGADDIGFAK
    QGDDIAVTFSAGKPPAVGSHVLLALGRTLNTDDLGLDRAGVAVDKRGAIIVDDQLRTSVPGIWAMGDCNGKGAFTHTSYN
    DYEIVAANLLDNDPRKVSDRIEAYALYIDPPLGRCGMTEAAVKKSGRRALVGQRPMTRVGRAVEKGETQGFMKILVDADT
    RQILGCSVLGPGGDEAVHCVLDLMYAKAPVDTLARATHIHPTVSELLPTIAQELKPLA

    >gi|13472775|ref|NP_104342.1| O6-methylguanine-DNA methyltransferase [Mesorhizobium loti MAFF303099]
    MSDSWARSPSLSGYARQEGKFRVAIGAPRGDIPGQGDSSMSTQTAVLKKDITPQGSDYEIVRRAIEKISLDYRDQPSLEE
    LAEEVGETPTGLQKLFTRWAGLSPKAFLQAVTLDHARRLLDSGMPLLETSFELGMSGPGRLHDLFVTHEAMSPGDYKTRG
    AGLTIRYGYHASPFGTALIMATDRGLAGLAFSDPGEERAAFADMSSRWPNAIYVEDLAATGPYAARIFDPTLWRPDQPLH
    VVMIGTDFQVRVWEALLQIPMGKARTYSSIAASIGAPSASRAVGAANGANPLSFVVP
    CHRAIGKSGDLTGYHWGLTRKRA
    ILGWEAGQVSS

    >gi|13472984|ref|NP_104551.1| glutaredoxin [Mesorhizobium loti MAFF303099]
    MVDVTIYTRMMCGYCTAAKRLLERKGVAYTEHDASFSPELRQEMISRAHGRTTFPQIFIGETHVGGCDDLHELEAEGRLD
    RLLANGATI

    >gi|13473026|ref|NP_104593.1| thioredoxin-like protein [Mesorhizobium loti MAFF303099]
    MAGALAGAVAVYVSESRSGNNAPARVAVGGSKDDVACAAKSGRAKKIAAAATGEVAALLPADPPQSMKSLAFNGPDGKPM
    TIADHAGKTVLLNLWATW
    CAPCRAEMPALNALQKDKGSDAFQVIAVNVDAGDDVKPKKFLKETGVEALGYFRDSTVALFN
    DLKARGLALGLPVTMLIDSEGCLIAHMNGPAEWSGRDARRLVETALGS

    >gi|13473217|ref|NP_104784.1| thiol-specific antioxidant enzyme such as rehydrin/peroxiredoxin [Mesorhizobium loti MAFF303099]
    MSLRINDIAPDFTAETTQGTISFHDWIGDGWAILFSHPKNFTPVCTTELGTMAGLEGEFKKRNVKIIGISVDPVASHDKW
    QADIKTATGQTVHYPLIGDKDLKVAKLYDMLPAGAGETSEGRTPADNATVRSVYVIGPDKKIKLVLTYPMTTGRNFDEIL
    RAVDSMQLTAKHQVATPANWKQGEDVIITAAVSNEDAIKRFGAFDTILPYLRKTKQPSA

    >gi|13473294|ref|NP_104861.1| hypothetical protein mlr3845 [Mesorhizobium loti MAFF303099]
    MRYLNFISDGDQLHQRWRPLMSYVTDVPAASPGIARDHFLHRLSVETDCSDVAATLRGGKPDFVLLHVVGSPDAYERRHV
    PGALHLPHHEISAERMAEWPAGTLFVVY
    CAGPHCNGADRAAFKLASLGLPVKIMIGGISGWQDEELPFASGREPGALRA

    >gi|13473369|ref|NP_104936.1| hypothetical protein mll3944 [Mesorhizobium loti MAFF303099]
    MSKAQSDMSETPLPAIRITYCTQCQWLLRAGWMAQELLSTFGTDLGEVTLVPGTGGVFTISCNDVLIWDRKRDGGFPDAA
    KLKQLVRDVIDPDRDLGHSDRKGHTSKGHTQKDPA

