Anoxybacillus flavithermus WK1 uid59135

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|212638133|ref|YP_002314653.1| Zn-dependent hydrolase and Rhodanese-related sulfurtransferase [Anoxybacillus flavithermus WK1]
    MEGMYMLFRSFFDEQLAHMSYLVGCQRTGEAIVIDPGRNVDWYIDTAKKEGLQIVAATETHIHADFVSGAKELAKCCGAK
    LYLSDEGDANWKYQYLDEVDYELVKEGSIFTVGNVEFKVLHTPGHTPEHISFILTDKGGGSTEPMGIFTGDFVFVGDIGR
    PDLLEKAAGVAGTADVGARQMFQSLKKFKALPDYLQVWPAHGAGSACGKALGAVPVSTVGYEKLNNWALKIEDEEEFVKL
    LLTGQPEPPKYFAMMKKVNKIGPAYLNDEEVQVLQTIEQLNEYKANGAFILDVRPSQEFAKAHYAGAINIPFNKSFTNWA
    GWLINYDQDIVLIANQEDVQTIRKALAYIGLDRVVAYIEPSVALSGEVESYEEIDVHQLQQYLKDDRYHLVDVRNQAEWD
    EGYIAGAQHIMLGTLVDRLHELPEGKTYIVQ
    CRSGARSAIGASILQAKGLKQVLNLKGGYLAWTREKLPIVKQS

    >gi|212638152|ref|YP_002314672.1| multifunctional NAD(FAD)-dependent oxidoreductase/hodanese domain-/SirA-like redox domain/Peroxiredoxin domain-conta
    MQSCDTIHNTRRLITMSKKIVIVGGVAGGATTAARLRRLDEQAEIVMFERGEYISFANCGLPYYIGGAIKERDALLVQTV
    EGMAEKFHLDIRIQSEVIAINRERKTVTVKHLPTGKTYEESYDYLVLSPGASPIKPNIPGMEEANDLFTLRNIPDTDRIK
    AYVDEKKPKKAVVIGGGFIGVEMAENLWERGIDVTLVEMAKQIMAPVDYEMAAILHQHIRDKGVRLILEDGVAAFEQQGK
    MVRLQSGTTIETDMIVLAIGVKPENELAKQAGLAIGERGGIQVNEYLQTSDPSIYAIGDAIEVMDYINGKPTHIPLAWPA
    NRQGRIVADHINGRNVHYKGTLGTAIAKVFDMTVAATGNNEKTLQRLGIQYEVIHIHPNSHASYYPGAFPIALKLLFDRK
    TGRIFGAQAVGYDGVDKRIDVLATAIKGGMTVFDLPDLELAYAPPYSSAKDPVNMAGYVATNIIEEMVETIQWHEVNELV
    KNGACLVDVREEIERDMGFIPGSINIPLGQLRQRLHELPKDETIYVY
    CQVGLRGYLAARILTQHGFRVKNLDGGYKTYAV
    VYSEQQEQRKEEQTEKQVERVDVMNVQATTTLDACGLQCPGPIMKVYQTMEQLKDGDVLEVKATDPGFARDIQSWCKKTG
    NTLLKTTFENKTFTAYIQKGTKTTASPEKETKKDGATLVVFSGDLDKAIASFIIASGAAAMGKKVTMFFTFWGLNILRKK
    DAPPVQKDMLEKMFGMMMPKGVHDLPLSKMNMAGMGPKMIQYVMEKKHVDDLETLMKNAMAAGVKLVACSMSMDIMGIKK
    EELIDGIEIGGVATYLGDAEEAGLNLFI

    >gi|212638183|ref|YP_002314703.1| hypothetical protein Aflv_0334 [Anoxybacillus flavithermus WK1]
    MNANWNFDNSYARLPERFFTRIYPTPVSDPKLVVLNHSLAKELGLNAEVLASEEGVAVFAGNRVPEGAEPLAQAYAGHQF
    GYFNMLGDGRAILLGEHVTPSGERVDIQLKGSGRTPYSRGGDGRAALGPMLREYIISEAMHALGIPTTRSLAVVTTGEVV
    MRETELPGAILTRVAASHLRVGTFQYAGRFLSKEELQALADYAIKRHYPNGEHASNRYVFLLEEVMKKQAALVAKWQLVG
    FIHGVMNTDNMTISGETIDYGPCAFMDVYDPETVFSSIDTQGRYAYGNQPYIAGWNIARFAESLLPLLHDEEEKAIEIAQ
    KVIEQFPALYETYWLQGMRAKLGLWTEEAEDKKLIGELLHLMYTHRLDYTNTFRSLTLEEWHFCEQELRDWYTRWQQRIA
    RQDMTKEEVYECMRQNNPAIIPRNYRVEEALAAAVEHGDDTVMERLLHVLSDPYAYMEEQEEYAKTPEPSDRPYRTF
    CGT


