Meiothermus silvanus DSM 9946 uid49485

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297564565|ref|YP_003683537.1| Rhodanese domain protein [Meiothermus silvanus DSM 9946]
    MSKLDPKTAYRLVHDGNARLIDIREPQEWHQTGVARGATLLPQTQLDRCLGELERRPSILVCRSGNRSEQVRRELEARGI
    RVWEVEGGLLAWIEAGLPLSHPIAAERC

    >gi|297564610|ref|YP_003683582.1| copper-translocating P-type ATPase [Meiothermus silvanus DSM 9946]
    MTKELQIGVEGMTCAACVNRVERGLKKVEGVEAASVNLATERATVAYDPATTTPQALIEKIQEVGYTPVVAEVELGVTGM
    T
    CAACVGRVERALKKLDGVLEASVNLATERATVRYLPASTGLAQFKRAIRDAGYGVLELGKGQNRADLEREARAKEVANL
    RRAVLMAAAFALPLFLIAMLPMLFPPVEEWLMRTFGHGVMAALSWVMLALATPVQFGPGLRFYRHGWKALRSGSPDMNSL
    VMIGTSAAYFYSLAVVLFPGLFPPQARHVYFEAAGVVITLILLGKYLEALAKGRTSEAMQRLLSLQAKTARVVEGSTEQE
    IPVDEVLPGDLIAVRPGEKIPVDGVVVSGESYVDESMITGEPIPVLKSEGAKVIGGTLNQNGAFTFQATAVGEGTVLAQI
    IKLVEAAQGSKPAIQNLADRVVAVFTPIVLGIALLTAGVWLLFGGENALTFALVNTVAVLIIACPCAMGLATPVSVMVGT
    GKAAEMGVLFRKGEALQTLQEAQVIALDKTGTLTQGKPELTDLQALEGFDEAELLRLVASLEKSSEHPVAQAIVKAAQGR
    GLELSEPVDFEALPGYGVGGQVGMYRVEVGADRYMARLGLDVSAFGAEAARLADEGKTPLYAAVNGKLAAILAVADPIKE
    GTPEAIAALHRQGLKVAMITGDHRRTAQAIARQLGIDEVLAEVLPAGKADAVKELQAQGYKVAFVGDGINDAPALAQADV
    GIAIGTGTDVALETADVILMSGDLRGVPGAIALSRATLKNIRLNLFWAFAYNIVLIPVAAGVLYPFTGWLLSPVLAGAAM
    GLSSVFVLSNALRLRRFRPPFGTKIPSEPVAVQAVPA

    >gi|297564612|ref|YP_003683584.1| Heavy metal transport/detoxification protein [Meiothermus silvanus DSM 9946]
    MSIELKIEGMSCGHCKMSVEKALKSVPGVEKVEVFLQEGRAIVEGNAPVDRLINAVQEEGYTASVRP

    >gi|297564628|ref|YP_003683600.1| glutaredoxin [Meiothermus silvanus DSM 9946]
    MIRVYGLTGCGPCEVVKLFLKQKNLPFEFLDVQESPEARQKVLEMVGTLTAGVVLEVNGEPIALSGVSIPKLEAWYQEYL
    RRWRT

    >gi|297564858|ref|YP_003683830.1| thioredoxin reductase [Meiothermus silvanus DSM 9946]
    MSEYDVVIVGGGPAGLTAAIYTGRANLKTLILEKGLPGGQIAQTEEVENYPGFPEAISGPELAKRMEDQARKFGAELIMD
    EAQAIEKADFGFLVKGFEQDYRAKSVILATGATPKKLGVPGEEKFYGRGVST
    CATCDGFFYRGKEVVVVGGGDAAVEEGL
    FLTKFASKVTLIHRRGELRANKTAQARAFANPKMHFLWNTVVEEVLGEETVTGVRLRNLETGEVYDYPTDGVFVFIGHTP
    NTEFVKGLVALRPDGYVDVKDEVYTSVPGLFAAGDVADPIYRQLGTSVGAGTRAAMVAEKYLAAREHPESEIAQDPSPVI
    EAYLSE

