Marinobacter aquaeolei VT8 uid59419

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|120536898|ref|YP_956956.1| hypothetical protein Maqu_4190 [Marinobacter aquaeolei VT8]
    MKFVNPLPEPIMLNIVSPSSSLFRTIRATALTLTIGMGVGGAPVMASESQDPKVAIRAVQSTLPSVAILGQKAGPAGSTE
    VFIQVPGVLNMQSVYVLGDGKTVISGVVVPPIENGYPGAQLSLPDGNATVNPRAPRSGAQQLNEVLGITPPTPAAMSGGD
    KANDFSVPPVPAQHSAPVPGSGADVRTVGDEIASSPVSAPVVAPTVARSEGAPSQASNVDNLSSNGGILIESLADVAQTG
    AFSKVVGHALDNNSDILAVKELAGKSGQTEAYLDLVKSLPAIVQGDSDRKVYVMFDPN
    CPVCHRYYSESKALVDVGELEI
    HWIPSIVFADTRSSLTASAALLAEAQRSDGDPLAMLHQVMTTNTYAQRIDSAPNVDRLVPYLDAVAKNTAVMVMARAETP
    LLVFEDTSGALKISAGIPRNGYHELIQREG

    >gi|120537142|ref|YP_957199.1| putative mercuric reductase [Marinobacter aquaeolei VT8]
    MKNDNKLHIAVIGSGGAAMAAALKATERGARVTLIERGTVGGTCVNVGCVPSKIMIRAAHIAHLRKESPFDAGISAEAPQ
    VDRAKLLQQQQARVEELRDTKYEKILREHKDITVLNGEARFVDTNSLVVTLAEGGEKPVHFDRAFIGTGARPAEPPITGL
    ADTPYLTSTSALALDTVPKRLIVIGAGFVSLELAQAFDRLGSKVTVLARSRVLSSEDPTIGEAIEAAFKREGIEVLRQTT
    PSNVDYSDNEFIVETPAGTLRADQLLVATGRTPNTEALNLASIGVETSRGAIQVDEHLQTTVTGIYAAGDCTNQPQFVYV
    AAAAGSRAAVNMTGGEAKLDLSAMPGVMFTDPQVATVGLTEAEAVARGYSVDTRLLDLENVPRALVNFDTHGFIKMVAER
    STGRLLGVQVVAAEGGEIIQTAVMALRAGLTVQEIGDDLFPYLTMVEGLKLCAQTFTKDVKQLSCCAG

    >gi|120537144|ref|YP_957201.1| mercuric transport protein periplasmic component [Marinobacter aquaeolei VT8]
    MRKQFVLAMFLTLLSMSSWAASQTVTLSVPDMTCAACPITVKLALSKVEGVSQVSVSYPDREAVVTFNDALTSIEALTEA
    TSDAGYPSTPTASEATPEGQ

    >gi|120537145|ref|YP_957202.1| putative mercuric transport protein [Marinobacter aquaeolei VT8]
    MSKFKSKSGGASLAVGGMAGLLASACCLGPLVLITLGVSGAWIGNLTALEPYRPLFIGAATVAMFFAWRRIYRPVEQCSP
    GETCAIPQVRKTYKVIFWVVTALVLVALVFPYILPLFY

    >gi|120537182|ref|YP_957239.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
    MPKLPHIALIATLGAMSTALAYQYSEIQSLKGQPRQSQAISEHKVVALVDQRLEVLERRRAKDGFEKKVFEFELAQQSTP
    DHRLIYGNPEARITLQEFGDIE
    CPFCRKMHDDLKQVVDNAENTVNWEFKHFPLESHNPAAALQAKVIECVKDSYGNKVAW
    AALDRFIFETAGNGKGVGDLTNFVRGMGLSGVAIDLCMASDAHENRIESDYREGQALGITGTPALRIIDTQTGDAYLIKG
    YKTAEQIAQAVQHILRG

    >gi|120553087|ref|YP_957438.1| ADP-ribosylation/crystallin J1 [Marinobacter aquaeolei VT8]
    MANDAIRAMNSDMVAALAGGWVADAASLGLHWLYDSDRIHDVGGEYPEFLPPKADYFEGGFGYFAHGGKKVGDISHYGAA
    TGVLTDSLLANQGHLNIRDYQRRFRAFFGPGGTWQGYIDNPTRVTLHNLNSIEQSAIERAQASTAASLTDQQKRLLVQKV
    LPYTSRLSGDQLAGPVRKAINLTYHETDIQEAGVHLAQTIDQHLLPESGANDMQLPAVSKLPPLVACYLGSDDLLTTTEA
    AVRVTNHNDEAVAWAKCAARLLESLYLGKSMSESLDAATAEAPEPCSLNKARADEQLDPVGAAESFGRT
    CYLKEAMPVIF
    HILNHATSYAEAVRANIQCGGDSCGRAWIIGPAMAAIHGVGGEYGIPLSWLARVKGAAAIYRDVELLVGMRAESNQ

    >gi|120553088|ref|YP_957439.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Marinobacter aquaeolei VT8]
    MVYTPQTGMDMNRSKLLLLLIIAALVGIFLGFDGHKLLTLENLQSHQGAIEQWIDQNLVLAVTGYALIYVAVTALSLPGA
    TIMTLAGGAFFGNLYGLAAVSIASTIGASLAFLVARFLMRDTLRKRYGETVVKMDRGIEKDGAFYLATLRLVPVFPFFLI
    NLAMGLTAMKLRTYALVSWIAMLPGTFVYVNAGTQLGQIQSTGDIVSADLLLSFALLGLFPLIAKFVVGFIRRRKVYAGW
    QKPERFDYNLLVIGGGSGGLVSAYIAAAVKAKVALIEKHKMGGD
    CLNTGCVPSKALIRSARAADTLRHANRYGLESVPVK
    GSFNNIMNRVREVIAKVEPHDSPERYRKLGVDCIAGEASFVSPWELEVRHNDGRTERLTARSIVVATGGKPAVPPIPGLE
    DMEPLTSDNLWQLEELPERLLVLGGGPIGSELAHAFARLGSQVTQVEMGERLLAKEDADVSELVLKQFRADGVDVRLKHS
    AAEFRIEEGEKVAYCKHEGERVRIPFDQVLVAVGRAANTAGLNLERIGVETLPNGTVPVEEDMSLRYPNVFACGDVAGPY
    QFTHAAAHQAWYAAVNGLFGQFRRFKVDYRVMPWVTFTSPEVARVGLSETEAKEKRVAYEVTRYGLDDLDRAIAESEDHG
    FIKVLTPPGKDKILGAVVVGTHAGEILAEFTLAMKHGLGLNKILGTIHPYPTWNESAKYAAGEWKRSHAPEGILKLLEKL
    HGWRRGKKTTTPRSHYAPDQNPTGPR

    >gi|120553181|ref|YP_957532.1| putative mercuric transport protein [Marinobacter aquaeolei VT8]
    MSEPKSGRGSLIAGGVAAVLASACCLGPLVLIALGVSGAWIGNLAALEPYRPWFIGAALVAMVFAWRRIYRPAQDCQPGD
    VCAVPQVRTTYKVVFWIVALLILTALAFPYVLPLFY