    >gi|13473382|ref|NP_104949.1| transcriptional regulator, putative [Mesorhizobium loti MAFF303099]
    MDTHTYPVTRTDAEWRARLTPEQYAVMRNHGTERPGSCALLYEKRAGTFSCVGCDQPLFESKLKFESGTGWPSFNDPVPG
    SIETTVDRSYGMVRTECHCSRCGSHLGHVFEDGPPPTGLRY
    CINGVALNFEPAA

    >gi|13473490|ref|NP_105057.1| hypothetical protein mlr4105 [Mesorhizobium loti MAFF303099]
    MTGKISALDLASGELSEPTKAYFAKCEEKLGLVPNVLKAYAFDDKKLRAFTDIYNDLMLGESGLSKLDREMIAVAVSSIN
    HCYY
    CLTAHGAAVRQLSGDPALGEMLVMNFRAADLSPRQTAMLEFAVKLTEEPAKIVEADRAALRKAGFSDRDIWDIAST
    AAFFNMSNRVAAAIDMRPNDEYHAMAR

    >gi|13473601|ref|NP_105169.1| osmotically inducible protein C, putative ATP/GTP binding protein [Mesorhizobium loti MAFF303099]
    MDRTATAVWKGNLKEGKGTLDSQSGTLKGTPYSFKARFEDESGKSGTNPEELIAAAHAGCYAMQLSHFLAENGTPAAELD
    AKAVVTLVPGTGITGSAITLVGKVPGIDAAKFKELAEKAKAE
    CPVSKALGAIKVSLDARLG

    >gi|13473621|ref|NP_105189.1| organic hydroperoxide resistance protein [Mesorhizobium loti MAFF303099]
    MALYTTQAHVTGGRAGHGETSDGLLKVDLAMPKELGGPGGATNPEQLFAIGYAACFESAIRFVARKQKLPLTDAGVTSTV
    SLLPNGEGFKLGVALAAETKGLDQAAAEALVSEAHKI
    CPYSNAIRGNVDVALSVKAA

    >gi|13473631|ref|NP_105199.1| dihydrolipoamide dehydrogenase [Mesorhizobium loti MAFF303099]
    MAYDVVIIGSGPGGYVCAIKAAQLDLKVAVVEKNATFGGTCLNIGCIPSKALLHASEMFAEAGHSFDTLGVEIPAPKLNL
    TKMMAHKDATVASNVNGVAFLFKKNKIDSFRGTGKVVAAGKVSVTGEDGKVEEIETKNIVIATGSDVAGIPGVKVDFDEK
    IIVSSTGALSLDKVPGHLVVVGGGVIGLELGSVWARLGAKVTVVEFLDTILGGMDGEVSKQFQRMLSKQGFEFKLGAKVT
    GVAKAKKGATVTFEPVKGGAAETIAADVVLIATGRRAYADSLGLKEAGVEVDERGRVKTDGHLKTNVPGIYAIGDVIAGP
    MLAHKAEDEGVAVAETIAGQAGHVNYEVIPSVVYTSPEIASVGKTEEELKKAGIDYKVGKFPFSANGRARAMLHTDGFVK
    ILADKASDRVLGVHIVGFGAGEMIHEAAVLMEFGGSSEDLARTCHAHPTMSEAVKEAALATFFKPIHI

    >gi|13473659|ref|NP_105227.1| cytochrome c biogenesis protein CycX [Mesorhizobium loti MAFF303099]
    MSGETETPTRGRRLFVLLPLLVFLGLAGLFLWQLLSGRDVSEVPSALIGLPAPQTNLPALEGSNLPGLDSRAFAGKVTLV
    NVFASW
    CAPCREEHPVLLALAQDKRFTMAALNYKDQPENARRFLGDLGNPFQAIGVDEAGRTAIDWGVYGVPETFVIGKD
    GKIAYKHVGPLTAEAARDVLLPQIDKALAVPN

