Meiothermus ruber DSM 1279 uid46661

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|291294424|ref|YP_003505822.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MWGWFKNLLGLGPRVPRISALEAQEKLRAGALLIDVRTPLERKLSKIPGSQGLPLAELARRWESLPKDRPIICFCESGSR
    SQQAAEFLAEKGLEVYNLAGGISAWQAAGLPVKKGDLQR

    >gi|291294425|ref|YP_003505823.1| glutaredoxin-like domain-containing protein [Meiothermus ruber DSM 1279]
    MFLDEKIQAQVREMLAPIQTPVEVVVFTTAGLELPGQEVGLQDETLGLLKEVVALNPHLSLEQRSIHSDPEAQALGLRYA
    PTILLREKGSNRNNIRFLGLPAGYEFSTLIETLLMLGTGESKLGEKSQADLQKVASPVRMQAFVTPT
    CPYCPQAVLATYK
    LAYHNPNIIAEGVEASEFPLLSRRYNISGVPDTIISGATQQRILGGQPDRVFVEAAIKASAGVVV

    >gi|291294426|ref|YP_003505824.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MKAIASLVVFLVASAGLAQGFKVVTVDDLYRALPDPKTFVIDVRTPQEYARGHVPGAVNWPLQQIEQWWSKVPKDRVVYV
    K
    CNTQNRSRVAVQYLLSRGYRNLNLVTGGIQAWMARGYPTTR

    >gi|291294579|ref|YP_003505977.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MPSPLVSAQWLHEHLGDERLRIVDCRFSLQDPSAGRQAYTAGHLPGALFLDLEQDLSAPVRPDRRGGRHPLPTPEALAQT
    LGRAGIGNEHFVVAYDDPPVGGMYAPRLWWLLRWLGHGQVAVLDGGIGAWRAAGYEVSTAAVEYAPTTFKPHPQPEMVVD
    ANFVAHRPAGTVLIDSRAPERYRGEVEPIDPVAGHIPGAINRNWLDSLEASGRFKPAEEQRKRFEGLEGEIIVY
    CGSGVS
    ATANVLALELAGKQARLYAGSWSDWVSDPSRPVARGPE

    >gi|291294634|ref|YP_003506032.1| putative periplasmic substrate-binding protein [Meiothermus ruber DSM 1279]
    MRVASLVPAATEILRFLGVEPVGVSHCCAVADKPVLTESILPKGLSQAEIDQRVRQAAQAGQSLYRVRTEVLQSLKPDLI
    LTQGVCEV
    CAVGPSELRQAVDCLSFGVPTLSLQGTRLAHLWDDLRAVAAATGVSAEAGIEELQGRLERVRRAVAGRKRPR
    VAFVEWLEPPFLGGHWVPDLVEAAGGAPLGASPEAPSFRTTWEEIAALQPEVVLFSFCGYGLEAALRDLAGWANPLSGVE
    CWALDSAYFCALTPQVVQGVEILAGILHPGAWPAPAPAEAVRR

    >gi|291294694|ref|YP_003506092.1| Heavy metal transport/detoxification protein [Meiothermus ruber DSM 1279]
    MTQLKIEGMSCNNCVRHVTEALKKVPGVEHVEVSLQEGRATVTGTAPVDKLIEAVQEEGYTARVA