    >gi|297564886|ref|YP_003683858.1| thioredoxin [Meiothermus silvanus DSM 9946]
    MNVVVCPSCGAKNRLGTPPAGQVPVCGACKKPLPWLVEVGEGGLTPELQAGVPVLVDFWAKWCGPCRMVAPVLEEIAREQ
    AGRLKVVKLDVDRHPLPASAFQVQSIPTLILFKNGQPAERIVGALPKAALLERLMPHLKQN

    >gi|297564889|ref|YP_003683861.1| glutaredoxin [Meiothermus silvanus DSM 9946]
    MLYRTPTLASVVVYGTRWCAQSQLVRRYLERLGIPYRFVDLEEHPEAVAQLRWWTGGYASHPTVYVGGEVLVEPSLAELE
    RSLMRRGLL

    >gi|297564890|ref|YP_003683862.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus silvanus DSM 9946]
    MSQRFAELSERFMALEPQLPQGPEREALSVLFAMAQEAWRQQGQTSPSEGGLEWLRNLYKSAPKMEAAAVNPGLPVGSPA
    PDFSLPNAQGEHIRLSDFRGRPVVLVFYPLDWSPG
    CSQQLDLYQSELAEFERRGAQILGISVDSIYSHGAWAAVRRIAFP
    LLSDFHPKGEVARRYQVFRENDGFSERALYVVDGSGMIRYAHVSPYLHHVPPIEELFAALDALRR

    >gi|297565063|ref|YP_003684035.1| glutaredoxin [Meiothermus silvanus DSM 9946]
    MAARVQIYGTGWCSFSRGFQNYLRSLHIPFEFFDIEKDPAAEEAVRLMNGGTLKFPMVVVGETLQGPWKPQDGGKVMKNP
    LLDDLEAALRGAGLLRP

    >gi|297565319|ref|YP_003684291.1| hypothetical protein Mesil_0871 [Meiothermus silvanus DSM 9946]
    MAQSVPIGYGLEEGTQILVFVVPNCAPCESLAALKDFPITFVGRAEQMPYNPYRQDKGDLLARALRIHTAPTLVVLKDGW
    EVKRITGKINPTPKTLGLLIDAAEAGLLSPQYAMPLALGQPAPAPYQDFTGLLIFGYEGCSWCQREKDTWARLCQQSVRL
    KIIYSEGKWPEACKGELNTALFSTFGIPGTPTHVYLREGRVVWVDVGYRSDLEEVAQALGAMEVK

    >gi|297565368|ref|YP_003684340.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus silvanus DSM 9946]
    MLHYPNLPLGSDLIDAQLPNTQGRIYRFSDFREPVLAIVFMCNHCPYVKGSIAELVRLARRYPGQVAFVAVNPNDYTRYP
    EDSPQAMDAFVAEHGIPFPYLLDESQEVAKAYGATRTPELFVFDRERKLRYHGRVNDVPKDAAQVQEHTLEIALEALLQG
    QAPPVGEAPAIGCSIKWKPGNEPNLTIEPTPSAGR

    >gi|297565387|ref|YP_003684359.1| periplasmic protein thiol/disulfide oxidoreductase DsbE [Meiothermus silvanus DSM 9946]
    MKRTFAAQAGWRLWPFALLVVLGALLFWGLRRGDPGALPSVLVGKPAPDFTLPTFAPYRAEWGEQIQLSKYLGRKPILVN
    LWASW
    CVPCRDEAPLLEAAWRQYKDRLLILGVNVQDTNPGAALGFIQEFGLSFPSGIDTNGRVWIDYGGYGVPETFLIGK
    DGKVLYRHAGPLNPATLQELLGKVL

    >gi|297565435|ref|YP_003684407.1| methylated-DNA/protein-cysteinemethyltransferase [Meiothermus silvanus DSM 9946]
    MALMTDLAQRATRLKGTKTDVELVRRASKCLAAFETVPTLAQWSAAVGVTPNQLKVAFQRVLGISPRRYAEAVRLEKLKL
    QLKNGGDVTRAMYEAGYGSSSRLYEKAKQKLGMTPGVYRKGGAGEIIRYATAQSPLGWLLVAATEKGICSVCLRDDCEEA
    RLALRVEFPKANLLEDSEGLKGYLEAILDYLEGRLVHLDLPVDLRVTAFQLQVLELLRRIPYGETRSYSQIAEALGSPKA
    VRAVAQACGANPVPLLIP
    CHRVVQKDGGLGGYSMGLERKKALLQIEQQHKGELAE