    >gi|212638217|ref|YP_002314737.1| peroxiredoxin [Anoxybacillus flavithermus WK1]
    MRAPDFTLPASNGENVTLSQFRGKYIVLYFYPKDMTPGCTTEACEFRDQYEIFTELGAVVIGISPDSIERHKKFIEKHRL
    PFLLLADEKQDVAKLYDVWKLKKNFGKEYMGIERSTFLIDPDGQIIKEWRKVKVNGHVEEVLNALKQAISSSE

    >gi|212638275|ref|YP_002314795.1| Rhodanese-related sulfurtransferase [Anoxybacillus flavithermus WK1]
    MLQINVQSLSHMWRGAFAKERKRLMKEITAAQLKQIMQTGERVHIIDVREDEEVAFGMIPSAIHIRMGDIPERMSELDKQ
    KTYVII
    CRSGVRSEHVCRYLEAHGYNVCNVIDGMLGWNGELL

    >gi|212638295|ref|YP_002314815.1| thioredoxin [Anoxybacillus flavithermus WK1]
    MEKSMKTIERIEQYNEAIQHGKVIMMFTADWCRDCQFIKPVLPEIEAQFSDYTFYAVDRDRLLDLFAEHNVFGIPSFIVY
    ENGQEKGRFVSKDRKTKEEIVAFIQSLGERNE

    >gi|212638327|ref|YP_002314847.1| thiol peroxidase [Anoxybacillus flavithermus WK1]
    MAKVTFKGNPVTLIGNEVKVGDAAPNFTVLANDLSPVTLDDTKGFVRLISVVPSVDTGVCDAQTRRFNEEAGSIEGVKVL
    TISVDLPFAQKRWCAANGLENVVTLSDHRDVSFGQAYGVLIQELRLLARAVFVVDRNDRVTYVEYVSEATNHPNYEAAIE
    AAKQAAQQ

    >gi|212638386|ref|YP_002314906.1| peptide methionine sulfoxide reductase [Anoxybacillus flavithermus WK1]
    MITTIHKRGEIKMEKATFAGGCFWCMVTPFEELDGIYGIVSGYTGGHVENPTYEQVKTGTTGHYEAVQITFDPDVFPYEK
    LLELYWCQIDPTDDGGQFHDRGPQYRTAIFYHNERQKTLAEQSKKQLEESGRFSKPIVTEILPATTFYPAEDYHQNYHKK
    NPKHYKEDRAASGRDEFIAKHWGNNE

    >gi|212638415|ref|YP_002314935.1| thioredoxin [Anoxybacillus flavithermus WK1]
    MAIVNATDQTFVNEVKEGVVLVDFWAPWCGPCKMIAPVLEEVDRELAGKVKVVKVNVDDNPETAGKYGVMSIPTLFVFKD
    GEVVDKTVGFQPKEALVGFLSKHL

    >gi|212638746|ref|YP_002315266.1| glutaredoxin family protein [Anoxybacillus flavithermus WK1]
    MLTVYMHPSCTSCRKVKKWLCANNVEFHERHLFRETPTYEELLHLLSLTTEGIDEILATRSQLFKQLVENIEEWPLSKVV
    ELLVKEPRLLRRPIITDGKRLVIGYNPSALKNMAKKYRRVYVS

    >gi|212638761|ref|YP_002315281.1| Rhodanese-related sulfurtransferase [Anoxybacillus flavithermus WK1]
    MATMKKRRGIMTIALIILGAIIVYAVITYFYQKRIVQTLTEEEFRAGYRKAQLIDVREPDEYAAGHILGARNIPLSQLRL
    RMKELRKDQPIYLY
    CQSGIRSSRAAQMLYRNGYRDLYHLKGGFKMWTGKVKKK