    >gi|291294696|ref|YP_003506094.1| heavy metal translocating P-type ATPase [Meiothermus ruber DSM 1279]
    MTCAACVNRVERGLGKLEGVALASVNLATERARVVYDPEKTTPQALLEKVREAGYTPEVAEVELGITGMTCAACVNRVEQ
    ALQQLDGVLEARVNLATERALVRYLPASTGVAQFKRAIRAAGYGVLELGRGQERADLEREARARELASLRRALLVAAVFA
    LPLFLIAMLPMLFPPVEAWLMGTFGHGVMSALNWVMLALATPIQFGPGLRFYRHGWRSLRSGSPDMNGLVMIGTSAAYFY
    SLGVVLFPGLFPPQARHAYFEAAGVVITLILLGKYLEAIAKGRTSEAMRRLLSLQAKTARIVQDGLEREIPVDEVLVGDL
    VQVRPGEKIPVDGVVVAGQSYVDESMITGEPLPVYKTEGAPVVGGTLNQNGTLTFRATAVGEGTVLAQIIRLVENAQASK
    PAIQNLADRVVAVFVPIVLAIAALTAGVWLVLGGENALTYALVNTVAVLIIACPCAMGLATPVSIMVGTGKAAELGVLFR
    RGEALQTLQEARVIALDKTGTLTQGRPELTDLEVLEGFDEAEVLRLVASVEQKSEHPLARAIVRAARSRGLELAEPEDFE
    AFPGFGVRGRVGLYRVEVGADRYMAQLGLEVHTLAALAQKLAEAGKSPLYAAINGKLAAILAVADPLKPGSAEAVAALHR
    LGLRVAMITGDHTRTAQAIARQLGLDEVLAEVLPHGKAEAVRTLQAKGHKVAFVGDGINDAPALAQADVGIAIGTGTDVA
    IETADVILISGDLRGVPNALALSRATLRNIQLNLFWAFAYNVLLIPVAAGALYPLTGWLLSPVLAGAAMGLSSLFVLSNA
    LRLRAFRPPFGPGEQTTMGKLVREMG

    >gi|291294732|ref|YP_003506130.1| glutaredoxin [Meiothermus ruber DSM 1279]
    MITMYTTSWCPDCHAAKQALTSLGLPFQEVNIEHDPTAAELVMKVNNGKRSVPTLVYKEHATSLSRFSISKLKAWMEQVG
    LQAGQP

    >gi|291295005|ref|YP_003506403.1| peptide methionine sulfoxide reductase [Meiothermus ruber DSM 1279]
    MQTLELATLGGGCFWCLEAVFDELKGVVDVVSGYSGGHVPNPTYEQVCSKQTGHAEVVQITFDPSGISYREVLEVFFTIH
    DPTTLNRQGNDIGPQYRSVIFYHSPEQQAVAREVMQALAQAGVWDNPIVTELVPFERFYPAEDYHQEYYRRNPYQPYCAL
    VVGPKVAKFRKQYFDRLKRTV

    >gi|291295228|ref|YP_003506626.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus ruber DSM 1279]
    MLRFWPILVLLLGGLFYWGMQRPNPNELKSVLVGKPAPSFSLPLLEPYQAQYGPEMGVRAGLGKPVLLNIWASWCIPCRT
    EAPLLERFHQQYRDQVLILGVNVQDSEAEALKFIQQYGLTFPSVYDGRGRIGIEYGYYGVPETFVIDRNGTVLARHAGEL
    SEAQLRGYIEQVLR

    >gi|291295275|ref|YP_003506673.1| thioredoxin [Meiothermus ruber DSM 1279]
    MAVSDNITTCIHCGAKNRLGNPPAGQVPVCGACKKPLPWLVNATQGLTPELQASVPVLVDFWAEWCGPCKMIAPVLEEIA
    REYAGRLKVVKLNVDHHPLAQSAYHVQGIPTLILFKNGQPVERIVGAAPKHMLLQKLQPHL

    >gi|291295305|ref|YP_003506703.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MQTIKPELLKSFLQENPVVVDVRPPEQYSPGDLEGALHIPLRDIQQGHHNLPKDRPLLLICERGVMSELAGLYLEAAGYQ
    QVYHLEGGLQKLRKVAEGL

    >gi|291295307|ref|YP_003506705.1| Thiosulfate sulfurtransferase [Meiothermus ruber DSM 1279]
    MSYANPDVLVSTDWVLENLNNPEVRILEVNEDILLYDTGHIPGSQKIDWQADLWDDTIREFIQPHELAALFERLGISNDT
    TIVLYGDKNNWWAAYAFWFFSYNGHQKLKLMNGGRIKWIQENKPLTTEVPTYPKGSYTPGQRDPNLRAFRDEVLAHLEKV
    KAGKGALVDVRSPAEFTGEKTHMPEYPQEGVLRGGHIPGAKNIPWATTVNADGTFKSAEELRAIYESKGITPDKEVIAY
    C
    RIAERSSHSWFVLKHLLGFPNVKNYDGSWTEWGNAVGVPIEKGAEK

