Mesoplasma florum L1 uid58055

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50364852|ref|YP_053277.1| NADH oxidase [Mesoplasma florum L1]
    MKVIVLGTNHAGTTAVRTLKRLNPEIEVTTYDRNDVISFLGCGIALWVKGEVKDPNGLFYATPEILESEGINVKMKHEWV
    SIDADKKTVLIKNLETGETFEDNYDKVIVATGTWPLLPPIPGLDLKGVQI
    CKNYDHAKKIQQANLDDSIKKVTVVGAGYI
    GVELVDAFVAHGKEVTLVDFADRIMPVYYDAEFTKHVEERMEKAGVKLALSQGVKEFKGANGKVTHVVTDKEEIPTDYVI
    FSVGVVAQTKQLEGVVELNDRKAILTNEYCQSSNPDIYAIGDCSTVFNKALNMEMPIQLATTAVRTGILAAANIVNGNKL
    ASPGFTGANGIEVFGFKMASAGVSETSAKKMGLDYEAILLSDSDRPEFMSTYKEAWIKLVWDKKTRKIIGAQVASENNHT
    EIMYMLSLGIQKELTIDELPLVDIFFLPHFNKPYNFVTLAGLEVLGLNYFKK

    >gi|50364857|ref|YP_053282.1| dihydrolipate dehydrogenase [Mesoplasma florum L1]
    MFKVKFADIGEGLTEGKVAEVLVKLGQEIKEGDALFFVETDKVNSEIPAPVGGKIAKVLISEGQEIKVGDVVIEIDDGSA
    TVEAAPAAEEENASVVGSTPVSNDLIPSRGPAPTQNVAAQPTPAPVATKHTDIEESFDVIVVGAGIGGYVSAIKTAQLGL
    KTLIIEKQYYGGV
    CLNVGCIPTKSLLRTAKVFEDIVHKAANLGIDMKTKDEPSINWNKALERKDGVVNKLTGGVKVLLTK
    NGVKQIIGEASALDKNTISVNGKKYHCDNLIIASGSVPNELPLPGFAEGRESGFLIDSTKILSLPKIPKTLTVIGGGVIG
    IEFGCLFAALGTKVTVIEGAPKILPMLDQDVTALMTKTLKEKYKIEIFTNAKVKEVKGKSVVFEIDGKEQTVKSDYCLES
    IGRKTVTKGFDGIGLELSERKSIIANDYGETNLEGVYAIGDVTSKIMLAHVASHAGIVTANRIALKANKPDAHDIKMDYS
    KIPSCIYSHPEIAMIGKTEQQLKEEGVEYKTFKFPFAAIGKALADDDTTGFVKIICEPKYKTLLGAHIIGNRATDMISEF
    TTLIECEGTITELARAIHPHPTMSEAIGEAAEALESGKSLNL

    >gi|50364865|ref|YP_053290.1| methionine sulfoxide reductase A [Mesoplasma florum L1]
    MENKTIYLAGGCFWGVQAFFDYQKGIIKTTVGYAQGDIDNPTYEEVCTGKTNHTETLKIEFNEKEISLKEILDLYFSIIN
    PFLLNQQGNDRGTQYRTGIYSINEFDFTFVKKYLENFQKQTTQKVVVENEILKNFFDAEEYHQKYLDKNPNGYCHIDLSD
    YKK

    >gi|50364879|ref|YP_053304.1| thioredoxin reductase NADPH [Mesoplasma florum L1]
    MKKHINENLKDILIIGGGPAGLTAGVYAARAGMKTIILEKEAPGGKMVKTDTIENYPGFDSIKGPDLALKMYMQVMNLGA
    EFVYDEVIKIEKMDNYFIVTTLNGQIIEALSVIVATGTLENKLGIPGEDNLYGKGVSY
    CAVCDGAFHKGNPVAIVGGGYS
    AVEEGIYLSKFVSKLYVVVRKDHFRVDPVTLSKLEQLENVEFLMNSVVKKVNGIDKVESVEIENVITKEIKTVPVTGLFP
    YIGATPVTEFLENLNLDKNEGYLTGDAKLKSNIKGLFIAGDVRDVPLRQIAIAAGDGALAGQMAVNYVQEL

    >gi|50364932|ref|YP_053357.1| organic hydroperoxide resistance protein [Mesoplasma florum L1]
    MSKIYETTVTNTGGRTGEVISSDGKFNLKISSPTLNLEGTTNPEQLFAAGYSSCFNGALQAVMAKNKVSFKTNVTAKVAL
    HNNGELNFNISVELQVEIIGADKEVAEKLMHEADLV
    CPYSKALKNNVEVTLSLK

    >gi|50364994|ref|YP_053419.1| thioredoxin [Mesoplasma florum L1]
    MAEMIKVSTKEEFDKIISEGKTFVDFNATWCGPCKMQMPLVHMLAQKTEGVKFIDLDVDLVPEVAKEYQVMSIPTLMLFE
    NGKESKKNVGFMDPTKLDNFVK

    >gi|50365468|ref|YP_053893.1| NADH oxidase [Mesoplasma florum L1]
    MKTVIIGGSATGMGVAAKLKRLNEQNEIVVIQDKDYVSLGACGIPYYIGHNFENPETLIARKIEKFEESQISVISNSKVN
    KIDFENKKVIFEESQISYDNLVIAVGAKPITPEIKNIDAKNIFTVNSKEDAIEIRKTINDDSNVLIIGSGLIGLEMVENI
    KHSTAAKISIIEKADRVLKNLFDEEFSELVEKEILNQEIELFKNNEVIEFVKDNNGKVTGAKTINGEIIKCDVVILSIGV
    IPNTSFLRDTDLELENNGAIKINEYCETNIPNVYAGGDCCSSLSYLYKNTRTFYLATVANKQAKIIANNVNKNKSSKFVG
    ALGTTIIRFFDLELARTGENRMFIDMNSIETKEVLIKDKDHTNYVTGQEDIWLKVIIDVKTKEIINVQMIGKNKSVLRIY
    GLVGLIWSRSKVDETLEQIDLPYSPPFSRTTDIIHIALSKLI