    >gi|297565464|ref|YP_003684436.1| uncharacterized peroxidase-related enzyme [Meiothermus silvanus DSM 9946]
    MAFIGTFPVNQATGEVRAMYERAQANLGYVPNYAKVFSLRPEVMGAWSGLLASIRGHMDLRRYELVTLATARALHSSYCM
    LAHGTILRRQFYGPEQLAAIAGGTADAGLEPAEAAMMAFAERVAKDASSITASDVEGLRAHGFTDAEIFDIAAAAAARCF
    FSKLLDALGAEPDSVYLELEDDLRRRLTPGRPVSAAPVERVPEVPAAGEG

    >gi|297565572|ref|YP_003684544.1| dihydrolipoamide dehydrogenase [Meiothermus silvanus DSM 9946]
    MSTVYDVIVIGTGPGGYHAAIRAAQLGKRVLAVEAEYVGGVCLNVGCIPTKALLHAAEELEGVKHGASFGLEVKDAKIDL
    KKLGSWRDGIVKRLTGGVSQLFKGNKVELKTGFAKFVGPKTIEVAGERIEGKTFIIATGSEPNTLPGFEVDQKDIVDSTG
    ALRVEDKFPKRMLCIGGGAIGLEFAQVYKRMGAEVTVIEFMGQILPAADPETAGLLAKILTKQGIAIKTHTKGVKVERKK
    DGLHVTLEDVKTGKQEVIVVDKILVATGRRPRGKGLGLEAIGVKVDERGYIPTNEKMETNVPGIYAIGDVTRPPLLAHKA
    MKEGLVAAENAAGGNAVMDYQIPNVVYTSPEWAAVGLTEEEATQAGYKVKVGKFPLSASGRAMTLDATDGLIKLIGDAET
    DLLLGAHLVAPSASDLIAEMALAIEMGATVTDIGLTVHAHPTLSEGIMEAAENLHKQAIHIANR

    >gi|297565586|ref|YP_003684558.1| mercuric reductase [Meiothermus silvanus DSM 9946]
    MSYDLLIIGSGSAGVAAALEAASKGAKAAVIEGGVLGGTCVNVGCVPSKALLRAAEAFHKAGHHPFRGIRTQAERVELEQ
    VIEQKDALVRSLRQEKYAEVLEAAGAPLIRGQARFLDGETLEVNGQVHKAQRYLLATGASATLPPIPGLADSKPWTYPEA
    LSPDRQPQNLLVIGVGAIGLEIAQAYARLGTEVTVLEATPYLLPSEDPELSTMLRGYLEAEGLSVHTGVRVERVERDSEF
    RVHTEGGVFRAERLLVATGRKPRTGGLELEAAGVGLGPRGEIQVDAHLKTSNPRVFAAGDAAGLPQYVYVAAQSGRVAAR
    NALGGEEALDLQAVPRVTFTDPALATVGLTEEEARKRYGSGIRVARLPLDQLPKALAQHDPRGMFKLVVDTEGGVLGLSI
    LAPEAGDALQEAVLAVKFGLNYRDLIDTFHPYLTLAEGIRLVAQALDTEVGRLSCCA

    >gi|297565755|ref|YP_003684727.1| Rhodanese domain protein [Meiothermus silvanus DSM 9946]
    MAELQLPTPLVSTAWLIEHLADSKLRIVDVRFSLADPLAGYMAYREGHIPGAVYLNLEADLSAPLRPDRKGGRHPLPTPE
    AFARTLSQAGIGNEHGVVVYDDNGMVAPRLWWMLRWLGHDAVAVLDGGVRAYLEAGGKLEPGSSTYPPTTFTPHPRPEML
    LDAEAVAGRSADTVLIDSRAPERYRGEVEPLDPVAGHIPGAINRNWADSLDTSGRFKPAQAQRARFAEVEGKDLIVY
    CGS
    GVSATANLLALEVAGIKGARLYAGSWSDWVSDPSRPVAKGEEG