    >gi|120553182|ref|YP_957533.1| mercuric transport protein periplasmic component [Marinobacter aquaeolei VT8]
    MKKSLIATALFLFVSLPALAAPQTVTLSVPGMTCSACPITVKAALNRVEGVTSVDVRYEERDATVTFDDEKTTVEALTQA
    TTNAGYPSTLKQSQAKQE

    >gi|120553184|ref|YP_957535.1| putative mercuric reductase [Marinobacter aquaeolei VT8]
    MSDNNLHIAVIGSGGSAMAAALKATERGARVTLIERGTIGGTCVNIGCVPSKIMIRSAHIAHLRRESPFDDGLSAQAPVV
    DRSALLAQQQARVEELRESKYQSILNDNAAITVLKGEARFVDERTLTVTLNDGGEQTVHFDRAFIGTGARPAEPPVPGLS
    ETPYLTSTSALELDHIPERLVVIGASVVAIELAQAFARLGSRVTILARSRVLSQEDPAVGEAVEAAFRREGIEVLKQTQA
    SEITHNGRVFTLQTNAGTLEAEQLLVASGRTPNTENLNLEAVGVATERGAIRIDNHLQTTASGIYAAGDCTDQPQFVYVA
    AAGGSRAAINMTGGDASLDLSAMPEVIFTDPQVATVGLSEAEAQAQGYDTDSRTLTLDNVPRALVNFDTGGFIKMVAERG
    SGRLLGVQSVAGEAGELIQTAVMALRARMTVNDIADELFPYLTMVEGLKLCAQTFTKDVKQLSCCAG

    >gi|120553196|ref|YP_957547.1| peroxidase [Marinobacter aquaeolei VT8]
    MSLRLGDTAPDFEQDSTEGRIRFHEWLGNGWGVLFSHPADFTPVCTTELGLTAKLKDEFAKRNVKAIALSVDPVDSHHDW
    IKDINETQGCTVNFPIIADHDRQVSEKYDMIHPNANDSLTVRSLFIIDPNKKVRLIITYPASTGRNFNEVLRVIDSLQLT
    DEHRVATPGNWESGSDVVIVPSLQDEDEIKKRFPKGYKAVKSYLRMTPDPRANWSGD

    >gi|120553274|ref|YP_957625.1| rhodanese domain-containing protein [Marinobacter aquaeolei VT8]
    MKTAHDLVAEAKKEVQEVPLANAEAAIKNADLLLDVRDADEYRSSHIPGAVNISRGMLEFKFTNDPALENRQMKIVLYCK
    TSGRAALSAKALKEMGYMNVQSIEGGFDAWLEAGKEVAQPDLPKFE

    >gi|120553300|ref|YP_957651.1| glutathione peroxidase [Marinobacter aquaeolei VT8]
    MMRWTVLKCVSVLLLLGLTVPAVARDCPDFLDHEQRKLHSRDSVNLCEVAAGKPMLVVNTASRCGYTGQFEGLEALHQRY
    KDRGLMVVGFASDDFRQEADSEEEAAKVCFVNFGVSFTMIAPSAVTGEQANPVFQEINRQSQPPRWNFTKYVIDGDGKVT
    ARFPSQVRPEDARLIQALESVL

    >gi|120553316|ref|YP_957667.1| hypothetical protein Maqu_0375 [Marinobacter aquaeolei VT8]
    MTNAIKTFALALLFAAPLTATAENQKAKDGNRGNTVEEVLVILSSDSLQTQGMAMVLSNTMAQKGAKVNVLLCDEAGDLA
    LKAYKAEPLAPKNVTPGQMLRGLMKAGGAVNV
    CALYLPNSEYSKDDLLDGVGVATPPAMAGQMLDRKMRTFTF

    >gi|120553322|ref|YP_957673.1| peroxidase [Marinobacter aquaeolei VT8]
    MTIRLGQIAPDFNVDTTKGPMSFHEWAGDSWVFFFSHPADFTPVCTTEMGRTAQLAQEFAARNVKPLGLSTDSVEEHLKW
    IDDVNDTQSCDLQFPIVADEDHKIAELYEMIHPGESETAAVRSVFIIDPDKKVRLTMTYPMAVGRNFDEILRAIDALQTA
    DANSCALPADWKKGGEVIIPPSISNEKAKDMFPQGWNELRPYLRLTRI

    >gi|120553405|ref|YP_957756.1| disulphide bond formation protein DsbB [Marinobacter aquaeolei VT8]
    MTSRWIFGLVFLVCAGLLAVAFYMEHVMGLEPCPLCWLQRFGFMGAGLVSLLAFLHGPRGFGNRVYGLLLIVAAGAGLAV
    AGRQLWLQSLPADQVPA
    CGPSVDYMLEVLPWFEVLQTALKGTGDCAEVVWRFLGLSIPGWTAVFFSLLIVLGLFVMLRRY
    SPRDWLQS

    >gi|120553412|ref|YP_957763.1| thioredoxin [Marinobacter aquaeolei VT8]
    MSGNIVNVTDASFEQDVLKSDVPVLVDYWAEWCGPCKMIAPVLEEIADEYDGKLKVCKLNIDENEQTPPKFNIRGIPTLM
    LFKNGNVDATKVGALSKSQLAAFLDSNL

    >gi|120553628|ref|YP_957979.1| iron-sulfur cluster assembly accessory protein [Marinobacter aquaeolei VT8]
    MATPLFFTDNAVAKVRELIEEEENPDLKLRVFVTGGGCSGFQYGFSFDESQEEDDTVIERDGVKLLVDSMSYQYLVGATI
    DYQEGLQGSQFVVQNPNASSTCGCGSSFSI

    >gi|120553846|ref|YP_958197.1| arsenate reductase [Marinobacter aquaeolei VT8]
    MTEATRIFHNPRCSKSRQTLELLQQKGIEPEIIRYLETPPTEQELLHILDLLGCEPRELMRTKEAEYREQGLDNPDLSRE
    ALVRAMVMTPKLIERPIVLANGKAAIGRPPENVLDIL

    >gi|120553847|ref|YP_958198.1| redoxin domain-containing protein [Marinobacter aquaeolei VT8]
    MQYPQSGLFCSGARWLAWPVLMLMLLLVSGCEKIELERADGTLANWDKYRGQWVLVNYWAEWCKPCLEEIPELNELDKAP
    DIAVLGVNFDGVKGVPLVELGERMGIEFTMLASDPGPGFGWQMPMALPATFVVDPEGTLIEARFGPQTEEDIRALIGE

    >gi|120553865|ref|YP_958216.1| electron transport complex RsxE subunit [Marinobacter aquaeolei VT8]
    MSTKTSSEIIKDGLWHNNPALVQVLGLCPLLAVTSTVVNAIGLGLATLLVLMGSNLSVSLIRNFVSESVRLPAFVMIIAS
    FVTCAELLMQAFTYELYQILGIFIPLIVTN
    CAILGRADAFASKNPPLPAILDGAMMGIGFLAVLMTLGAMRELIGQGTLF
    ADMHLLLGPMAADWVIRPLEQYPDMLFMVLPPGAFVGLGLLIALKNGIDNHLKERRKAAEPAPASTGSKRVRVTGTIS