    >gi|13473735|ref|NP_105303.1| thioredoxin [Mesorhizobium loti MAFF303099]
    MSDNKPFGGSFGSNGGQYATTVQYGGTAAAPAKVSLGDTPAAAPAGDVIKDTTTAAFAADVIQESRRQPVLVDFWAPWCG
    P
    CKQLTPQLEKAVRAAGGKVKLVKMNIDDHPSIAGQLGIQSIPAVIAFKDGQPVDGFMGAIPESQIAEFITKVGGKGNGA
    PAVAEALAAATEAREAGDMQTAADIFDAILAQAPETIEAIAGLGELLFEAGDTEGAEALLATAPEAKKDAPVLAALRAKM
    ALAAQAAELGNPAEFERRLAENPKDHQARFDLAMIQNARGERTAAADNLLAIIKADRGWNEDGARTQLLQFFEAWGMTDE
    ATLAARRKLSALLFS

    >gi|13473766|ref|NP_105334.1| dihydrolipoamide dehydrogenase [Mesorhizobium loti MAFF303099]
    MKEISCKLLVIGAGPGGYICAIRAGQLGVDTVIVEAGKPGGTCLNVGCIPSKALIHAAEEFEKVAHMAGGKSPLGISVSA
    PVLDLGKTIAWKDGIVSRLNSGVAGLLKKAGVKTVHGWAMFRDGKTVEVETETGSQVIRAETIVIATGSAPVELPFLPFG
    GPVISSTEALALSVVPKKLAVVGGGYIGLELGMAFAKMGAEVTLVEALPRVLAQYDAELTRPVVKRLAALGVEVMTEAKA
    KGLSTKGDALLVETADGKNTKVSADKILVTVGRKPVTEGWGLDQIDLDMSGKFIRIDDQCRTSMRGIFAIGDVTGEPMLA
    HRAMAQGEMVAEIVAGHKRNWDKRAIPAVCFTDPELVTVGLSPEEAKAQGEIKIGLFPFAANGRAMTKLGEDGFVRVVAR
    ADNHLVLGIQAVGQGVSELSTAFGLALEMGARLEDIAGTIHAHPTQGEGFQEAALKALGHALHI

    >gi|13473777|ref|NP_105345.1| hypothetical protein mlr4484 [Mesorhizobium loti MAFF303099]
    MTLPAQNLLAEEASPYLQQHSGNPVHWRAWSPASLEEARTLDRPILLSVGYAACHWCHVMAHESFENDGVAAVMNRLFVN
    IKVDREERPDIDQIYMAALSSMGEQGGWPLTMFLTPDGKPFWGGTYFPREARYGRPGFIQVMEAVDKAWREKRDSLHQSA
    DGLTSHVEARLSGTHARQSLDRGALTDLAGRIDGMVDRDLGGLRGAPKFPNAPFMLTLWLSWLRDGNAAHRDDVLVSLER
    MLAGGIYDHIGGGLSRYSTDAEWLVPHFEKMLYDNAELIRFCNWAFSASGNDLFRIRIEETVDWLLREMRVEGGAFAASL
    DADSDGEEGLFYTWNRQEIKTVLGDDSALFFKYFTLSAPHGWEGKPVIHQTRTQQAQGVADREKLIPLKARLLAVREERV
    RPGLDAKTLTDWNGLMIAALAEAGRSLGRPEWIEAADKAFAHISGASRDGRLPHSMLGTRKLFPALSSDYAAMANAGISL
    FEASGDWSYIDQAKQFIEQLDHWYPDPAGTGYYLTASDSTDVPIRIRGDVDEAISSATSQIIAALVRLASVTGDPDLAEK
    AWKIAEHAAGRAAHQAYGQAGIVNACALAIEPLKLVIVDSPEDPKLVPVANRCPDPRRVDIIAAIGSETNRPLLPGGILP
    PTDKVGAWLCTGQVCLPVVADAEELERLLRR

    >gi|13473810|ref|NP_105378.1| methionine sulfoxide reductase A [Mesorhizobium loti MAFF303099]
    MDEKAAPGSETAIFAGGCFWGVQGVFQHVKGVSKAVSGYTGGAKDDAVYETVGTGRTGHAESVEITYDPSKVTYGQLLQV
    YFSVAHNPTQLNFQGPDSGTQYRSTIFAENDTQKQIAQSYIDQLDKAKLYPAPIVTTIETGKTFYPAENYHQDFLTLNPT
    YPYIVYNDLPKVANLKQLFPALYSEKPVLVLSASN