    >gi|297565813|ref|YP_003684785.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus silvanus DSM 9946]
    MRNLLCLLALLTSAFAQKIGDPVNLPKVQDSYNKPVDLPALTQEGRYLLFWFYPKALSPGCTAQGKRYAELYDEFKKLGV
    EVFGVSADPGAEQCAFIEKLALKGGMIPDKSGTLARLFGVGGFFGFYNRDTILVNPQGRIEQIWRGVNPFRDADTVLAYL
    KEKLAKR

    >gi|297565939|ref|YP_003684911.1| Disulfide bond formation protein DsbB [Meiothermus silvanus DSM 9946]
    MTAEHPSTQARNNLLLAFAWLVALVATLGSLYYSEIRLFLPCELCWYQRVFMYPLAVILGIAAWRGDYNVRLYALPIAAI
    GWLVSLRHNLEQRFPDHFPAA
    CKGPISCTSEYIPSFPIPLQAFIAFTLIILALLLIRSPKR

    >gi|297566042|ref|YP_003685014.1| UBA/THIF-type NAD/FAD binding protein [Meiothermus silvanus DSM 9946]
    MWSREELDRYARHIILPGVGAAGQARLKRGSVLVVGAGGLGVPVLQYLVAAGVGRIGIVEMDKVDPSNLQRQVLYGIQDI
    GRSKAEVAKERLEALNPHIQMDLYPIRLDSTNALEVLGPYDLVLDCTDNFPSRYLVNDACVLLDKPLVYGAIHQFEGQIS
    VFHYRGGPCYRCLYPTPPKPGTVPN
    CAEAGVFGVLPGVIGSLMASEALKVLLELGEVLSGKLLLYDGLEPAFRTLHLTRN
    PACPVCGDKPTVLELQDYEVFCGVEG

    >gi|297566049|ref|YP_003685021.1| heavy metal translocating P-type ATPase [Meiothermus silvanus DSM 9946]
    MAAYSSKSSTPEYCYRVEGMDCAECASKIETVIGKTPGARNPQVVFATQTLRFHLDESVTPREQVEARLRSLGYQPTLQS
    APGEGQAAGLEHGDTHRPWHATRQGHGVLLTGALLAAAFAFGFLEPRLAQWGYVAATLVGVWPLARKAWAGVRLGNPFGI
    NTLVTIAAIGAVVIGEAPEAAVVVFLFAVGELLEGIAAGRARAGIKALAALAPKTAFLLEGEGEDIRTREVPASSLRVGQ
    VVQVRPGGRVPADGTILSGFSALDDSPVTGESVPVSKGPGDRVFAGSINTDGVLTVRVDKDPSDNTIARIIHLVEEAQGS
    KAPTARFIDRFSRYYTPGVLAIATLIAVVPPLFLGGAWHEWLYKALALLLIGCPCALVLSVPAAITSAISAGARRGLLIK
    GGAVLETLARVRTVAFDKTGTLTEGRPRVTDVVALEGSEAELLGLAAAVEQGSSHPLAKAIVEKADEVGATLPPSSDQQA
    VQGKGAQAMVQGRTLVVGSPRYAAELAPLAAEVAGQIEAMELQGKTVVVLLNPPTPLGLIALRDEPRPDAREALARLEGL
    GVRCVMLTGDNARTGRAVAEGLGLEVRAELMPEDKLRAVGELGQGRPVAMVGDGINDAPALARADVGIAMGGGTDVALET
    ADAAVLRGSVRGVAELVRLSRGTMRVVAQNIAFALGLKAVFLATTLLGVTGLWPAVLADTGATALVTLNALRLLRWRY

    >gi|297566133|ref|YP_003685105.1| uncharacterized peroxidase-related enzyme [Meiothermus silvanus DSM 9946]
    MSQVPSKPKRKTAPIPPTPAASTAWVKVPEPSEAPPEVQALFAKFLEKTGLIPNVARNFALLPEHFLRWFRYYDFLMRSE
    EHSQLSRKEREMIAVVVSSENRCEY
    CLASHSAYLREISGDPVLPEVLAANYRRADLAPRERALLDFAVKMTQDSPTMSPD
    DLIPMRAVGLSDEAIFEAAQVAAMFNFTNRLANALGWKPNEEYYYQHRTPKADE