    >gi|120553870|ref|YP_958221.1| electron transport complex, RnfABCDGE type, A subunit [Marinobacter aquaeolei VT8]
    MTEYLLILVSTILVNNFVLVQFLGLCPFMGVSGKLETAMGMSLATTFVLTLSSVCSYLAYTYLLAPLDLAFLKTITFILV
    IAVVVQFTEMVVRKTSPLLYRVLGIFLPLITTN
    CAVLGVALLNLNKNNNFVESVLYGFGAAAGFSLVLVLFAAMRERIAV
    SDVPVAFRGAAIGMITAGLMSLAFLGFTGLVAV

    >gi|120553938|ref|YP_958289.1| methionine-R-sulfoxide reductase [Marinobacter aquaeolei VT8]
    MKRKVIGLFSALALVSAAGLFAAQVAAERVDSAGNAYAPDDPDLAVATFAGGCFWCVEAGYEKIPGVVEAVSGYAGGEEK
    SPTYKQVSSGRTGHTEAVQVYYDPDKITYEGLLAGLWRMMNPTDLEGQFVDRGRQYRPTIFYHNEEQKRFAEAAKQALEA
    SGVYDKPVVIPIEPLKRFYPAEEYHQDYYKKNPVRYKFYTFNSGRYQFIEEVYGEDYELDFSRYQPNNGVNDSMPAEADP
    TEAAASGGFNPERFQKPDDKTLRQRLTEMQYEVTQEDGTEPAFNNTYWDNTRAGLYVDVVSGEPLFSSRDKYKSGTGWPS
    FTRPITPEAVVEREDKSFFMTRTEIRSAHADSHLGHVFDDGPAPTGLRY
    CMNSAAMKFIPLEQMEAAGYGKWIDAVE

    >gi|120554083|ref|YP_958434.1| dihydrolipoamide dehydrogenase [Marinobacter aquaeolei VT8]
    MSDKFDVIVIGAGPGGYVAAIKAAQLGLKTACVESWTGKDGKSQVLGGTCLNVGCIPSKALLEVTHKFEEASHDYDSMGI
    LAKDVKIDVAKMMERKAGIVKQLTGGIAGLFKANGVTSIHGHGKLLAGRKVEVTDKDGKTKTYEADNVIIATGSRPIEIP
    PAPFDGEYIVDSEGALEFTEVPKRLGVIGAGVIGLELGSVWARLGSEVTVIEAQDSFLPAVDQQCAKDALKQFQKQGLNI
    VMGARMTGAEVKRKLVNVSYEDSKGKQDAKFDKLIVAVGRRPYTDGALAEDSGVTMDERGFIFVDDNCKTEAPGVWAIGD
    VVRGPMLAHKASEEGVMVAERIAGHKPQVNYDCIPNVIYTFPEVAWVGKTEEQLKAEGEEYNVGTFPFAANGRAMAANAA
    SGMVKIIADAKTDRILGFHVVGPQASEIVAQGVIAMEFGSSAEDLALTCFAHPTLSESVHEAALAVAGGAIHVANRRKKK


    >gi|120554283|ref|YP_958634.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Marinobacter aquaeolei VT8]
    MSESHDFDLIVIGAGSGGVRLARMSAQRGARVAVVESRYLGGTCVNVGCVPKKLFVYGAHVREELEDANGYGWSVPTDDV
    SFDWPTLVANKNAEIERLNGIYGRLLENAGVTIIEGTASLRDPHTVIVGDRAFSAAHITVATGSWPVVPDVPGKEFLLTS
    NEMFYLPQLPRHAVVWGGGYIAVEFAGILAGLGVETTLLYRGELFLRGFDEDIRKFTEQEMRKKGVDLRFNVTIESVEQL
    NAHYQVNLSDGSSMETGLVMAATGRRALVDGLGLTDLGVELNASGHVEVNDHFQTAVPSISALGDVIGTPQLTPVALAQA
    MVLSRRLFGDGQGDMDYSAIPTAVFCQPNIGTVGLTEKEARDAGHSLRIYRSEFRPMKYTLSGRDERCLMKLIVDDSSDK
    VLGAHMVGPDAGEIIQGLAVAIKAGATKAQFDATMGIHPTSAEEFVTMREPVA

    >gi|120554315|ref|YP_958666.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Marinobacter aquaeolei VT8]
    MNSDKNLHIAVIGSGGAAMAAALKAAERGARITLIERGIIGGTCVNTGCVPSKIMSRAAHIAHLRTESPFDGGVSAQIPK
    VDRANLLQQQQTRVEELRDAKYEGILRDQTAITVLNGEARFVDANNLVVQLNEGGEQNVHFDRAFIGTGARPAEPSIPGL
    VQAESANDAQAVKALATDSSGALLVLRDSGLLVLDDKTAADIPLPPSDSGAQPRSMAKGADERLYLAGPGLGIWRYEYAS
    ERWHSLNDTLPDLGITAIAAHATQPETLYAYLGEGGMFRSRDGGGEWVKVDGGPREPVQAFLHSDMPGSMESGWLFAGTT
    RGVARSMDCFCFWGDAGELRGAVTAIDYDPSAPENVYAVIEGQLHHSSDGGETWVGLEIPQAITALTFSPKEGLVVGTEN
    GDLLSRNASGEWVPVHE

    >gi|120554316|ref|YP_958667.1| mercuric transport protein periplasmic component [Marinobacter aquaeolei VT8]
    MKMRFAMTLLFALLSMPSWAAMQTVTLSVPGMTCSACPITIKLALNKVDGVSQVDVSYPDREAVITFDDTRTSVEALTQA
    TGDVGYPSTLKSLETDSK

    >gi|120554317|ref|YP_958668.1| putative mercuric transport protein [Marinobacter aquaeolei VT8]
    MPNSKSGRVPLAAGGIAGLLASACCLGPLVLVALGVSGAWMGNLTALEPYRPIFIGVALVAMFFAWRRIFRPVEQCQPGE
    VCAVPRVRTTYKVIFWAVTALILVALLFPYALPLFY

    >gi|120554320|ref|YP_958671.1| Fis family transcriptional regulator [Marinobacter aquaeolei VT8]
    MSFYLEYPVRGMTVLCHKLSMALFLSLFAALASASPPMDPGIKALQERIGFTVTERFSTPAEGVTGYVVKTGDGKTGILY
    GLGDLTFSGALLESDGNDLTSEYSARYIPKPTYASVAEQLSRDPHLVSEGGKDAPEVYIFADPN
    CIFCHKFWQQTRDWVA
    EGKVRLHWVMVGFLKPSSLGLSAAIMNAEDRAAALQVFEENFGKSGDGRGISELTPIPADLQQALEQHGQWMAEAGFSGT
    PGLLFKDTSGQWRGQTGVPSQEALGRMLGVTE

    >gi|120554321|ref|YP_958672.1| cytochrome c biogenesis protein, transmembrane region [Marinobacter aquaeolei VT8]
    MDQLPSLLIAGQIMMAVMAGLLLNLTPCVLPAIPIKVRTILREAGGQRSHRVLAALAFTAGTLTFFLTLGGLTALLQWNW
    GTLFQSTLFVAVLVALMVGFAVITWLDLPIPVPTFAASAHGRRYFEAYVSGLLSAILAAPCAGPFLGGVLAFAVTQPTPV
    IMGIFGSIGLGLSLPYAVLMLRPEWLSRLPKAGPWTLAIREVLALILLAAAVFFSASLVPKAVYPWLWWAWLALVLVWGL
    RRFVQGSGAVRVITATATGLALAVTVVFASPLGSGEDELVWQPYSAELLADTKARGTPYLLEFTADW
    CINCKVLERTVYK
    EPAVAEAVARAGMVPIQVDVTASDPEKDALLTATGGQALPFAAIFDADGTVVARFTGLFDTDSLVEAINRTENSQP