    >gi|212638802|ref|YP_002315322.1| dihydrolipoamide dehydrogenase [Anoxybacillus flavithermus WK1]
    MMAKEYDVVILGGGTGGYVAAIRAAQLGLKTAVVEKGKLGGTCLHAGCIPSKALLRSAEVYAQTKESETFGVIASEVRLD
    FSKVQARKQAIIDQLHKGIHMLMKKGKIDVYEGTGRILGPSIFSPMPGTISVEMNDGTENEMLVPKYVVIATGSRPRTLP
    GLTIDGQFVMTSDEALRMETLPSSIIIVGGGVIGIEWASMLNDFGVDVTVIEYADRILPTEDRDVSKEIEKILKQRGVRI
    VTKAKVLPDTLVVENGVRIQAEINGKNETFTAEKMLVSVGRQANVEGIGLENTDIVVEKGFIQTNEYYQTKEKHIYAIGD
    VIGGLQLAHVASHEGIIAIEHLAGKEVHPLDYAMVPKCIYSRPEAASVGLTEEEARAKGYDVKVGKFPFKAIGKALVYGE
    AEGFVKIVADAKTDDLLGVHMVGPHVTDMISEAGLARVLDATPWEIAHTIHPHPTLSEAMMEAALAVDGKAIHF

    >gi|212638826|ref|YP_002315346.1| hypothetical protein Aflv_0985 [Anoxybacillus flavithermus WK1]
    MVKITITERAIEQLRRVRGNKHVKLTYDTDDCGCAVNGVPMLLLVEQLDEHDVAIETNDIQIWMEKHRLIFFDERMTIDV
    VDGAGCFQLKSPNQILNPRMSLMER

    >gi|212638877|ref|YP_002315397.1| thiol-disulfide oxidoreductase [Anoxybacillus flavithermus WK1]
    MAMKEKRFWLRTVILAIMLVAIGYTIYSNVFVEKKAIQVGDSAPDFVLTDLNGNKIQLSDYRGKGVFLNFWGTWCKPCEK
    EMPYINSQYNVYKNEGVEVIAVNVGEAKVTVQTFVDRFQLAFPVVIDQQDQVMNAYDINPLPTTFLIDKDGKIVDIITGT
    MTEEDVKKHMERIKP

    >gi|212639055|ref|YP_002315575.1| cation transport ATPase [Anoxybacillus flavithermus WK1]
    MKGVGSIMSEQKHVTLRVTGMTCAACANRIEKVLNKMDGVEANVNLAMEKATIQYDPSKQTIADIETKIKNLGYGVATEK
    VTLDIEGMT
    CAACAARIEKGLHRMEGVTSATVNLATNSAVVEYKEGVTSVEDILEKIKKLGYKGQIRNEEQDDAGRKEER
    LKQKQRQLAISIILSLPLLYTMVAHMPFDIGLPMPHLLMNPWFQLLLATPVQFYIGGPFYVGAYRALRNKSANMDVLVAL
    GTSAAYFYSLVETLRSLGHHEPRLYFETSAVLITLVLVGKYFEALAKGRTTEAISKLLSLQAKEATVIRNGEEIKVPLEE
    VVIGDTIIVKPGEKIPVDGTVIAGSSSVDESMITGESIPVDKREGDFVIGATMNTNGVLTIRAEKVGKDTALANIIKIVE
    EAQGSKAPIQRMADTISGIFVPIVVGIAALSFLIWYFVVTPNDLPKALEVAIAVLVIACPCALGLATPTSIMVGTGKGAE
    HGILFKGGEYLEGTHKINAVLLDKTGTVTKGKPEVTDVLQFQANMLDYAVSAESASEHPLAQAIVAYGKANGMVAQPLTH
    FSALVGHGIEATVNGKHVLIGTRKLMNERAVDIAEHEEQMIKFENEGKTVMLVAIDGQLAGIIAVADTVKESSKEAIQTL
    KQMGIDVYIVTGDNKRTAEAIAKQVGIEHVYSEVLPEDKANIVEELQKQGKRVAMVGDGINDAPALAKADIGMAIGTGAD
    VAIETADVTLVGGDLLHIPKAIELSRQTMKNIRQNLFWALFYNSVGIPVAAAGLLQPWIAGAAMAFSSVSVVTNALRLKR
    VKI

    >gi|212639056|ref|YP_002315576.1| Copper-ion-binding protein [Anoxybacillus flavithermus WK1]
    MMTITLQVQGMTCGHCKAAVTNALQTLDGVSRVEVHLQEGTVDVDYDETKVSVEKLKEAIEEQGYDVE