    >gi|297566141|ref|YP_003685113.1| protein of unknown function DUF255 [Meiothermus silvanus DSM 9946]
    MANRLALETSPYLLQHAHNPVDWFPWGEEAFAKAKAEDKPIFLSVGYATCHWCHVMERESFEDPETAQLLNEFFVPVKVD
    REELPDVDHVYMMALQALTGSGGWPMSLFLTPDLKPFYGGTYFPPEDRHGLPSFARVLKTIASTWQNRREEVLGSADELT
    QHLHKLLVPRGGPLPQDLHAQALKQLARAHDATHGGFGGAPKFPQAPTLTYLLALAWKGDPLAWGMLELTLDKMAEGGIY
    DQVGGGFHRYAVDGIWRVPHFEKMLYDNAQLAWVYLGMSRLTGKTLYRRVTLETLDYLLREMQHPEGGFYSAQDADSEGV
    EGKFYVWSEQEVRAVLGSDAEAALKLFGVSQAGNWEGVNVLEARYPEPALRQELGLDEATFARWLEEVKAKLYQARRQRI
    PPLTDDKILADWNGLALRAFAAAGRILGKEAYLEAARKNAEFVTSRMMRDGLLRHSWRGGKLRPEAYLSDQASYGLGLLE
    TYQATGEMRWLEAARTLAEGILTHFRDPNGGFFDASGGGLPLRAKDVFDGPYPGGNSAAAELLIRLAALYEREDWAEAAR
    GAIEFHAQGLAHSPSAFPGLLLAHLLDTEGTELALPTPSGLAREVQSQFLPLTALAIGQPGELPALRGREAGKAYLCRRG
    VCRLPVDGLEALGEELRAIYPEARV

    >gi|297566225|ref|YP_003685197.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus silvanus DSM 9946]
    MVHIGEPAPAFSLLDQEGKIHNLADYRGKWVVLYFYPKDDTPGCTKEACNFRDEKGRLEEMGAVVLGVSADDLESHGKFH
    AKYALNFPLLSDPSTEIIKAYGAWGVKNAYGKEYEGVLRQTFLIDPQGKVAKVWEKVRPDEHALEVAEALSELQKA

    >gi|297566270|ref|YP_003685242.1| DSBA oxidoreductase [Meiothermus silvanus DSM 9946]
    MQKANPSPQRGLFLIVAVIAVVLAVVLFVFLRPKPTAADPAAGARFVFGSPSAKVTIVDFSNYLCPHCADHALRNVPEIF
    RDYVDTGKVRYIFRDFPFTGQDNVIRAGEAAACAADANRYRDYHEVLFRAQRLWGGLSGAALDQFFIDLASQLGIPAGPF
    AECLRSGSKRAGVLADRDLTTQLALRGTPTFFVNGQLFDDGYVPYEKWKERIENALAGKTSAPSQGGESTPAPKQP

    >gi|297566356|ref|YP_003685328.1| dihydrolipoamide dehydrogenase [Meiothermus silvanus DSM 9946]
    MPAHQVVVIGAGPGGYVAAIRAAQLGLDVACVEKERALGGTCLRVGCIPSKALLEASERFYAAKEGKLVGVKLGEVQLDL
    AAMMAHKDKVVKASTDGIDFLFKKNKVTRYLGHGRIVGPNRVVVEGPEGTTELETTYIIVATGSKVAMLPGVEVDYQTIV
    TSDQAIAFDRVPQSLLVIGGGVIGLELGSVWHRLGAKVTVLEYLPRILGGMDGELSKTAERIFKKQGLDIRTGMKVTRGY
    VKDGKGVVEVETGETFVAEKVLLAASRIPNTDGLGLESVGISLEQGRIPINAHWQTQVPNIYAIGDVVLGPMLAHKAEEE
    GVAVAEYIATGYGHVDYGSIPNVVYTHPEIASVGKSEEELKAEGVPYKKGSFPFSANGRARAINDTEGFVKVLAHAETDR
    VLGVHIIGPHAGDLIAEAAVAMAFKASAEDIGRASHAHPTLAEAVKEAALAAWDRPLHI

    >gi|297566423|ref|YP_003685395.1| Redoxin domain protein [Meiothermus silvanus DSM 9946]
    MSLARANLLRWGLAVLVVGGVVYGLLGRPTSRPAAVPLPNLVLETEQGQPQNLRAFVGKPVVLNTWATWCGPCRREMPLL
    LEEAARQHNVQFVFVNMGEGPEAIRIFLDEVKLKKIPNLLLDKKTALSEVLQIQGLPTTLFFDAKGNLLARHLGEINREE
    LSGYLGRLE