    >gi|291295494|ref|YP_003506892.1| OsmC family protein [Meiothermus ruber DSM 1279]
    MPVRSAQAVWKGTLKEGQGHLKLESGVYEGPYTWASRFAEAGGTNPEELIGAAHAGCFAMFLSALLTNNNTPPEELHATA
    RVHLGEGPTITKIELHLEGKVPGLSPEKFQELAQEAKAK
    CPISKALAAVPEISLEAKLL

    >gi|291295544|ref|YP_003506942.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus ruber DSM 1279]
    MKLKPGDPAPLLQVQDALGRTVDLAELVQQGRYIVLWFYPKSNSPGCTAQGRQYAMLREEFQQLGAEVFGVSADPASEQC
    AFMDKLALEGGLIPDPSGRLGKAFGVGGLWGVGALLGLYSRDTILINPQGKVEQVWRNVNPFRDAQVVLDYLKQASGRGD
    PLEVKPGLQPTEDATGKL

    >gi|291295545|ref|YP_003506943.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus ruber DSM 1279]
    MRRFWWILLVLAPVLALSPGDPVDLPRVRDSYGKPIDLAATARAGKYLLFWFYPKASSPGCTAQGKRYAELYGEFEKLGV
    EIFGVSADPAADQCAFIEQMALKGAMLPDQDGRLARLFKVGGLFGFYNRDTILVNPQGRVERIWRNVNAFRDADVVLAYV
    RQLKR

    >gi|291295732|ref|YP_003507130.1| Peroxiredoxin [Meiothermus ruber DSM 1279]
    MLNVGDSAPNFTLPDQEGKLHTLEDYRGRWVVLYFYPKDDTPGCTKEACSFRDEKGRLEELGAVVLGVSADDVQSHGRFH
    GKYGLNFPLLSNPDKEVIRAYGAWGSKTLYGKAYEGVMRYTYLIDPAGRVARVWNKVKPDEHALEVAEALLELQQQKVGG
    NSVS

    >gi|291295832|ref|YP_003507230.1| hypothetical protein Mrub_1448 [Meiothermus ruber DSM 1279]
    MPNRLAKESSPYLLQHAHNPVDWYPWGEEAFAKARAENKPIFLSVGYATCHWCHVMERESFEDPEVAQFLNAHFVPIKVD
    REERPDVDQVYMSALQAMTGSGGWPMNMFLMPDLRPFFGGTYWPPEDRQGFPSFRRVLAGVHNAWLHQQKEVLENAEQLT
    TYLQDQLKPRGGALPDDLHSTALAGLSRIFDPAHGGFGGAPKFPQSPALGYLLTQAWLGHEAAWKHLQLTLDRMAEGGLY
    DQVGGGFHRYTVDHIWRVPHFEKMLYDNAQLARLYAAASRMPQASLEQARRYQRIAQETLDYVLRELTGPEGGFWSAQDA
    DSEGVEGKFYVWQAEEFRRVLGAEAEAAMLLFGVSEAGNWEHTNVLERRIPDAALMQHLGLGPEAFERWVQSVRHRLYAA
    RQQRTPPLTDDKVLADWNGLMLRALADVGRWLEEPRYIEAARKNAAFVMQEMYRDGLLRHSWRQGQLKPQAYLSDQAHYG
    LGLLALFEATGEVGWLEGARQLAEAILTHFKEPTGAFRDSLDQTLPVVALDAYDGPYPSGNAVAAELLFRLAALYERPDW
    HQAALTTVESNAQRLLHNAFGFPAMLQAHLVGTLGSELAVAAPAAMMDALRSWFLPLTTLIYGPPNTLPVLQSRQPGRAY
    LCQHGACRLPVDRLEQLRGELQAIYPSASIPG

    >gi|291295852|ref|YP_003507250.1| Redoxin domain-containing protein [Meiothermus ruber DSM 1279]
    MLLWMRRWIWFVLPLIGLVGWWLLQPKPTAAPEALPSATLQRLDGPAVQLSDFKGKPIVLNAWATWCGPCRREMPLLVEA
    ARAHPGIQFIFLNISDGPEAVKAFQRELKLQIPNVLLDPEATLSDPLRIQGLPVTLFYNAEGVLVNRHIGEIKAETLEAL
    LKAL