    >gi|120554324|ref|YP_958675.1| redoxin domain-containing protein [Marinobacter aquaeolei VT8]
    MSHQRISAARGIAVVLFALAISIAAQVMAAGKVPKSVGPQGFLIWESPRTLPELAFEDEDGRPLTLADFKGKAILLNIWA
    TW
    CAPCREEMPTLDSLQAQLGGEQFEVVALSVDHVGISVVEKFYRETSIQHLRQYIDPSTLATSTLGIEGVPTTLLLDHD
    GREIGRLVGAAEWDSPAMVDLMTRTIEGVPD

    >gi|120554333|ref|YP_958684.1| peroxidase [Marinobacter aquaeolei VT8]
    MTLQLGETAPDFTVASTEGNIQFHEWLGDDWAVLFSHPADYTPVCTTELGAFAKRKDEFASRGVKLIGVSVDPLDSHNDW
    VKDIEKTQGAGLNFPLLADKDQVVADLYGMIHPKADPKVTVRTVFIIDSAKKIRLMLTYPPSTGRNLDEILRVIDSLQLT
    DNHKVATPVDWKNGEDVIIVPSLSNEEAKERFPDGWDEQTPYLRVTRQPGRK

    >gi|120554335|ref|YP_958686.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Marinobacter aquaeolei VT8]
    MMRRLLLLLPFVVFLGLAFFLYRGLSLDPSARESALIGQAFPAFTLPTLEDPDTEVDESLLRGQISLVNVWASWCPTCKE
    EMPQLLALSERGIQMVGINYKDARDLGRQFLEEFGKPFEVNIFDPAGDLGFEIGVYGVPETFLVDADGIVRYKHVGYITP
    AQVDEVMMEVEKWR

    >gi|120554439|ref|YP_958790.1| DsrE family protein [Marinobacter aquaeolei VT8]
    MPQSLSYTLVITGAPWATQAPQTALSLAQALLRAGHRIDRVFLYGDGVHLASALSAPPSDEQHWPRLWSEFLSGNNITAV
    A
    CIASALRRGIVDETEQARYELTASNLRAPFEIAGLGEWVEGNLKSDRVLYFHGAH

    >gi|120554612|ref|YP_958963.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Marinobacter aquaeolei VT8]
    MSSVALNQPVPEFQAEATGDQTVRLSDLKGRNIVIYFYPKDNTPGCTTEGQDFRDRMEAFAAEDTEIFGVSRDGLKAHDN
    FRAKYDFPFHLISDKDESLCKLFDVIKLKKLYGKEHLGIERSTFLIDKEGVLRREWRGVKVKGHADEVLEAVKAL

    >gi|120554673|ref|YP_959024.1| thioredoxin reductase [Marinobacter aquaeolei VT8]
    MSETRHSRLIILGSGPAGYTAAVYAARANLNPTLITGIEVGGQLTTTTDVDNWPGDNDGVQGPELMQRMQKHAERFETSI
    VYDTINEADLNNRPFRLKGDNGEYTCDALIIATGASAMYLGLESEEKFKGQGVSA
    CATCDGFFYRKQKVAVIGGGNTAVE
    EALYLSNIADEVTLVHRGDKLRAEKILQDKLFEKAENGNVNIIWDHTLDEVLGDGTGVTGMRIKSTKDGSTQDLELAGVF
    IAIGHKPNTSLFEGQLDMTNGYIRIRSGLEGMATQTSIPGVFAAGDVADHVYRQAVTSAGFGCMAALDAEKFLDQQG

    >gi|120554689|ref|YP_959040.1| glutathione peroxidase [Marinobacter aquaeolei VT8]
    MASETIYSFSAKDIKGHEVSMDDYRGKVLLIVNTASKCGFTPQFEGLQSLHDELGERGFEVLGFPCNQFMNQDPGNDDAI
    SQFCSLNYGVSFPMFAKIEVNGDGTHPLFRFLKREAKGLMGSEKVKWNFTKFLVNREGQVVRRYAPTAKPADIRADIEKL
    L

    >gi|120554696|ref|YP_959047.1| protein-disulfide reductase [Marinobacter aquaeolei VT8]
    MTVSMSAVQAFSAPTRNQFYHLLLVLAVVLSLASPGAKALGSGNGSLFGNSEFLPVDEALPFDYTTDNGAVVLAWNITPG
    HYLYKSRIQINAVTDGVQVGEPGFSLPGTLTEDEFFGEITVFFDPVQARVPITLPDGVREAELQVTYQGCAEAGLCYPPQ
    TRDILYYPGGDAAETAANRVTSDTGNAAPADTSTATGLAGFLSSQSIWMIAGVFFLLGLGLTFTPCVLPMVPIISSMVSG
    RNTRTTSHALLLSGSYVLGMALTYAAAGVITGLLGASFNLQAQLQSPWVLSVFAGLFVVFALSMFDLFEIQLPRFIREPL
    NDASHRLTGSRVASIFGIGALSALIVSPCVSAPLAGSLLYISTTQDAVIGGVALLALGLGMGVPLILVAVGGRKLLPSSG
    HWMTTVKHFYGVMLLAVAIWLVERLVPVWLSLTMWGLLIAITGVQLGAFDAAKAGWQRTRKGLGLVMFAYGLALLAGAVS
    GANDPLKPLAPFVASAAPGPVAGELSHASFQRIEDPNQIRTLLANASNRGQPVMLDFYADW
    CISCKVMERNVFSDPQVIQ
    ALSPYTLLQIDMTDNTPAQQALLDELGLFGPPAILFYQASGSELSNARVLGEMDRDQFLEHVANVGQKL

    >gi|120554708|ref|YP_959059.1| heavy metal translocating P-type ATPase [Marinobacter aquaeolei VT8]
    MTTLNCFHCGEPADGEPPITLELQGQQRHFCCQGCKAVCQTIHQEGLTGFYEFRTEPAVTPRELTRSELDRIRELDHPLV
    QQAFVAPVKAGQEAQLLIGGIT
    CAACIWLLENHMKQQPGVQSFTVNHTTQRARLVWASDKARLSDLLIAIHELGYTARPY
    QADEAEQALKAEHRSMLIRLAVAGIGSFQSMMLAFPLYFELVSDLSTDFVDFFRWFSLLVATPVVFYSARPFFTNARRDL
    LSRHLTMDVPVAIAIGLAYGASAWITLIGGEEVYFESVCMFTFFLLLGRYIEVQARYRAGLSGNALAGFQPSVAARVLNG
    EAEIIAIHQVQPGDVIRVRPGETLPVDGEIVSGESTLNEAALTGEYLPETRKPGDTVHAGSVNGENPLDIRVTHAGAQTR
    LSGILRVLDRVQSEKPPVARMADRIAGKFVGRVLILAPVVWAGWWLAGADNAFDITLSVLVVTCPCALSLATPTAITSAT
    VRLRKLGFLPTRGHTLESMNTIDTVVFDKTGTLTRGELSLTDQSVFGSLDQDTCIRIAAGLEKHSEHPIARVFHEQPSLT
    VSQVSNHLGGGLSGLYHGRAVYIGHKAFVAEHTSAIAPEGEDAQGMEIWLATDKEWLARFRLDDKIREDASQALQALRKS
    GIETLLLSGDRSGHVQQVAHALGIDRAIGEASPEQKLEVLEQLRADGHRVMMVGDGLNDLPSMAGAGISVAMGTAADLTQ
    LKADAVLLNGQLNSLVAAIETSKQTRKIIRQNMIWAFGYNVCALPLAAAGLVPPWLAAIGMSLSSLIVVLNALRLSRSNK
    GTPPPEATLGAPEAA