    >gi|212639134|ref|YP_002315654.1| NAD(FAD)-dependent dehydrogenase fused to Rhodanese-like domain [Anoxybacillus flavithermus WK1]
    MRKIVIVGGVAGGASAAARLRRLSEKDEIIMFERGEYISFANCGLPYYIGDVIQERSKLLVQTVDGMSKRFRIDVRNLSE
    VTSINRERKTVTVKHLRTNEQYEQPYDVLILSPGAKPIVPPIPGIDEAKALFTLRNVPDTDRIRSFVDNEKPKRAVVIGG
    GFIGVEMAENLTERGVHVTLVEMANQVMAPIDYEMAAIVHTHMKEHGVDLVLEDGVQAFENEGRRVVLKSGRTIETDMII
    LAIGVQPENQLAKEAGLELGFRGAIKVNEHLQTSDPNIFAIGDAIEVKSFIHGFETFIPLAWPANRQGRLVADYINGHDV
    KYNGTLGTSIAKIFHMTVAATGLNEKILKHYGIDYEVVHVHPMSHASYYPGATQMTLKLIFDRQGRIYGAQAVGQDGVDK
    RIDVIATAIKGGLTVYDLPDLELAYAPPFSSAKDPVNMAGYVASNVLDGMVETVQWHEIDDIVANGGLLIDVRTPKELET
    RGAIPGSINIPLDDLRDRLHELPKDQTIYVT
    CQVGLRGYLATRILKEHGFEAKNLDGGYKLYSSVK

    >gi|212639135|ref|YP_002315655.1| Rhodanese-related sulfurtransferase [Anoxybacillus flavithermus WK1]
    MGMFENILPTQANTLRHEENVEVLDVREAHEVAAGKIPNARHIPLGQLFARLNELDSNKTYIVVCHSGGRSALACEWLSE
    RGFHVKNMVGGMMSWEGEVE

    >gi|212639157|ref|YP_002315677.1| glutathione peroxidase [Anoxybacillus flavithermus WK1]
    MSESKHHLCRKNDSYVTIALKEECEMNIYDFHVRTIRGEEQSLAQYKGKVLLIVNTASKCGLTPQYEQLQQLYDKYKEQG
    LVVLGFPCNQFGNQEPGSEEDISQFCQLNYGVTFPMFAKVDVNGPNAHPLFVYLTEQAPGMLGTKAVKWNFTKFLVDRNG
    QVVARFAPTTKPFELEQHIEALLRETVSR

    >gi|212639169|ref|YP_002315689.1| cation transport ATPase, contains heavy metal-binding domain [Anoxybacillus flavithermus WK1]
    MKEYEIKGLTCANCARALEEQIQSLPYGDGATLNYNSGKLRVHERIDLEKVRTILATDGAYIADDEQTQKKRNPLLYLVG
    VSLVLFLMALVLEHLDIDGASIIIIIYMATIVLSGYKTFVKGLKNIIRFRFNMDTLMTIALIGAFGIGEWKEAAVVAILF
    GINEYLEGLGMERARRSLHMLLKQAPKEALLISNGNMRVVPIDSLQVGDVVLVRPGEKIPSDGIVIEGKSSVNEAAITGE
    AMPIEKELGMNVYGGSVNNEGMLHVQITKQYKDSSLAKILHLVQEAQETKTPLELFIHRFAKYYTPFIMIVSLFVMLVPP
    LWFEASWHDSLYQGLAVLIVGCPCALILSSPIALLAGMTRNAKNGVLVKGGVHLETLGRVRTIAFDKTGTITKGKPHVTN
    VIAYSDENELLYIAASLESVSSHPLAQAIVQKAKQHHIAYKQPEQVETRTGSGIEGKVDGIWYRIGNERMFDPQLFTEQV
    QQDAEKLKCEGRTIVFVADEQRILGLFGVADEIREESKKVIQQLHRIGIRRTVMLTGDHEKTAEQVAKQVGVTHTLAKLL
    PEQKVEKIKELMETDIVAMVGDGMNDAPALAHAHVGIAMGKGTDSAIETADVVLMQDHLEKLPEAIVIARRVNRTIRLNI
    AIALSLKAIALLLTIPGWLTLWMAILSDMGATIFVSILSLFILWEKRTI