    >gi|297566672|ref|YP_003685644.1| Thiosulfate sulfurtransferase [Meiothermus silvanus DSM 9946]
    MSYAHPEVLVSTDWVLEHLNDPNIRVLEVNEDILLYDTGHIPGAQKIDWQADLWDPVIREFIQPEELAQLFERLGISNDT
    TIVLYGDKNNWWAAYAFWFFSYNGHQHLKLMNGGRIKWIQEGKPLTTEKPTYPKGSYTPGKRDPSLRAFRDEVLQHLEKV
    KAGKGALVDVRSPAEFTGEKTHMPEYPQEGVLRGGHIPGAKSIPWASTVNPDGTFKPVEELRALYEPKGVTPDKEVIAY
    C
    RIAERSSHSWFVLKYLLGYPNVKNYDGSWTEWGNSVGVPIAKGPE

    >gi|297566673|ref|YP_003685645.1| Rhodanese domain protein [Meiothermus silvanus DSM 9946]
    MKSVDAASLPAFLERRPLVVDVRSPVLFRQGSLEGALNIPTADIQQKKHQLPKDRPILLVCERGIQSELAGLYLEADGYA
    EVYNLAGGLNALKR

    >gi|297566768|ref|YP_003685740.1| DSBA oxidoreductase [Meiothermus silvanus DSM 9946]
    MKRWCGLLAAFLLGHAWAQISFPPENLTQALGVNSQGRTFTYNRGTVQLELLAGLVYKVGYRGPATDYLGAGRVLAAGIG
    EPKIAEAFLGFMRQNADKLRGKGPQNIGVVDGFTFTLTLAADLSFTLAPVEIKDFGPDRHVLGKSGVMIREFSDFQ
    CPYC
    KQFTLQVKPELEKRYINPGLARFSFRHFPLTQIHPQAMPAALAAECAAQQGKFFEYHDALFEKGINVSARAQELKLDELK
    LLRCTQDPATRQIIESDLAMGNQVGVNGTPTVFVGPFRLPNAYDIDAYERYIKMANAL

    >gi|297567014|ref|YP_003685986.1| Rhodanese domain protein [Meiothermus silvanus DSM 9946]
    MVKNIRPQEAKQLLEQGVLFVDVREVEEFDEARIPGAKLIPGSEFAERFREIPKDQPVVVYCRSGNRSAQAAYWLAGQGY
    SNLLNLEGGLLSWYRQGLPLDTQPVEETYPTAHYTDLTPHQAEAWIREGAYVVDVREPYEYAMGHLPGAVNIPLGRFPQS
    LGQLPRDRKILLV
    CASGGRSSSAAEYLVGQGFSKEQVGNLEGGTYGWMSAGLAVER

    >gi|297567015|ref|YP_003685987.1| Rhodanese domain protein [Meiothermus silvanus DSM 9946]
    MLGWFRNLLGPGVPSLSPQEAQAKLKSGAILLDVRTPYERKDGKIPGSKALPLAELAKGWESLPKDKEIICQCASGNRSR
    QAAAFLARKGYTAYNLLGGIEAWKRAGLPLKK

    >gi|297567016|ref|YP_003685988.1| Rhodanese domain protein [Meiothermus silvanus DSM 9946]
    MLFKQIYEEGLAQASYLIGCQASGEAMVVDPKRDIDTYLEEARKNGLKIVAVSETHIHADYLSGARELAQATGATLYLSD
    EGDEYWKYSGLEGFKHQLLRDGDEIRLGNVRVKAVHTPGHTPEHLSFLVTDGAAAGEPGFLLTGDFVFVGDIGRPDLLEE
    AAGIVGTAEPGARRMFKSLKEKFLTLPDYVQVWPGHGAGSACGKALGAVPSSTVGYERRFAWWADYLAKDDEEGFVKALL
    SGQPEAPSYFAVMKRLNRDGMTILGDLPQPHRLTPEQFRQALQGGAVLVDTRDKFAFAGGHLPGSLNIPAGKNFSTWAGW
    LLPYDRPLVLLAGSEAVQGLVRQLVRIGLDRIVGYIPSLEGYAEGELEAVPQASAAEVKAKWERGEVLILDVRGADEYKA
    AHIPGALNIHAGRVMQNLQRIPKDRPIVLH
    CLGGDRSSTAISALLAAGYSNVSNLTGGIKAWQEHGFPLEKGEAPQPVGA