    >gi|13474036|ref|NP_105604.1| methionine sulfoxide reductase B [Mesorhizobium loti MAFF303099]
    MNRRDFLLSGAAAIGLVGAAATMLRMGSPQVAQAAEKFEVTKTDDEWKAILSPAAFDVLRKQGTEYPGTSPLLNEHRKGI
    FACAGCDLPVYPSETKFDSGTGWPSFWQEIANGIGKTEDRSLGMTRTEVHCRRCGGHLGHVFDDGPAPTGLRH
    CINGVAL
    SFKPAAA

    >gi|13474238|ref|NP_105806.1| thioredoxin [Mesorhizobium loti MAFF303099]
    MGATVKVDKNNFQADVLNANVPVVVDFWAEWCGPCKQIAPSLEDIATELGAKIKIAKLNIDENPELAAQFGVRSIPTLMI
    FKGGEVADMKVGAAPKTALSHWINGSL

    >gi|13474368|ref|NP_105936.1| mercuric reductase [Mesorhizobium loti MAFF303099]
    MAREQTKAATFPVDRNDVELVRGAHPPRWKNPTPDGPYNLVVIGAGPAGLTAARDAASLGAKVALIERGLIGGACVNVGG
    VPSKSIIRTARLYADMRDAENFGGDTPARLPVDFERAMMRMRQIRQRLSRADSAAAITAEGIDLYFGEARFGGPDTVEVA
    GKTLHFKKALVATGAHPSGPAIPGLAEAGYLDNESMFNLTRRPERLLVIGGGPLGCETAQAFCLLGAKVILAQSDPMFLP
    GEERDAAQILSDTLAREGVEVRLNTEVVAVRKEGGRKLADLLRDGDTTTISVDEIITGVGRSPNVRGLGLEEAGVVYDAN
    GIKVDDHLRTTNPHIYAAGDVCLEYKFTHTAEAAARIVVRNALFRGRERLSDLVVPWCTYTDPEIAHVGLYPIEARQNGI
    PVKTYTVLMHDVARAVMDGEEEGFVKIHVREGSDRILGATVVASHAGEMINAVTLAIRSGMGLHALADVIHAFPTQAQGI
    KMAGDAYRRTRFTSLRRRLAARWLAWSRR

    >gi|13474494|ref|NP_106063.1| hypothetical protein mll5391 [Mesorhizobium loti MAFF303099]
    MLKSKLNVRSFVVAAGIGALLTISPAKAEDASATAAYKDIQATLGSVPDMFKTLPDVAIAGAWAEIKGVQLNPKTALDGK
    TKELMGLAVASQIPCQY
    CIYFHTEAAKLNGASDEEIKETIAMAAIVRHWSTMLNGSQVDLATFKKQTDDVFAAVKAKSQ

    >gi|13474645|ref|NP_106214.1| molybdopterin biosynthesis protein MoeB [Mesorhizobium loti MAFF303099]
    MTTTLTADEIERYARHIVLPEVGGAGQQKLKQARVLVIGAGGLGAPVLEYLAAAGVGTLGIVDDDTVSLSNLQRQVIHAT
    DAVGKLKTDSARAAIAHINPNTAVETHTFRLSADNAPALVTRYDIVVDGSDNFETRYTVADACASARKPLVHAAVGRFDG
    SVTVLKPFEVGKDGKPNPGYRDLFPEAPPPGLVPS
    CAEAGVLGALTGVVGTLQAMEAIKLITGIGEPLIGRLLLYDALAA
    RFETIRYSRR

    >gi|13474673|ref|NP_106242.1| DMSO reductase chain B [Mesorhizobium loti MAFF303099]
    MTCLPSQSGKKLGLVIDLDTCVGCQACVTACKEWNTGGHMAPLTDIDPYGGHVDGVWFNRVHSYEHTTEMGGRTVNFPRS
    CLHCETPACVTVCPTGASYKRASDGIVLIDEDKCIGCKLCSWACPYGAREFDTDVGVMKKCTLCVDRIYNDNLAEEDRVP
    ACVAACPTSARHFGDLGDPHSAVSQLVAERGGVDLMAELGYHPTNKYLPPRAHTQRAASVPAKALEPVRAEGGFLGWVDR
    MLSN