    >gi|120554736|ref|YP_959087.1| redoxin domain-containing protein [Marinobacter aquaeolei VT8]
    MRASIATLALAGVLACASPLAAAEAINVPAPDFTLESRSGENLRLQDHRGEVVMLNFWASWCGPCRQEMPLMDELYSQYK
    DLGFTILAVNVDENRDEAHRFLDKVPVNYPILYDPESSVSELYEVQAMPTTVMIDRNGNARYLHYGYQPGYEDEYEQQIR
    ELVRE

    >gi|120554813|ref|YP_959164.1| selenide, water dikinase [Marinobacter aquaeolei VT8]
    MRILTITELLNRKKEDALSIKLTQFSHGAGCGCKIAPDVLDRILHTDAPEFHDPRLLVGNSSRDDAAVADVGNGLGIIST
    TDFFMPVVDDPFDFGRIAATNAISDVYAMGGKPVMAIAILGWPVNELEPEIAAKVIDGGRAVCAEAGIALAGGHSIDSPE
    PIFGLAVTGQVAVDRIIRNDTAQAGDLLYLTKPLGVGILTSASKKGKVTPEDLAVAVENMATLNKVGEVFAEVDGVNAMT
    DVTGFGLAGHLLEICRGSGLKATVSRKAVPVLPNLKPYIDADCIPGGTHRNAAAFGKAISGMTDADKLLFCDPQTSGGLM
    VSVAEKSREAYEALARKHGLDLQPLGRLEAAGSGESLVFIED

    >gi|120554840|ref|YP_959191.1| soluble pyridine nucleotide transhydrogenase [Marinobacter aquaeolei VT8]
    MAEHHYDVVVIGAGPSGEGAAMNAAKHNRRVAIIEDKPTVGGNCTHWGTIPSKALRHSVKQIITFNTNQMFRDIGEPRWF
    SFPRVLQNAQKVIGKQVKLRTQFYSRNRVDLINGRAAFVDKHRLEIRGNKSVETIHFKQAIIATGSRPYLPPDVDFRHHR
    IYNSDSILNLSHTPRTLIIYGAGVIGSEYASIFAGLGVKVDLINPGSRLLSFLDDEISDALSYHLRNNGVLVRHNEQYES
    VKGDDHGVVLSLQSGKKIRADAFLWCNGRSGNTENLGLENVGLTPNSRGQLAVDEHYRTEVEHIYAAGDVIGWPSLASAA
    YDQGRAASSDITQDEYFRFVDDVPTGIYTIPEISSVGKTERELTEAKVPYDVGQAFFKDLARAQITGEAVGMLKILFHRE
    TREILGIHCFGDQAAEIVHIGQAIMNQEGEANSLNYFINTTFNYPTMAEAYRVAALNGLNRIF

    >gi|120554844|ref|YP_959195.1| Na(+)-translocating NADH-quinone reductase subunit E [Marinobacter aquaeolei VT8]
    MEHYLSLLLKAIFVENMALAFFLGMCTFLAISKKIEAATGLGIAVVVVLTVTVPVNNLLYNTILREGALDWAGLPNVDLS
    FLGLLTYIGVIAAIVQIMEMVLDKYIPALYAALGVFLPLITVN
    CAILGASLFMVERDYTFGESLVYGFGAGVGWALAIIA
    LAGIREKLKYSDVPNGLRGLGITFITVGLMSLGFMSFSGISL

    >gi|120554845|ref|YP_959196.1| Na(+)-translocating NADH-quinone reductase subunit D [Marinobacter aquaeolei VT8]
    MAGSTAKQVLFEPIFSNNPIALQILGICSALAVTTSMSVSIVMCLAVIAVTAFSNLAVSLVRTQIPGSIRIIVQMTIIAS
    LVIVVDQILKAYAYEISKQLSVFVGLIITN
    CIVMGRAEGFAMTNPPLMSFLDGIGNGLGYSVILLFVAFFRELLGAGSLF
    GVSLMPVVNEGGWYVPNGLLLLPPSAFFIIGLAIWGLRTWKPEQVEEPDYKLSRHTVKEAF

    >gi|120554871|ref|YP_959222.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Marinobacter aquaeolei VT8]
    MKRVLLFLPLLIAVGVGVFLFAGLGKDPTKLESVLVGKPVPEFSLEALDNPDVQLDPSVFQGEVSLLNVWAEWCPSCWDE
    HEYLTYLAREQGVRIVGLNYKDQRENAFRFLNRLGNPYETIIFDPKGTLGFDLGVYGAPETFVIDADGVVRYRHVGVVNQ
    KVWDEVLLPVIAQARGNS

    >gi|120555089|ref|YP_959440.1| hypothetical protein Maqu_2174 [Marinobacter aquaeolei VT8]
    MEIKVNYLDNLRLEAKFDDFTVISDQPVRYKGDGSAPGPFDYFLASSAMCAAYFVKVYCNARDIPTDNIRLSQNNIVDPE
    NRYKQIFKIQVELPEDISDKDRQGILRSIDRCTVKKVVQTGPEFQIEVVENLDEDAQALLTAAPGGDGNTYIEGKDLPLE
    QTIANMTGILSDLGMKIEIASWRNIVPHVWSLHVRDTAAHMCFTNGKGATKEAALCSALGEFIERLNCNFFYNDQYFGQD
    IANSEFVHYPNEKWFQPGPEGELPDGILDDYCQEIFNPDGELLGTHLFDTNSGTPERGICSIPYVRQSDGETVYFPSNLI
    ENLYLSNGMSAGNTLQEAQVQCLSEIFERAVKKEIIENEIALPDVPESVLAKYPEIVEGIKALEEQGFPVLVKDASLGGQ
    FPVMCVTLMNPKTGGVFASFGAHPSFHVALERSLTELLQGRSFEGLNDLPAPTFNSMAVTEPNNYVEHFIDSSGVVSWRF
    FSAKSDYDFVEWDFSGSNEEEADTLFGILADMGKECYMAVFEDLGAPVCRILVPGYSEVYPVEDLVWDNTNMALEFREDI
    LNLHRLSEDELANLVQRLEEAELDVYMTIVTLTGIEFDENTVWGQLTILELKLLIYLALGELEEAQELVEMFLQFNDNTV
    ERGLFYQAMNAALEATLNEELELDDYLYNFRRMFGDEVMDAVVGSINGTVRFFGLEETGMDLRGLDRHLKMIESYKKLHA
    ARARKAGL

    >gi|120555094|ref|YP_959445.1| putative selenoprotein [Marinobacter aquaeolei VT8]
    MATRITLHYCTGCNWMLRSAWMAQELLTTFDGMVDELTLKPGSGGIFEVWVNDTRIWSRKEQGGFPDIKQLKQLVRNQIA
    PEHSLGHSDKPV