    >gi|291295916|ref|YP_003507314.1| dihydrolipoamide dehydrogenase [Meiothermus ruber DSM 1279]
    MPKHQLVVIGAGPGGYVAAIKAAQLGLDVACVEKEQALGGTCLRVGCIPSKALLDASEKIYAAQHNQIIGAKIGQVELDL
    AALMAHKDKVVKANTGGVEYLFKKNKVTRYLGHGTILTPNKVRVEGPEGVQELETERILIATGSKVAPLKGVQLDYEIVG
    TSDQAIAYPSVPERLVVIGGGVIGLELGSVWNRLGAKVTVLEYLPHILGGMDSEVARAAEKIFKKQGLDIRTGVRVTAAY
    ARDGKGVVEYEGGEPLVADRVLLATGRIPNTDGLGLENVGLRTDERGRIPVNAHYQTAVPNIFAIGDVIAGPMLAHKAEE
    EGYAAVEYMVTGYGHVDYNAIPNVVYTHPEIASVGKTEEELKSAGIPYKKGSFPFSANGRARAMNDTDGFAKILAHAETD
    RILGVHIIGPRAGDLIAEAAVAIAFHASSEDLARASHAHPTLAEVLKEAALATWDKPLHI

    >gi|291295950|ref|YP_003507348.1| DSBA oxidoreductase [Meiothermus ruber DSM 1279]
    MQRTLFAVVVVLAIAIAAVLFVVLRPKPTASTTDAAAGARFVIGNPEAKVTVVDFSNYLCSHCRDHANEVFPLIKRDYID
    TGKIRYVFRDFPFGGQENVIRAGEAAACAADHNLYVEYHEALFRAQMQWAGLSGEALDNYFTDLAGQIGIAPATFSQCLK
    SGSKRAGVLADQKLATDLGLTGTPSFIVNGETYTGQRPYDSWQEILDKALAGQSSSDQGGSSSPAKP

    >gi|291295957|ref|YP_003507355.1| hypothetical protein Mrub_1573 [Meiothermus ruber DSM 1279]
    MTTPRKTSRASGKKTASKAKPQVKPTAWVRVPEESEVPEDVRVLFGKFKEKTGFIPNVARNFALTPEHFLRWFRYYDFLM
    RNEDQSHLTRKEREMIAVVVSSANECEY
    CLASHSAYLREITGDPVLPDVLAANYRRAHLTPREHALLEFAYQITVDSASM
    SSADVQMLRAIGLSDEAIFEAAQVAAMFNFTNRIANAMGWVPNEIYYHLHRDKK

    >gi|291296110|ref|YP_003507508.1| UBA/THIF-type NAD/FAD binding protein [Meiothermus ruber DSM 1279]
    MWSKEELDRYARHIVLPGVGGAGQARLKQSAVLVVGAGGLGSPVLMYLAAAGVGRLGLVEMDRVDVSNLQRQVLFDTPSV
    GQRKAEIAKSRLESLNPHIQIEAHAERITSENALRLLHPYDLVIDCTDNFPTRYLLNDACVLLDKPLVYGAIHQFEGQLS
    VFHHQGGPCYRCLFPQPPRPGTVPS
    CAEAGVFGVLPGVIGSLMATEAIKVLLGLGEVLSGTLLLYDGLQARFHRVGFPRR
    PDCPVCGEQPSVSTLQDYELWCGISV

    >gi|291296113|ref|YP_003507511.1| Redoxin domain-containing protein [Meiothermus ruber DSM 1279]
    MARRGFRVRRYPLLGTVTLHTPDGQALLNLNSMEAAPKKLSPALQLGIVGLIAVGLVALALFAAPPQRAGDLPQAQLVRL
    DGSSAVLRSGKPIVLTVWATW
    CTYCQRQLPEFEEMARQRPDVQFAFVNDGEPVQLVRQFHDTRGFSSAVVYQDALRTVSR
    SLRVNGYPSNFFYDSRGRLVGEVRGYMSPEQLQAALAQLN