    >gi|13474806|ref|NP_106376.1| thioredoxin [Mesorhizobium loti MAFF303099]
    MATVKVDINNFQSEVLESAAPVVVDFWAEWCDPCKMIAPSLEEISVEMESKIKVAKLNIDENPELAAQLGVRSIPALAIF
    KGGEVADFSVGAKPKTALLNWISNAA

    >gi|13474891|ref|NP_106461.1| peroxiredoxin 2 family protein [Mesorhizobium loti MAFF303099]
    MTVKKKVPFVTFRTRVRDDSIEGPNPYRWEDKTSDDYFRGKRIILFSLPGAFTPTCSTLQLPDFEMLYDEFEKEGIDAIY
    CVSVNDAFVMNAWGKALGLQKVQLIPDGSGEFTRKMGMLVAKDNLGFGMRSWRYAAVINNGVVEQWFEEDGFCDNCEADP
    YGVSSPQNVLETLRAAKAVTAA

    >gi|13474947|ref|NP_106517.1| hypothetical protein mll5942 [Mesorhizobium loti MAFF303099]
    MITLTENAVAAVKAALSRADEPAEGFRIMVEAGGCAGLKYLMGLESVSREGDAIMETDGFKVFVDANSQPHLAGMTVDFV
    TDLESSGFVFDNPNARDKCACGKSFG

    >gi|13475370|ref|NP_106934.1| nitrogen fixation protein fixI [Mesorhizobium loti MAFF303099]
    MSCCAPSAELALDLTSTTSVLPSSQEIRLASRSLGDNLWQTDLSVPTVHCAACIQAIETALGRLDRVEGARVNLSTKRVA
    IRWRGDSVPPFVAALGRLGFQAHLFEADPDKKDKTLAELIRAVAVAGFAAGNIMLLSVSVWSGAEGATRDLFHWVSALIA
    IPALTFAGGIFFRSAWNALRHGRMNMDVPIAVGVSLAYAMSLYETINHGDHAYFDASVSLLFFLLIGRTLDHVMRERART
    AVKGLSQLAARGAMVLRGDGARDYLPVGEIEPGMQLLVAAGERVPVDSRVIRGASDLDCSLVSGESTPKTVASGEQVQAG
    TLNLTGPLTIEATAAAKDSFLAEMVRLMEAPEGGRAHYRRIADRVSALYAPVVHLTAFVTFLGWMAVTGDWHRAVTIAIA
    VLIITCPCALGLAVPIVQVVAARRLFEAGVMVKDGSAIERLAAIDVAVFDKTGTLTLGQPRLVNASTIDPAMLAIAADMA
    AHSRHPFSKAIAAFAGFAGQPKLEAVSEHPGLGIEATTADSTWRLGRRGWAGWKARTGGEGKYGGYGGTVLSKNGRIVAS
    FTFEDATRADAKAAVGQLKDAGVSVEMLSGDIVHACGEVAGTLDIESFVPALLPSGKVERIEVLARAGHKVLMVGDGLND
    TPALAAAHVSIAPATAADIGRNAADFVFLRESLLAVPLALDVSRQAGRLIRQNIAIAIVYNAVAVPIAILGHVTPLIAAI
    AMSASSLLVIGNGLRLQGFRLAELTRASSATHSGIHPSARSS

    >gi|13475502|ref|NP_107066.1| thioredoxin [Mesorhizobium loti MAFF303099]
    MAQDNLVVCDKCGGVNRLPPARNADEAKCGKCGNRLFSGHPLDVDAKAFDHQIARSSIAVVVDIWAPWCGPCKMMAPAYE
    AAARELEPHVRLLKLNSDNEQAVAARLGIRGIPTMILFHGGREIARTSGAMTAGQIVRWVRDRLPTVAA