    >gi|120555189|ref|YP_959540.1| protein-disulfide isomerase [Marinobacter aquaeolei VT8]
    MNIKSVAVSIGLALTLVGAPASQAGEAEDRIAQRLTEAVPGLKVNSVRESEAKGLYEVQSNNGDTIYTTEDGTYLLTGDL
    LKITENGIANVTEESRAGSRKDLMADYGGKGVISYPAKGKEKAVVNVFTDID
    CPYCRKLHDEVPQLNEYGITVNYYAFPR
    SGPGTASFNKYISVWCADDQQAAMDAAKAGRSVEQRSCENPVAEQYRLGGQVGVTGTPAILLEDGNMVRGYVPARNLAEG
    LGIL

    >gi|120555228|ref|YP_959579.1| glutaredoxin-like protein [Marinobacter aquaeolei VT8]
    MYNKRKGRLAAKLTPNQRNEFMDINETIKSQLEENPVILYMKGTPQAPQCGFSARTVQALMACGERFAFVNILDNQELRE
    ALKVYSSWPTYPQLYINGELVGGCDIVLEMSESGELAKMVKDAAGQAEA

    >gi|120555270|ref|YP_959621.1| UBA/THIF-type NAD/FAD binding protein [Marinobacter aquaeolei VT8]
    MLSDEELLRYSRQILMPRFDIAGQEKLKAAHVLVIGAGGLGCPVALYLGAAGIGHLTLVDDDQIELANLQRQIAFEQSWL
    GNSKAERLAERVRAINPEITVNAVNRRVDGDDLRQLVSESTLVLDCTDNFNTRFALNRASVSSKVPLVSGAAIRGEGQLS
    VYDPRHPESPCYHCLYPEQGNEDLT
    CSEAGVIAPLVGMIGSAQAMEAVKVISGLGKPLVGRLLILDAWQMEWREMKLAKD
    PGCPVCAG

    >gi|120555315|ref|YP_959666.1| glutaredoxin 1 [Marinobacter aquaeolei VT8]
    MEQVTIYGRSSCGFCVRARDLCESRNIPYVWVDMIEKGMSKQDIADRIGHPVYTVPQILVGSEYVGGFDDFSAYVRRHEA
    QTAS

    >gi|120555463|ref|YP_959814.1| arsenate reductase and related [Marinobacter aquaeolei VT8]
    MKLYGIRNCDTVKKARKWLDEHGVDYEFHDFKKDGLSSEKLSQWEQAVGWETLLNKRGTTWRKLPDEVRDTISAQSAHQI
    MLDNPSIIKRPVVERGDGVSVGFNADDWSAWLG

    >gi|120555480|ref|YP_959831.1| hypothetical protein Maqu_2569 [Marinobacter aquaeolei VT8]
    MSKNSFQVEHRYLELPDSFYSRVQPSPLSEPRMVCFNQALASDMGFLVRDENDWAAIGAGAELLEGMDPVAMKYTGHQFG
    MYNPELGDGRGLLLWETVGPDGTRWDWHLKGAGTTPYSRFGDGRAVLRSTIREYLCSEAMHGLGIPTTRALFMISAKDPV
    RRESIETAAALMRVAKSHIRFGHFEFAAHHEGPEALKTLLEHVIALHFPHLISLPEEQRYARWFEEVVERTARLIAKWQA
    VGFCHGVMNSDNMSIIGDTFDYGPFAFLDDFDAGFVCNHSDHEGRYAYNRQPQVGFINCQYLANALLPIMDEDTVRRGLR
    RYETAYNEHFKHQMLAKLGLEEADGSDMGLIMDTFSMLHEHRVDYTRFFRGLSNLHDHGTAPVRDLFADRSVADEWLERY
    EARLQKETRGHDEREYAMRRVNPKYILRNYLAQQVILEAQNGDYEPMKELLKVLEKPFDEQPEYEKYAALPPDWGKHLNI
    S
    CSS

    >gi|120555487|ref|YP_959838.1| hypothetical protein Maqu_2576 [Marinobacter aquaeolei VT8]
    MSKNSFQVEHRYLELPDSFYSRVQPSPLSEPRMVCFNQALASDMGFLVRDENDWAAIGAGAELLEGMDPVAMKYTGHQFG
    MYNPELGDGRGLLLWETVGPDGTRWDWHLKGAGTTPYSRFGDGRAVLRSTIREYLCSEAMHGLGIPTTRALFMISAKDPV
    RRESIETAAALMRVAKSHIRFGHFEFAAHHEGPEALKTLLEHVIALHFPHLISLPEEQRYARWFEEVVERTARLIAKWQA
    VGFCHGVMNSDNMSIIGDTFDYGPFAFLDDFDAGFVCNHSDHEGRYAYNRQPQVGFINCQYLANALLPIMDEDTVRRGLR
    RYETAYNEHFKHQMLAKLGLEEADGSDMGLIMDTFSMLHEHRVDYTRFFRGLSNLHDHGTAPVRDLFADRSVADEWLERY
    EARLQKETRGHDEREYAMRRVNPKYILRNYLAQQVILEAQNGDYEPMKELLKVLEKPFDEQPEYEKYAALPPDWGKHLNI
    S
    CSS

    >gi|120555494|ref|YP_959845.1| hypothetical protein Maqu_2583 [Marinobacter aquaeolei VT8]
    MSKNSFQVEHRYLELPDSFYSRVQPSPLSEPRMVCFNQALASDMGFLVRDENDWAAIGAGAELLEGMDPVAMKYTGHQFG
    MYNPELGDGRGLLLWETVGPDGTRWDWHLKGAGTTPYSRFGDGRAVLRSTIREYLCSEAMHGLGIPTTRALFMISAKDPV
    RRESIETAAALMRVAKSHIRFGHFEFAAHHEGPEALKTLLEHVIALHFPHLISLPEEQRYARWFEEVVERTARLIAKWQA
    VGFCHGVMNSDNMSIIGDTFDYGPFAFLDDFDAGFVCNHSDHEGRYAYNRQPQVGFINCQYLANALLPIMDEDTVRRGLR
    RYETAYNEHFKHQMLAKLGLEEADGSDMGLIMDTFSMLHEHRVDYTRFFRGLSNLHDHGTAPVRDLFADRSVADEWLERY
    EARLQKETRGHDEREYAMRRVNPKYILRNYLAQQVILEAQNGDYEPMKELLKVLEKPFDEQPEYEKYAALPPDWGKHLNI
    S
    CSS

    >gi|120555866|ref|YP_960217.1| methylated-DNA--protein-cysteine methyltransferase [Marinobacter aquaeolei VT8]
    MSRSPEQDSDWMTGVGDSAAGESARVARLVRVAQHIEMHADEALTLSSLAKVAALSPSRLQKQFKAAFGVSPKAYQDAVR
    MRRFKQSLKDGSKVTDAIFASGFGSVSRVYGEANRSIGMPPRAYRAGGAGEVIVYAGRTTALGLMMMAATERGVCFVEFG
    DDEASLVGRLRSEFPKAELTASPARNAPELDAWMEALDQHISAGAPRPDLPLDMRGTAFQVKVWQFLLSIREGDVLSYSE
    VAARIDKPRAVRAVASACGKNRIGVLIP
    CHRVLRGDGGLGGYRWGLERKRALLEAERRSVTRE