    >gi|212639201|ref|YP_002315721.1| thiol:disulfide interchange protein (thioredoxin) [Anoxybacillus flavithermus WK1]
    MTNRRVGMLMKKWMAIIVLFSFFAYMLWEHTAERQTIQTGIHIGMKAPDFSLQTIDGKTVQLSQLRGKAVIVNFWATWCP
    P
    CRAEMPDMQTFYEQYYRQVEIVAVNVMVRDSQEKVREFIKDYHLTFPVVLDVDGNVMKQYDIQPIPTSFIIDRQGIIRK
    KQIGPMSYEQMVQYAEKWGK

    >gi|212639234|ref|YP_002315754.1| thioredoxin [Anoxybacillus flavithermus WK1]
    MIFVHFAIIVNEREKERVICMPAVESNMFPLGEKAPSFELVNVINGQTVRLEDVKSDIATVIMFICNHCPFVKHVQEELV
    RLANDYQPKGVSFIAINSNDVEKYPDDSPEKMKEVAEQLGYPFPYLFDETQEVAKAYQAACTPDFYIFDGELKCVYRGQL
    DDSRPGNGIPVTGSSIRSALDALLLGKPVPKEQKPSIGCSIKWKEK

    >gi|212639257|ref|YP_002315777.1| mercuric reductase [Anoxybacillus flavithermus WK1]
    MKRYMMRIEGMTCPSCEKHITSILEQLGATSIDVSFHRGEAVFELPHANVEMAKQAITAAGYEPTEAEEIEATRETYDYI
    IIGSGAAAFASAIEARKYGAKVAMIERGTIGGT
    CVNIGCVPSKTLLRAGEINYLAKNHPFLGLHTSAGTVDLSALIEQKN
    ELVQNLRQAKYIDLIDEYGFTLIQGEAVFLDETTVEVNGKKLSANRFLIATGAAPAIPNIPGLADVEYVTSTTLLERKEV
    PKRLAVIGSGYIGIELGQLFHHLGSDVTLMQRSPRLLKTYDQEISEAITKALTTQGVRLLTGVAFERIEQDGNVKKVYVE
    IDGKKQVIEADELLIATGRTPNTAALRLEAAGVTTGSRGEIIVNDYLQTTNPRIYAAGDVTLGPQFVYVAAYEGAIAAAN
    AVGGQQKKIQLETIPAVTFSSPAVATVGLTEQQAKEKGYEVKTSVLPLEAVPRAIVNHETVGVFKLVADAKTGKLLGSHV
    VTEHAGEIIYAATLAIKFGLTINDLRETLAPYLTMAEGLKIAALTFDQDVGKLSC
    CAG

    >gi|212639281|ref|YP_002315801.1| Cu2+-binding oxygen sensor (SCO1/SenC/PrrC family) [Anoxybacillus flavithermus WK1]
    MKRIRLWLFALLLLLLVACQQSIPDAKNWPIEDFTFTDQHGQQFGLADLKGKVWVADFIFTRCADVCPPMTANMAKLQKM
    AKEKGLDVHFVSFSVDPENDTPDALKTYVEKFQGDLSNWHLLTGYTQQDIERFAQKNFKAVVKKPQEGDQVIHGTDFYLV
    DQNGTIVKYYSGLNDVPYEEILKHIDMLQE

    >gi|212639371|ref|YP_002315891.1| Rhodanese-related sulfurtransferase [Anoxybacillus flavithermus WK1]
    MIICGGDNFMQKWFSFLFTFLFIISGCAQNRYTNISVDEAAQMMQKEDVVVLDVRTEEEYASGHIPGAILLPLQQLPDRV
    DELNKNKTYIVV
    CRSGNRSAQASELLVKEGFSSIYNMTGGMNEWKGEVEK

    >gi|212639388|ref|YP_002315908.1| thioredoxin family protein [Anoxybacillus flavithermus WK1]
    MTIKVLGTGCKKCRELEQNVKMALAQLQLDVQVEKVEDIEKIMSYGVMSTPALVINEKVVSTGKLLSVDEVLRLLK

    >gi|212639447|ref|YP_002315967.1| membrane-associated thiol-disulfide oxidoreductase [Anoxybacillus flavithermus WK1]
    MQIGAIVIQGENVLLIVSLLMTYVFFYYGLFVLKAERNVMDVIFNSFVYGLVIWKVSYGIVHPNVVLQNPLTLLYFNGGM
    VGLVLAVIFIVLYTYWQLKKQHISFDVYIRSVTPIYFGYWIVFIVVKGIEFSEHRFIWLQAAVALIFFIVSSRTKTTQKI
    GRLLVLFHIFSFIFSLISDKTNEATSKQSSTNVGINVGEMAPDFELMTLKGEKMKLSQFRGKKVILNFWASW
    CPSCRAEM
    PEMQRFYEQYRQHVAIVAVNLTNKEKNHQAVETFTNEKGVSFDIMLDEKGTVSKTYEVITIPTSYIIDEHGVILRKHVSP
    LSYDMMKRTVLSE