    >gi|291296269|ref|YP_003507667.1| FAD dependent oxidoreductase [Meiothermus ruber DSM 1279]
    MIKPEEVLSEYHPPLTDHEAMVEANRCLYCFDAPCTQACPTHIDIPKFIKKIATGNLVGSARTILEANLMGASCARVCPV
    EELCEGACVLGAEHRPIMIGRLQRYATDYVYERGIDVFKPGAPTGKKVAVIGAGPAGLTCAGELAKLGHSVTVFEKRALP
    NGLSTYGIIVLREPVEVALAEAEMIKRLGVEIKTQMELGRNLSWEEVRNTYDAVFLSVGLGSVPQLGIPGEELIVDGLSY
    IETSKMNPSALQVGREVVVIGAGNTAVDCATIAKRLGAERVTMVYRRSEKEMTAYPHEYEFAKKEGIEFRFLTQPVEVMS
    EGGRVTGLKCVRMRLGAPDASGRPAPEPVPGSEFVLPCDQVVKAIGQEKPAVAKLLGLETEKGFIKVNHEFETSLPGVYA
    GGDCIRAQGSASTVMAVQDGKLAAFAIHRRLAGSLEAAAD

    >gi|291296442|ref|YP_003507840.1| thioredoxin [Meiothermus ruber DSM 1279]
    MAKPIEVNDANFDATLKENKYVLVDFWAEWCGPCRMVAPVMEELAKEYEGKVTVAKLDVDANPQTAMKFRVMSIPTIILF
    KDGQPVEVMVGAAPKSNFVARLNKHVQVSA

    >gi|291296627|ref|YP_003508025.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus ruber DSM 1279]
    MAIQVGDRLPDVTVFNTAAEPISLTTLATGRPLVLLFFPAAHTRVCEKELCTVRDGLAEYNQLGAEVYGLSVDTPWTLAA
    YARSLGLAFPLLSDYNREATRAFGLEISLRGLPGFAQRAAYVVDASGQIAWAWVAEVPAQEPPYPEVAAAVKALVEARAS
    SRTGS

    >gi|291296629|ref|YP_003508027.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Meiothermus ruber DSM 1279]
    MLQYDQLPLGADLIDAELPDLSGQTVRLSAFSEPFLAVIFICNHCPYVKGSIREIVALADKYRGKVAFVGINANDYERYP
    EDSPEGMRAFAAAHNLNFPYLLDETQATAKAYKALRTPEVFVFDQGRKLRYHGRVNDAPKDPSGVQEHTLDMVLAALTQG
    QEPPITEADAIGCTIKWKPGYEPTVRIG

    >gi|291296653|ref|YP_003508051.1| iron-sulfur cluster assembly accessory protein [Meiothermus ruber DSM 1279]
    MVQEQTVLSITPLAAERAKEILHRYNKPDAAIRVFIKSGGCSGYQYGMAVDERELEGDTVVEMHGVRLVVDRMSLPLLVG
    SEVDWVENLMGGGFSVNNPNATSSCGCGHSFRTDGAKAPVGEGSSGCCGG

    >gi|291296696|ref|YP_003508094.1| dihydrolipoamide dehydrogenase [Meiothermus ruber DSM 1279]
    MSTIYDVIVIGTGPGGYHAAIRAAQLGKKVLAVEAEHVGGVCLNVGCIPTKALLHAAEELEGTKHASAFGLEVKEARLDL
    KKLGGWRDGIVKKLTGGVSQLLKGNKVDLKTGFARFVDKNTIEVGGERIQGKTFIVATGSEPNTLPGFEVDQKDIVDSTG
    ALRVEDKFPKRMLCIGGGAIGLEFAQVYKRMGAEVTVIEFMGQILPAADPETAGLLAKILGKQGIHIKTHTKGVKVERKK
    DGLHVTLEHTQTGQQETLVVDKILVATGRRPRGKGLGLEAIGVVVDERGYIPTNEKMETNVPGIYAIGDVTRPPLLAHKA
    MKEGLIAAENAAGGNAVMDYQIPNVVYTSPEWAAVGLTEEEATKAGYKVKVGKFPLSASGRAMTLEATDGLIKLIGDAET
    DLLLGGHIVGPNASDMIAEIALALEMGATVTDVGLTVHAHPTLSEGIMEAAEHLHRQAIHIANR