    >gi|120555887|ref|YP_960238.1| thioredoxin [Marinobacter aquaeolei VT8]
    MTDIRHLVCPHCHKVNRVPADKLSSGGNCGACKQPLWPDQVLELTEQNFATHTGRSDLPVLVDFWASWCGPCKMMAPQFE
    QAAKAWRGKVRFAKLNTEQAPGPAGQFAIRSIPTLILFQNGREVARQSGAMNQAQISQWLQSQGIR

    >gi|120555922|ref|YP_960273.1| rhodanese domain-containing protein [Marinobacter aquaeolei VT8]
    MSNEIVVCALYKFAVLNDYKDLRQPLLNLMLEKGVHGTLLLAREGINGTIAGSREGIDAVKAWIGKDDRFNGIDYKESFV
    DIQPFKRTKVKLKKEIVTMGVDGIDPKRIVGTYVEPQQWNDLISDPDVVLVDTRNQYEVEIGTFKNAVNPATDTFREFPE
    YVKQNLDPQKHKKVAMF
    CTGGIRCEKSTAYLKEQGFEEVYHLKGGILKYLEEVPQEQSLWQGECFVFDDRVTVNHNLERG
    EYDQCHACRRPITEADKQRPEYEQGVSCHQCIDSLTEEQKARFKERERQMRLARERGEEHVGGEAARIIAERKARKKAER
    EAQARRSLEGEKQRKSAVN

    >gi|120555923|ref|YP_960274.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
    MGEAKRRKQTGAPSPRNTQGRKSLIIVLSLVIGVAVIAGLYFVTKPPAPSSEALPVAAPNADEFPAIVDQYGVSVGNEDA
    PVVVREFADYQ
    CPACARFAEASQRLKKEYVESGKVRFVYFDLPLRQHQNAMPAALAARCAGDQDQYWAMHDKLYGSQLDW
    SGSNDPTATFTRYANDLGLEERRFRRCMETELHREAVEQSLQVAVQLRVASTPTVMVDNIQLTRPGWGQLSAVVERELAK
    AE

    >gi|120556065|ref|YP_960416.1| iron-sulfur cluster assembly accessory protein [Marinobacter aquaeolei VT8]
    MTAEVFTPSDVNVTMTPTAVKHVRKQLDKKPEAKGIRLAIKKSGCSGFKYETQWVETPESDDRIFTIDGVDVFVKQEHLP
    LVNGIEIDFVTEGVNSLFRFRNPNATAECGCGESFTVA

    >gi|120556184|ref|YP_960535.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
    MQTRTLVISLLLFCLVVFAGAFVIYDRSQGTNEPAVVEKTPLVRDYSPVIGPEDAPVTIVEFFDPSCEGCRAMHPYVKQI
    QAAYPDNVRLVLRYVLFHKGSEEAVRILETAREQGIYEPVLDAVMEAQPKWHDDPKVTAAWDAAASAGLDVEAARAGMNS
    PEIDGIIQQDAADVKAVGISGTPTFYVNGDILSRLGPQELYDLVTSKVESLE

    >gi|120556238|ref|YP_960589.1| thioredoxin [Marinobacter aquaeolei VT8]
    MSNSPHIFDATADNFQQKVMEASATTPILVDVWAEWCAPCKQLMPILQKLAEEYQGNFQLAKVNADEQQELTASLGVRSL
    PTIILVKNGQAVDGFNGALPESEIRKILEKHIEAPAEDPYEKAHALWEAGDVDGALAILSELNQKDPENLDVLIDLAQLK
    AEQGDLDTAEQVLNSLPPEEKMQHKAKQLAARVKFLKQSGELPAQAELEAKLEANPKDPEALHQLSLHMVLQDKNAEAMD
    LLIRLMQADSTYKDGVAKTTLVELFEKLGNNNPDVRTYRRKLYTLMH

    >gi|120556308|ref|YP_960659.1| methionine sulfoxide reductase B [Marinobacter aquaeolei VT8]
    MSVSAAGYDLTPLTRAEVEARAEHLSEEERRVLLDHGTERPFCGTLLDNKKPGTYHCRLCDLPLFSSDSKFDSGTGWPSF
    FQPFDPEHIRYLEDSSLGMTRIEIRCPRCDSHLGHVFPDGPPPTGQRY
    CLNSIAMVFSESN

    >gi|120556309|ref|YP_960660.1| peptide methionine sulfoxide reductase [Marinobacter aquaeolei VT8]
    MTDACNLPGLSVPRSRFPDPEQDLPEAAGESRLVLAGGCFWCVEAVFLAVDGVQRVTSGYAGGEASTANYEAVCTGKTGH
    AEVIEVHYDPARVSFGQLLKLFFSVAHDPTQLNRQGNDVGSQYRSAIFYETPEQHDVAEAYIRQLDAAGVYQDRIVTTLE
    PLEAFYPAEEHHQNFAARNPWQPYIMAVAAPKMEKLVNTWPEQLKPEFSKDDPDQA

    >gi|120556314|ref|YP_960665.1| uncharacterized peroxidase-related enzyme [Marinobacter aquaeolei VT8]
    MPAQNELPISRFPVPELDALPEDIRSRILKVQEKSGFIPNVFLALAHRPAEFRAFFDYHDALMEKDSNLTKGEREMIVVA
    TSNLNQCQY
    CVVAHGAILRIREKNPLVADQVAVNYRKADITERQKAMLDFAVKVSQSAYEVNDSDFQTLHEHGFTDEDAW
    DIAGIAAFFGLSNRMANVTSMRANPEFYSLGR

    >gi|120556394|ref|YP_960745.1| dihydrolipoamide dehydrogenase [Marinobacter aquaeolei VT8]
    MDKREVDVAVIGAGTAGMVAYQRARRATDRIVLIEGDQYGTTCARVGCMPSKLLIAAAERAHQVRQADAFGVLPGDVRID
    GPAVMARVREERDRFVAPVVRSMESLPQEHRLMGHARFVDIHRLVVGDHTEVTAGRIVIATGSRPNIPGILKEAKDRLVV
    NDDVFDWRDLPSSVAVFGPGVIGVELGQALSRLGVKVRMFGVSGGIGGIQDEKVREYALDTFREEFAISPKADTRRVERI
    EEGVRISWSEGGKEHQQTFDYLLAATGRRPNIDHLDIQNAGIELDERGMPEFDPFTLRCGDSHIFIAGDVNNDRPLLHEA
    ADEGRIAGDNAGAWPEVRIGLRKTPMAVVFTEPQIASVGLNIHQVDERCQGCFAVGEVSFEDQGRSKVIGKNRGLLRVYG
    EHGSGLFMGAQMFGPAAEHIAHLLAWCVQKRMTVSEMLDMPFYHPVIEEGVRTALKDLSKKLQIGPAPGEGGMDCGPGV

    >gi|120556456|ref|YP_960807.1| OsmC family protein [Marinobacter aquaeolei VT8]
    MKATVDWTGNASFKATSGSGHSVQLDGPPDHGGENLGPRPMELLLMGVGGCSSFDVMSILKKSRQDVTACHCELDAERAD
    EVPAVFTRIHLHFVVSGNNLKEKQVERAVSLSADKYCSASIMLGKAGVEITHSFEIQAAS