    >gi|212639452|ref|YP_002315972.1| putative dithiol-disulfide isomerase involved in polyketide biosynthesis [Anoxybacillus flavithermus WK1]
    MKIEIWSDFVCPFCYIGKRRLEEALSSFPHRENVEIIFRSFELDPNAKKETSLSIHEMIARKYGISVDEAKRANADIGKQ
    AAALGLTFHFETMKPTNTFDAHRLAQYAKEKGKLDEVVERLFYAYFTESKRISDRNVLLELAEVAGLDRKEVEMMLDSER
    YAEHVRNEEAIAAQLGVRGVPFFVLNQKYAISGAQPVDVFRQALEKVWAEEQQSSSLQSLAEEGKICTDENCAID

    >gi|212639717|ref|YP_002316237.1| dihydrolipoamide dehydrogenase [Anoxybacillus flavithermus WK1]
    MVVGDFAIETETLVVGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISAGHRYEIATHSQDMGIFAEN
    VKVDFSKVQEWKAGVVKKLTGGVEGLLKGNKVEIVRGEAYFVDENTVRVMTENSAQTYKFKNAIIATGSRPIELPTFKFS
    KRVLDSTGALNLPDIPKSMVVIGGGYIGTELGTAYANFGTKITILEGADEILSGFEKQMSAVVRRRLKKKGVDVFTNALA
    KGVEEREDGVTVTFEVNGETKTIDAEYVLVTVGRRPNTEEMGLEQIGINMTERGLIEIDKQCRTSVPNIYAIGDVVAGPP
    LAHKASYEGKIAAEAIAGHPSEIDYLAIPAVVFSDPECASVGYFEKQAIEEGIDVITAKFPFGANGRALALNETDGFLKL
    VLTKDDGVIIGAQIVGPNASDMIAELGLAIEAGMTAEDIAMTIHAHPTLGEITMEAAEVALGSPIHIINK

    >gi|212639728|ref|YP_002316248.1| thioredoxin domain-containing protein [Anoxybacillus flavithermus WK1]
    MKLREPMPSLDGATLVLNENVTREQLIGKPTLIHFWAVSCHLCKEGIKQVNAFRDRYEGELHVISIHMPRRDGDENVEVV
    QQLAEQYGITHPLFIDNDHRLKEAFDNRCVPTYYIFDADGHFRHYQAGSGGMNMLEKRIIRVIDEYRTRGDL

    >gi|212639904|ref|YP_002316424.1| thioredoxin [Anoxybacillus flavithermus WK1]
    MKRLQDAQQFEQAIASSTPVVVKFFTTWCPDCVRMDQFIGEVIASYPQFTWYDINRDDVPDIAETYNVMGIPSLLVFQNG
    EKIAHLHSANAKTREQVEEFLQTIS

    >gi|212639951|ref|YP_002316471.1| glutaredoxin family protein [Anoxybacillus flavithermus WK1]
    MVIVYSSPSCTSCRKAKAWLEEHHIPYKERNIFAEPLTIEEIKSILRMTENGTDEIISTRSKIFQKLNIQLDSLPLQDLY
    EIIRQHPGLLRRPIIMDEKRLQVGYNEDEIRRFLPRKVRTYQLRQAQQLVNNKGLA

    >gi|212640104|ref|YP_002316624.1| Rhodanese-related sulfurtransferase [Anoxybacillus flavithermus WK1]
    MGTWMNVVLVILLIYFVATKMLPTKGVEHITPDELKEKLKQTKDRQFIDVRTPAEYRARNIRQFKNIPLHQLADQLHELD
    REKETIVI
    CQSGMRSNQAAKILAKNGFKRVVNVRGGMNAWNG