    >gi|297567017|ref|YP_003685989.1| glutaredoxin-like domain protein [Meiothermus silvanus DSM 9946]
    MNFLDEKIQAQVREALAPIQNPVELVVFKGSGLILPGQDAPGMQEETLGLLKEVAALNEHLTVVEKTLSDPEAQALGLKL
    APTILLREAGSSRSNIRFIGLPAGYEFSTLIETLLMLGTGMSGLGEKSQGELQKITQPVRMQSFVTPT
    CPYCPRAVLTAF
    RFAFHNPNVVAEGIEANEFPLLSAQYRISGVPDTLILGQGTERVLGGQPERVFLESTLKAAGVGVQA

    >gi|297567018|ref|YP_003685990.1| Rhodanese domain protein [Meiothermus silvanus DSM 9946]
    MKLKLSLLVLALLGLVGAMAQAGYQNVSVQQLHQARSPKFILDVREPYEFAAGHVAGAKLIPLGQLAQRATEIPRNIPVY
    VI
    CRSGNRSAQASRILVSKGFSNIHNVQGGLLAWQAAGYPVRR

    >gi|297567019|ref|YP_003685991.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus silvanus DSM 9946]
    MNFTPDALRLGPLVIEWSRFSLILGLLVFLTLVGRLRQPRLEAAAWQAALAGVLAARLGYALEHPQAFLHSGLFPALVAL
    VDIRSGGFAWGWGLLGAGLVALWRLRGESPRLLPAGALAVGIALIPQLLKPVPGQAVQALPPGLQLERLAPDGSVQLVAW
    KDLPKPLLINVWASW
    CPPCRAEMPLLAEYAKQGYPIVFLNSGEDAPTVRAYLDGVGIGTAYLDAGDVQRRLEVSGLPTTL
    LIGADGKVKARHLGSLSRVQLVELLNTFKETP

    >gi|297567098|ref|YP_003686070.1| peroxiredoxin, OsmC subfamily [Meiothermus silvanus DSM 9946]
    MPIRSAEAIWQGTLREGKGHLKLGSGAWEGPYTYRMRFEDEPGTNPEELIGAAHAGCYTMFLSGLLANNQTPAERLECTA
    KVHLGEGPTITKIELHLEGKVPGLDEAKFRQLAEQAKAG
    CPISKALAAVPEIVLEARLV

    >gi|297567115|ref|YP_003686087.1| iron-sulfur cluster assembly accessory protein [Meiothermus silvanus DSM 9946]
    MVQEPNAFQETNGVEPPVLTITENAAAKAQEILQKYNKPQAAIRVFIKSGGCSGYQYGMAVDERELEGDTFVEMHGVRLV
    VDRMSLPLLIGSQVDWVESMMGGGFTVNNPNATSSCGCGHSFRTDGAKVPEGAGGCGSH

    >gi|297567294|ref|YP_003686266.1| electron transport protein SCO1/SenC [Meiothermus silvanus DSM 9946]
    MAEPTPLPPARRRNVWLPGLLVLLLAGLGYLAYTRFANPYQPYGTPLLNPRAAYDFTLTDNKGKPFRLSSQRGKVVLIFF
    GFVN
    CPDVCPTTLLELKKVYQALTPEERRRVQVVMISVDPERDTPEVLDKYVTFFDSSFIGLTGTPQQIAEVAKPYGVFY
    QKSEIKSAKQYNVDHTASTYLIDPKGALRLIYGNGKPAETQRMVQDVRWALKN

    >gi|297567396|ref|YP_003686368.1| thioredoxin [Meiothermus silvanus DSM 9946]
    MAKPIDVNDGNFDQTLKENSLVLVDFWAEWCGPCRMVAPVMEELASEYQGKVTVAKLDVDANPKTAMKYRVMSIPTIILF
    KNGEPAEVLVGAQPKRNFEARLQKHVPAAAQN