    >gi|120556473|ref|YP_960824.1| DSBA oxidoreductase [Marinobacter aquaeolei VT8]
    MIRTLTSSAVLALSLLSAASLVNAQPWVAGEHYRVLDNPVRTASDNGVEVAEVFWYGCPHCYNFKPLAEAWEAEAPDYIN
    YVKLPAALGRSWEPHAYAFYALEAMGELDKVHDALFDALAGERRPLNTPEALADFVAGYGVNAEKFLENYNSFGVRARVQ
    QAQAKIRGARITGTPTMLVDGKYVVSASMAGSHENTLKVVEYLAEKERSGSE

    >gi|120556554|ref|YP_960905.1| thiamine biosynthesis protein ThiI [Marinobacter aquaeolei VT8]
    MKLLIRPAPEVAIKSKPVRQQQMRQLRQNIRKLLARLDPEIRVDGSWDRVDVDVPDGRSLAGPVIDELVRIPGISTIQEI
    GVFPFVDLDDVGEKAVQAYAERLKGKTFAVRARRHGDHDFRSIDLERSVGAALLQGSDAKGVDLKSPDLEVRIEVKDDSY
    HIAHRRHEGLGGYPLGTVETVMTLISGGYDSSVAAYLMMRRGIRSHYLFFNLGGAAHEVGVRQVAHYLWERYGSSHNVKF
    ISVPFEGVVAEIMRSVNHRHWGVVLKRMMLKAAAEIARDYNASGLVMGDAVAQVSSQTLTNLNVVDRASDEVVLRPLIAM
    DKQEIIRIAKDIGTEPFARNMPEYCGVISSKPVTRARLHRVEEDEANMDPAALADAIANRTDTMVSQLLDSTQTPEEVEL
    IQTPSVDDVIIDVRHPSEEERSPLTLTNNDVLKIPFYELNQQVAELPGNRQYLLY
    CDRGTMSRMHAGHLKAEGHGNIKVY
    APAV

    >gi|120556694|ref|YP_961045.1| copper-translocating P-type ATPase [Marinobacter aquaeolei VT8]
    MSEASVLKTALSISGASCQGCAKKIRHALEPLTGSTERVEVNLEDQTVALPENVDTAEAARIVTEAGYPAEPLVPNDSPG
    SCCASKKDNSAADKAPNSDTPAASTDVEPSDAGDGQIALAVSGAT
    CASCVNTIEKALMSVHGVTHAHMNLADSTATANGD
    ADPQALVQAVESAGYGARVIEDADAADDRKQEEDKKQYKVLLVKMAISLGLGLGLMIWGMGFGSMMVTEANQLTWINLGI
    LTLGVMIATGSHFFTGAWKAFRHHNANMDTLIALGTGTAWLYSMVVASVPEALPEMARHVYFEASAMIIGLINLGQALEL
    RAKGKTSEAVRRLLDLRAKTARVIRDGQEQDIPVEEVEKGDRIRVRPGEKLPVDGVITEGTTRIDESMLTGEPMPVSKGE
    GDEVSAGTLNTHGSIIYEATRVGSETALAQIIRLVKKAQGSKPAIGRLADKISSVFVPTVMLIAVVSALVWYNVGPEPAV
    VHMMVAATTVLIIACPCALGLATPMSVMVGVGKAAEYGALIRQGDALQTAGKIDLVILDKTGTITEGHPAVTRVHATNGD
    ETRLLALAAGLEQHSEHPLAEAILDRARENDIEPEPVSGFEALNGKGVQGKLDSEPVRLGNRRWLETEGLSVEALDDAAQ
    TITQEAGTPLFLAVGQQVLGVIGVADAIKPDSEAAIRRLHDAGIKVMMVTGDVDATAKAIAAKAGIDDYRAEVLPEDKAE
    VVSEMRGKGYTVAMVGDGINDAPALAAADVGFAIGTGTDVAIESASITLMRGSLHGVPDAIEISRATVKNIHQNLFGAFI
    YNSLGIPVAAGLLYPVWGILMSPILAGAAMSLSSVTVVSNANRLRLFKTSQPQVSAEERN

    >gi|120556703|ref|YP_961054.1| redoxin domain-containing protein [Marinobacter aquaeolei VT8]
    MSNVTLDGNPIELSGKFPQPGDNVPPFTLTSSGLEEVKLDNWAGKRKILNIIPSIDTGVCAASTRKFNEKAGSLDNTVVL
    VISADLPFAASRFCGAEGLKNVETLSTFRNYSFQQDYGVAIQNGPLAGLCARAVVVLDENNKVIHSELVNEIKNEPDYDA
    ALSVL

    >gi|120556731|ref|YP_961082.1| redoxin domain-containing protein [Marinobacter aquaeolei VT8]
    MLSVGVGPLSLSIGHLLLVLAFVVALIVGALIGRKEKTPVAGTLSDIFLVAMVSARIGFVVRYFSEYQGDWLGMIDIRDG
    GFDLMTGLIAALAFTGYLMWKRAAIRRALGSAVTAGLIIWGGMSGIIALINQQTQGLPEVALTDLNERPVDLASLAGDKP
    TVVNLWATW
    CPPCIREMPVLEDAQQRYPNVNFVFANQGEHPETIRKFLMAQNLNLSHVLSDRQNRFGRVVGSHGLPTTLF
    YNAQGHLVDTHMGELSRASLARSLERFDPAYLRPATGSD

    >gi|120556742|ref|YP_961093.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Marinobacter aquaeolei VT8]
    MLDANIKGQLKAYMEKLQQPIELVAAYDDSKKSEELKQLLEEIEPMSEKISLRTEESTEVRRPSFAINRVGTDIGVRFAG
    IPMGHEFTSLVLALLQVGGHPSKASQEVIQQVQELEGEFEFETYFSLS
    CQNCPDVVQALNLMSVLNPNIKHTSIDGALFQ
    DEVEQREVMAVPSVYLNGQPWGQGRMTLEEIAARLDTNSAEKEARKINQKDAFDVLVIGGGPAGSAAAIYAARKGISTGI
    AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQHVNEYEVDIMNMQRAEKLIPAEQTGGLHEVRLANGGSLKARTLIL
    STGARWRQMGVPGEEEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVGHVTLIEFGEQMRADEVLQKKL
    RSLNNVKIITSGQTTEVVGTDGKVSGLNYTDRTTGESHHVELEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNDRNETSI
    PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSAE

    >gi|120556743|ref|YP_961094.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Marinobacter aquaeolei VT8]
    MGIVNSEIKPFNATAFKQGEFVEISEADVKGKWAIFFFYPADFTFVCPTELGDVADKYEELQKLGVEVFSVSTDTHFTHK
    AWHDTSETIGKINYYMVGDQTGTITNNFGVMREGQGLADRATFLIDPDGIIQAVEITAEGIGRDADDLLRKVKAAQYVRN
    HPGEVCPAKWKEGEETLAPSLDLVGKI

    >gi|120554323|ref|YP_958674.1| electron transport protein SCO1/SenC [Marinobacter aquaeolei VT8]
    MYSELLIAMVAQVSTNAMAHSMEDVEASLNEKERYAQFVDQPAPEFDLTGVDGNTLALADLNGKTVVLNFLYTRCTEACP
    LHMNLIRQLQTGVEEEGLSEEVVFITIATDREDVAGTRRNMRAYGENFDLNPRNWQFLYRARMEPPELTPELAKAYGVQF
    RDTGEGVQVHGVVTHVIDPEGQMRARFHGLKFKPEHLVTYLTAIAKGPNAAADDGFWGRLHGRIEELLQSE