    >gi|212640134|ref|YP_002316654.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Anoxybacillus flavithermus WK1]
    MDRYSRQQLFAPIGEKGQRYIREKHVLLIGAGALGAANAETLVRAGVGKITIVDRDYVEWSNLQRQQLYTEEDAMKRLPK
    AIAASVHLRAINSDVVVEPIVADADARLIGQIVGRHRPDVIIDSTDNFDVRMIINDVSQKYSVPWIYGACVGSYGLSYVI
    IPNETPCLRCLLEDVPLGVAT
    CDTAGIISPVVHMVVAHQTAEALKILVGDKRTNRKLVSFDVWHGQYRMIDVHKLKKDDC
    SSCGKKRIYPALQYENETKFAVLCGRETVQIRPAQRGEREWATLLSFLQKQGIRVEQNEYLLAFTIHPYRFVVFSDGRVF
    IHGTNDIQEAKRLYYQYLG

    >gi|212640152|ref|YP_002316672.1| O6-methylguanine-DNA methyltransferase [Anoxybacillus flavithermus WK1]
    MRFGRGELDMEKHVVYYESPIGWLQIIGTNEGIERIDVVERGRDQNEKVAEPLMQSLEELEQYFQKKRTSFSMPLKLVGT
    PFQLRVWEALQTIPYGQTVSYADIAKQIGQPKAVRAVGNAVGNNPITIVVP
    CHRVVRTGGGLGGYAWGTERKKWLLTHET
    R

    >gi|212640158|ref|YP_002316678.1| thiol-disulfide isomerase [Anoxybacillus flavithermus WK1]
    MKKLLIFGGIIIILFGALAWITSYTQKQKAEGNPFGKEELHPATIDLLDDPNYQNIILPNELREALNKKETITVYFYSST
    CEFCKKTTPIVAPLAQEMGIDLKQFNLLEFEEGWDEYHIEATPTIVHFKNGQEVARIEGYYEEDVFRKWFEQME

    >gi|212640164|ref|YP_002316684.1| Zn-dependent hydrolase [Anoxybacillus flavithermus WK1]
    MAVHALTAQQINEMIVNKEPFFLFDVRNESDFADWKIEGEHIEYLNVPYFELIDGVEPVLERLPKDKKIVVVCAKEGSSM
    MVADMLAEKGLEVFYLKGGMKAWSEYLYPVVVYQDNDIKVYQFIRVGKGCLSYMVVSGKEALIVDPSRFIDVYKEVAQKE
    NVAITHIVDSHLHADHISGGYELAKQTGATYYLMKSEGAVFEFEPLENHDRIEFEKVSLEVLAIKTPGHTPGSVSFFVNN
    KLLFSGDTIFVSGLGRPDLGGKAREWAKDLYDTVYNKVAQIADDVIVLPAHYANFDQEVNAQGYIGNTLGNIRQMNEIMQ
    GKTEEEFVEHVAQSASSETPPNFEDIIAINRGVKDATQEQQQELEIGPNRCAVHHTH

    >gi|212640169|ref|YP_002316689.1| putative redox protein, regulator of disulfide bond formation fused to Rhodanese-like domain [Anoxybacillus flavithermus WK1]
    MTIHVDLVVDAKGLTCPMPIVRTKKAMEQLQPGQVLEVQATDKGSLADIQGWAKNTGHQYIGTIEEGDVLKHYLRKANPT
    EVREETKYPHVIALEDLQKKVENNEQVFILDVREEAEYAFGHIPGAYHIPLGQLEERLNELNKDETIYVI
    CRTGNRSDLA
    AQQLTEKGFTHVFNVIPGMTQWKGTMTKGGNEQ

    >gi|212640170|ref|YP_002316690.1| Rhodanese-related sulfurtransferase [Anoxybacillus flavithermus WK1]
    MSEMKHILPQEVEQQLKEGRALSIIDVREDEEVAQGKIPGARHIPLGQLLERMNEIDKNEEHILVCRSGNRSGMACQLLE
    SYGYRVVNMTGGMLEWTGEIER

    >gi|212640227|ref|YP_002316747.1| Fe-S cluster assembly scaffold protein [Anoxybacillus flavithermus WK1]
    MEQIVLLTEKAVEQVKQMMKESGEEHAYFRVGVYGGGCSGLSYAMGFEHNKREDDHEFEQNGLRILVDKESALVLKGTTI
    DYEQGAMGGGFTIHNPNAIASCGCGSSFRTATHAGTPEEC