    >gi|291296877|ref|YP_003508275.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MKVGYKKLLEQALAEIETISAEEAKGYLGHPDYVFVDLRDIRELQREGKIPGAFHAPRGMLEFWIDPESPYHKPIFASGK
    KFVFY
    CAGGWRSALAAQTAQRMGLEPVCHIEGGFKAWAEAGGPVERLEGPKNQV

    >gi|291296997|ref|YP_003508395.1| electron transport protein SCO1/SenC [Meiothermus ruber DSM 1279]
    MPRRAIWITLLAGLPLLLAAAAFLVSRDTYQPYGTRLLNARPPEANQFTLTAHDGSRKSLSDFQGKVVLIFFGFVNCPDV
    CPTTLLELSKVYKALTPAEQARVQVLLISVDPERDTLEKLRNYVTFFSPSFIGLTGTPEQIAEVAKRYGVFYQKSQIKSA
    TEYNVDHTATVFALDPKGQLRLIYGNGKAAETERVVQDVRWLLR

    >gi|291297218|ref|YP_003508616.1| beta-lactamase domain-containing protein [Meiothermus ruber DSM 1279]
    MLFKHIYEEGLAQGSYFIGCQSQGTAIVVDPRRDIQVYLDEAQKNGMKIVAVAETHIHADYLSGARELAKATGARLYLSD
    EGDENWKYRGLEGFDYQLVRDGDQIRLGNITLTVVHTPGHTPEHISFLVQDGAAASEPGFFLTGDFVFVGDIGRPDLLEE
    AAGLLGTAEPGARRMFRSLKEKFLTLPDYVQVWPGHGAGSACGKGLGAVASTTVGYERRFAWWADYLRTGDEEGFVKALL
    SGQPEAPYYFAQMKRLNRDGMPILGDLSIPHQLTPEQFQQKLSEGALLVDTRDKLAFAGGHLKGAINIPAGKNFSTWAGW
    LLPYDRDLVLLASPERVGELVKQLIRIGLDRVVGYIPGLEGYAQGELETVPQVTAAQAKALWEKGEATILDVRGADEYLA
    GHIPGAQNIHAGRVMNNLNRIPKDKPVVVH
    CLGGDRSSTAISALMGAGFSNLVNLTGGIRAWQQEGFPIEKGPSREMVNA


    >gi|291297219|ref|YP_003508617.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MNLSVQAAYHMLERFQVVDVREPEEWADGLLPGALRLPLSRLQALAPLYLERERPVLLYCRSGNRSQEALKTLKNLGHPK
    VWHLEGGLKAWCEAGIPCTSPV

    >gi|291297220|ref|YP_003508618.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MLTVPYKDISPQEARKLQEEKALFIDVREPEEFAQVRIEGAQLIPLSEFGGRFSEIPKNQPVVLYCRSGNRSAQAAAWLS
    AKGYSNLLNLDGGLMAWYQAGLPLDTTPLEVTYQDTAFTELTPHEAQQWIREGAYVVDVREPYEYAMGHVPGAVNIPLGR
    FVSEVGKLPKDRKLVVV
    CASGGRSSQASEYLVGHGFAKENVGNLEGGTYGWMSAGFEVER

    >gi|291297221|ref|YP_003508619.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MIGWLKNLLGGGAAVGRLSPVEAHEKAKAGAIILDVRTPLERQEGRIPGSQALPLDRLALEWEKLPRDKEIICQCRSGAR
    SAQAARFLAAKGYKAYNLVGGIEAWKRHKLPVK

    >gi|291297222|ref|YP_003508620.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MQDVFPNELSLWQKRGAVLLDVRSPEEFASGHIPGSRNLPLEQLLEALDTLKSPVVTICATGSRAGLAAEVLGYEGLEVG
    KLVGGIQGYAAQGYPLERTATQVAEVPFKPEEAPCS