    >gi|297567468|ref|YP_003686440.1| peptide methionine sulfoxide reductase [Meiothermus silvanus DSM 9946]
    MSQNLETATLGGGCFWCLEAVYDELRGVTDVVSGYSGGHVENPTYEEVCSKKTGHAEVVQVTFDPKVVSYRELLEVFFTI
    HDPTTKDRQGNDVGPQYRSVIFYHSPEQKATALQVIGEFEQAKVWDNPIVTEVVPFEKFYPAEDYHQEYFKKNPYQPYCS
    FVVAPKVAKFRKHFFDKLKRSAAL

    >gi|297567531|ref|YP_003686503.1| Rhodanese domain protein [Meiothermus silvanus DSM 9946]
    MIVQQAPKNALLIDTRAPQLYATGHLSGALNLDLSPISPRLHTPADLAAFEESLANLNGQIGATPDRPVVVYDQGLTGAA
    GRTAYLLALSGLEVHLWPSGWETQATSTEPVQPTPSQPWAKLNRDILLTLEEAARYPNLVDVRRPEEFAAGHIPGARSLP
    LDQLFQPGVLSRLELKPGDEVGVY
    CRSGTRSAVAFWILQSEGIKAKNYLGSMLDWQGSGQEVEK

    >gi|297567558|ref|YP_003686529.1| hypothetical protein Mesil_3199 [Meiothermus silvanus DSM 9946]
    MLSRRRLLALLPLLPWAQAQAGCEDWTVRFGEFIERVPPASYLVYPTEARDLLLFDPFILDVRTREERGRGYIPRSVHIY
    AGEVPKRLSELPKDRSALVLVY
    CASGSVSAVIAAYLQSLGYANAKNIAHGFKGWLDAGLPVEGERP

    >gi|297567793|ref|YP_003686764.1| PE-PGRS family protein [Meiothermus silvanus DSM 9946]
    MLSRRRLLALLPLLPWAQAQAGCEDWTVRFGEFIERVPPASYLVYPTEARDLLLFDPFILDVRTREERGRGYIPRSVHIY
    AGEVPKRLSELPKDRSALVLVY
    CASGSVSAVIAAYLQSLGYANAKNIAHGFKGWLDAGLPVEGERP

    >gi|297567801|ref|YP_003686772.1| sulfur oxidation protein SoxY [Meiothermus silvanus DSM 9946]
    MRTGILGLIGFVYCVFSLALGADFSRWYAYAEASRLAQQEGRTLLVYFWSHGCPYCEQMNTFVFSDPAVSRTLERCFVVA
    SVDSQSPEGIPLARQLRALGTPTFVFLAYSGGRWQETGRLLGSRPRAQFLAELQQVSTQGGSGCG

    >gi|297567802|ref|YP_003686773.1| hypothetical protein Mesil_3457 [Meiothermus silvanus DSM 9946]
    MGRRSVGVVLAVLSLAATWAAKPGEKAPDFRLADAGGTPYTLASFKGKPVVITFWASWCTVCKAEFPKLHRLAQEYRVPF
    VVISREPRDTTQVVLSYMKAYPAFLPLVAAPGGDIPAAVADRFKVLGQPWTFVLDGEGRIVNLYAGRVEVEAIRDDLALA
    GYRGATP

    >gi|297567810|ref|YP_003686781.1| transcriptional activator domain-containing protein [Meiothermus silvanus DSM 9946]
    MDLAQKRRYKDQLFAQFARIGKALANNHRLELIELLAQGERSVESLAREADLSVANASQHLQVLYSAGLVEQRRQGVFVY
    YRLSESTFPLWRALRDLARRHLAEVERLVARTLEREGDVVSLEALSSKLERGDAVLLDVRPRQEFAAGHIPGAIPAPIEE
    LEALLPSLPRGVEVIAYCRGPY
    CTFADEAVELLRARGFQARRLELGLPDWREAGYPVVAEGNA

    >gi|297565695|ref|YP_003684667.1| glutaredoxin 2 [Meiothermus silvanus DSM 9946]
    MSDKLDIHSDSRAESCMGYVLVSRRGCHLCEDAEQALKAASLPYHWRDVDADPDLRGYTFRVPVLLHGGKVVLEGWITHD
    KLMRALNRIEEC