    >gi|212640287|ref|YP_002316807.1| gamma-carboxymuconolactone decarboxylase subunit [Anoxybacillus flavithermus WK1]
    MSIWASFYIFCKTTHDKKEGGVHMSMEQCLHEYKQGLGTFTQHMPKVGQTFHAFTEACFAEGSLSKKEKQLIALGISVAK
    QDEY
    CTIYHTKGCIDEGATEEQIFEACAVAAALAGGATMSQAVTLVRQCVEEFRHVH

    >gi|212640297|ref|YP_002316817.1| thioredoxin [Anoxybacillus flavithermus WK1]
    MIVVKVVYMYTPLCGTCQVASRMVDVLEQLLPSVTFERQDLNYVPDKAVEWCIESVPCLLIFQHDKLVQKIYAFHSVPYL
    YETLRKLAE

    >gi|212640301|ref|YP_002316821.1| arsenate reductase, glutaredoxin family [Anoxybacillus flavithermus WK1]
    MVTFYWYPKCGTCRKAKKWLDDNNISVQAIHIVEQPPSKEQLRTLYEKSGLDLKKFFNTSGMKYRELGLKDKLKTMTEED
    MLQLLSSDGMLIKRPIIINGERVIVGFNEQKYHEMFKLS

    >gi|212640340|ref|YP_002316860.1| glutaredoxin related protein [Anoxybacillus flavithermus WK1]
    MKIVLYSKENCCLCDEAKDILRELQVEWEEVDIYKDERLLERYHLMIPVIEMNGDIVAYGRIHKDVIRKRLQQIRSS

    >gi|212640348|ref|YP_002316868.1| thioredoxin reductase [Anoxybacillus flavithermus WK1]
    MESDAYRKGEKNVSQENIYDVIIIGAGPAGMTAAVYTSRANLSTLMLERGVPGGQMANTEEVENYPGYEHILGPELATKM
    FEHAKKFGAEYAYGDVKEVIDGEEYKTVVTSNQQYKARAIIIATGAEYKKLGVPGEKELGGRGVSY
    CAVCDGAFFKGKEL
    VVVGGGDSAVEEGVYLTRFASKVTIVHRRDQLRAQKILQQRAFANEKIDFIWNHTVKQINEKDGRVGSVTLVHTQTGEER
    EFPCDGVFIYIGMVPLTKPFASLGITNENGYIETNELMETKVPGIFAAGDVREKSLRQIVTATGDGSIAAQSAQHYVEEL
    KEKLNIQ

    >gi|212640590|ref|YP_002317110.1| alkyl hydroperoxide reductase large subunit [Anoxybacillus flavithermus WK1]
    MILDAEIKTQLAQYLQLMENDIVLKVSAGDDKVSRDMLALVDELATMSPKIKVEKTTLERTPSFSVNRVGEDTGVVFAGV
    PLGHEFTSLVLALLQVSGRPPKVDQAVMEQIKHLKGTYRFETYVSLT
    CHNCPDVVQALNVMSVLNPNVSHTMIDGAAFKE
    EVEQKDVMAVPTVFLNGEPFASGRMSLEEILAKLGSTPDASTFAEKDPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
    FGGQILDTLGIENFISVKYTEGPKLAASLEEHVKHYNVDIMNLQRAKRLEKKDLIEVELENGAVLKSKAVIIATGARWRN
    LGVPGEAEFKNKGVAY
    CPHCDGPLFEGKHVAVIGGGNSGVEAAIDLAGIAKHVTVLEFAPELKADAVLQDRLYSLPNVTV
    IKNARTKEITGTDKVNGLTYIDRATGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNVPGVFAAGDC
    TDSAYKQIIISMGSGATASLGAFDYLIRN

    >gi|212640591|ref|YP_002317111.1| alkyl hydroperoxide reductase small subunit [Anoxybacillus flavithermus WK1]
    MPLVGKQIQPFKAMAFHNGDFIEVTEENLKGKWSVVCFYPADFTFVCPTELEDLQNEYSKLKELGVEVYSVSTDTHFTHK
    AWHDHSPAISKIEYVMIGDPSQKLSRMFEVLDEETGLAQRGTFIIDPDGVIQAVEINADGIGRDASTIVNKIKAAQYVRN
    NPGEVCPAKWQEGRETLKPSLDLVGKI

    >gi|212639057|ref|YP_002315577.1| Copper-ion-binding protein [Anoxybacillus flavithermus WK1]
    MTCGHCKAAVTNALQTLDGVSRVEVHLQEGTVDVDYDETKVSVEKLKETIEEQGYDVE