    >gi|291297224|ref|YP_003508622.1| Redoxin domain-containing protein [Meiothermus ruber DSM 1279]
    MKRWLAVLTLFAVGLAVSPGQSAPDFRLRDLSGKVYTLGSFKGKPMVITFWASWCPICRAEFPRLHQLAQEYQVPFVVIS
    REPRDTEQVVRDYMKNYPRFLPLLAQPGGDNPVAVANRYKVLGHPWTFVLDGEGKVVNLYAGRVDVESLKDDLALAGYPE


    >gi|291297225|ref|YP_003508623.1| hypothetical protein Mrub_2856 [Meiothermus ruber DSM 1279]
    MRYILFTAIGIFMAVHAQGVDFNRWYPYTQASQYAQSHGRILMVYFWGEACPYCDQMNTHVLSDPRVSSILEHRFVVASV
    DSHSPEGRALSAQMRAFGTPSFVFFVPQGGTLKEAGRLFGSRTRAQFLSELQQICTKVGGEGCG

    >gi|291297233|ref|YP_003508631.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MRKGWILLVLLGGLGLAQEMSPASLQEMGNFIKKTNPASYLLYAAEAKDFVEVFEPFILDVRTAEERSRGFLPGSVHIHI
    SQLPDRLGELPKDKDKPILVY
    CGTGHVSAVAAAYLRALGYREVKNLNGGFRAWLELGLPVQRP

    >gi|291297248|ref|YP_003508646.1| thioredoxin reductase [Meiothermus ruber DSM 1279]
    MSQLYDVVIIGGGPAGLTAGIYTGRANLKTLILEKGLPGGQIAQTEEVENYPGFPEPISGAELSERMVQQAKRFGAEIVM
    DEAQAVEKTPEGFVVRGYEQDYRARSVILATGANPKKLGVPGEEKFYGRGVST
    CATCDGFFYRGKEVVVVGGGDAAVEEG
    LFLTKFASKVTLVHRRDTLRANKTAQARALAHPKMQFIWDTVVEEVLGEETVTGVRLRNLKSGEVYDHPTDGVFVFIGHE
    PNTGFLQGVVELRPDGYVAVRDEIFTSVPGLFAAGDVADPIYRQLSTSVGAGTRAAMMAERYLAEQEHAAVH

    >gi|291297252|ref|YP_003508650.1| Redoxin domain-containing protein [Meiothermus ruber DSM 1279]
    MKLTPDALLLGPLALSWPNLALLVGILAFTWLAARQGQEGKAWWVLLATLLAARMGYAVAHLSTWPSLGAALLGIVDIRS
    GGWNWWVGLPVGALAAIWLLRQESPRLLVPGGAALALALLPLGVQFSLTRPVQTPTPPEYASRVLQYLEPAQTRPLEVRF
    AELPKPMLLNFWATW
    CPPCRAEMPLLVEYQQKGYPIVLLNTGEDVGAIQGFLAQTGLSARVFLDSAGLQQAFQVSGLPTT
    LLIGADGKVRARHLGPVNRAQLEQLLRQLE

    >gi|291297312|ref|YP_003508710.1| DSBA oxidoreductase [Meiothermus ruber DSM 1279]
    MQTVVIYLDYLCPFAWRGLELAYVAAPQLGLDLTLRHYSLEQGNHPENAGRPRHTPAWKLAEQPLESSPSLRAFLASHAA
    RQQGKAAHLRFALELFRLHHQDKRPLDEDQTLVEAVGRAGLDLERFMADLEDEESRRLELATDLEVAGELGVFGTPTFVL
    PSGDAAYLRFTQLTTEPELAVNLWELFTAVLENGAHIETIKRPRW

    >gi|291297371|ref|YP_003508769.1| Rhodanese domain-containing protein [Meiothermus ruber DSM 1279]
    MILSADPPAHALLIDSRSPAEYAQGHLEGAINLDLSGFRGRLRSEEELAQLEQALADLNGRIGAGPHRPVVVYDLGFNTR
    LTKTAFMLALGGLEVYLWPQGWEPRATQQTPAQPVAGEPWARLNREILLTADEILAGLPYPLLDVREPQEFATARIPGAK
    NIPLGAFGPDNAGALGLLAGQAVGVH
    CRSGARSASAFWLLRQQGVQARNYLGSMLEWEAEADLPVERS