    >gi|13475529|ref|NP_107093.1| nitrogen fixation protein fixI [Mesorhizobium loti MAFF303099]
    MSCCAPGAEMARDLESSMSVLPSSQEIRLASRSLGGGLNQTDLSVPMVHCAACIQTIETALGKLDNVEGARVNLSTKRVA
    IRWRGNEVPPFVAALGRLGYQAHLFEAEIDNKDKTLAELIRAVAVAGFAAGNIMLLSVSVWSGAEGATRDLFHWVSALIA
    IPALAFSGGIFFRSAWNALRHGRMNMDVPIAVGVSLAYAMSLYETINHGDHAYFDASVSLLFFLLIGRTLDHVMRERART
    AVKSLSQLAARGAMVLRGDGARDYLPVGEIEPGMQLLIAAGERIPVDGKIIQGASDLDCSLVSGESTPRNVAPGEPVQAG
    VLNLTGSLTIEATAAAKDSFLAEMVRLMEAAEGGRSQYRRIADRVSALYAPVVHLTAFVTFLGWMAATGDWHRAMTIAIA
    VLIITCPCALGLAVPIVQVVAARRLFENGIMVKDGSAMERLATIDTAVFDKTGTLTLGQPRLVNASSIDPAMLSIAADMA
    AHSRHPFSKAIAGFAAPGGQHKFDAVTEHPGFGIEATDGGSTWRLGRRGWAGWKARTGGEGKHGYGGTVLTKNGMIVACF
    VFEDALRADAGAAIDQLKHAGMSVEMLSGDTAAACAEVAKVLGVDDFVPCLLPSGKVERIETLAEDGHKVLMVGDGLNDT
    PALRAAHVSIAPATAADIGRNAADFVFLRESLLAVPLALDVSRKAGQLIRQNIAIAIVYNAVAVPVAILGHVTPLIAAIA
    MSASSLLVIGNALRLQASMPNSPAKDVRRNRQSDFNELARSS

    >gi|13475574|ref|NP_107138.1| stress-induced protein [Mesorhizobium loti MAFF303099]
    MRTTGKLLYTAKTRTSQGRENGIARSSDGQLDIRLAAPGSARIGTNPEQLFAVAWSACFQTAIVQVARKQKIALPASSAI
    DAEVDLRLENDSYFISARLNISLPGVDRTVALALLNEAHQI
    CAYSKATRGNIGVTISLT

    >gi|13475879|ref|NP_107449.1| glutathione S-transferase [Mesorhizobium loti MAFF303099]
    MKLCHSTSSPNSRRVRMFIAEKGISTPLHPVNLGEKEQFSDWFKAVNPRQQVPVLVLDDDTKIAEVPAIWRYLEETHPER
    PWLGSDARSKALVAMWERRVELDGFAPTMEGVRNAVAGLKGRALSGPHDYEQIPELVERSKRRVANFYTDFDARLKESPF
    ASGAEFSAADITALVTVDFATAGLKMPIPDQAHALQHWYEKVADRPSAKA

    >gi|13476150|ref|NP_107720.1| hypothetical protein mlr7393 [Mesorhizobium loti MAFF303099]
    MTITIYGITTCDTVKKARVWLESHDVAYRFHDFRADGLDAKRLDGWVGKVGWEKLLNKGSTTFRELADKDKQDLDEKKAK
    ALMLAKPTMVKRPVLELGDRVLVGFKPDVYEQAVE

    >gi|13476239|ref|NP_107809.1| peroxiredoxin-like protein [Mesorhizobium loti MAFF303099]
    MTISVGDKLPEATFKTMTADGAKAITSAEIFPGKKVVLFGVPGAFTPTCSNNHLPGYLENHDAILARGVDTIAVVSVNDV
    HVMGAWARFTGGEDKILFLADGSADFAKAVGLDNDLSAGGMGLRSKRFSMIVDDGKVTALNIETKPGVDESGAAHILGQL


    >gi|13476252|ref|NP_107822.1| hypothetical protein mlr7525 [Mesorhizobium loti MAFF303099]
    MIRMNRPPFGKSLSRRNVLSSLAAIPAVALLAACSDSGEQAKAADVKPADPAAPAKPATPAAAKVPESQGTVDMAELLKP
    GALPDKQLGKDDAKVTIVEYASMT
    CPHCAHFAETTFPDLKTKYIDTGKARYILREFPFDPSAEAGFMLARCAKDNYFPMV
    DVLFRQQPNWVGVSNTKDALLQISKLAGFTQESFEACLTDQKLLDDVRSVQKRGANEFKVDSTPTFFINGKTYKGAMSIE
    EMSAIIDPLL

    >gi|13476495|ref|NP_108065.1| hypothetical protein mlr7830 [Mesorhizobium loti MAFF303099]
    MLLAGRKSERGNEMDATELKAMQAPLKQAYRDDASQALITLRAKGSIDDQSVACKVETGRAIAVAGLHPATGGSGLELCS
    GDMLLEALVA
    CAGVTLKAVATALEFKLGAATVEAEGDLDFRGTLGVAKDVPVGFRAIRLNFTLDTDEPQERIDSLLKLTE
    RYCVVFQTISQKPELTVSARR

    >gi|13476538|ref|NP_108108.1| hypothetical protein mll7882 [Mesorhizobium loti MAFF303099]
    MGGVPSFVKQFPKAGLPGAWAEVKAIELSDKTALPPKVKSLISLAVAAQIPCNYCVWSDTQDAKRAGATDEEIQEAVAMA
    ALTRHWSTIFNGMQVDFDTFKKEMGGQ

    >gi|13476762|ref|NP_108331.1| glutathione S-transferase [Mesorhizobium loti MAFF303099]
    MGRKMAEFTLYIGNKCFSSWSLRPWVAMRHLEIPFEEGFVRLRTPETFANLAKVSPTGQVPVLNHKPLQGGGRIVWETLA
    ILEYLADLFPEKKLWPADIGARALARAAATEMHSGFREVRYGWPMNLRRPKGHKPLDAEGEVQRARIEALWRECREKYGK
    GGPFLFGHFTAADAMYAPVVTRFDTYGGELAPDTRAYVDAVLAMPAMRHWYAEAAKEPWPEPGPDE

    >gi|13476771|ref|NP_108340.1| osmotically inducible protein OsmC [Mesorhizobium loti MAFF303099]
    MTIREASAKWQGTLKEGSGRMKLGSGVFEGAYSFPSRFENGPGTNPEELIAAAHAGCFSMALSAILGTAHHIPASISTVA
    KVDLGATVAGPTITRIELETRAEIPGLAPDEFQNLAERAKTT
    CLVSRALAGVASITLKAELIATTAQ

    >gi|13476798|ref|NP_108367.1| iron (III) ABC transporter, periplasmic-binding protein [Mesorhizobium loti MAFF303099]
    MKRLALSLVFSLLASTAFAFPVTVDSCGKPLTFDAPPKRAVIHDLNMAEMAFALKLQPSIVGLTGITGWYKVGPEFKAEQ
    GSIPELAPKYPTLENLVAVEPDFFFAGWYYGMKPGGDVTPDTLAPHGIKTLVLTES
    CVHLDKNRPAASMDLLYGDVEKLG
    KIFGKEADAEKLVSGWKAQLADITTKVGDRKGTRVFLYDSGEDKPFTAGKFAIPNAMITAAGGDNIMADMDTSWGNTDWE
    TVASRNPQFLILLDYQDGGGYKKLLDFLKAHPAMKETDAVKNERFVALRYAELTPGPANIEAIAKIARAMHPEAF

    >gi|13472514|ref|NP_104081.1| hypothetical protein mlr2838 [Mesorhizobium loti MAFF303099]
    MGRHLAKALPSVRTSVRPLRAVKMDYRRRPRRRPKADRHFSMPKDVCAAHGLKPPARTSVVWIDPRGGISMSERLNIGPL
    RPGETAPNVVLDAITREGKIAIDDFRGEKPVLVGLYRGLH
    CPFCRRHIAMLSQLTPALNEKGIESLTVVNTPIERARLYL
    RYHPMLGLLAASDPERASHRAFGLPNMQITEDESAWPQKVSMSDVKSMRVDLPGEMPEPMDPFAALEYLNKKDSYDITEA
    DQQMMATGIGQLVGQFLLDRDGVVRWTSNEVLDGGLFGAPNTQELMSAASQIGR