Maricaulis maris MCS10 uid58689

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|114568641|ref|YP_755321.1| thioredoxin [Maricaulis maris MCS10]
    MATKAVSDESFESDVINASGPVLVDFWAEWCGPCKQISPALEEIAEEMSGSLTVAKVNIDDHPMTPGKYGVRGIPTLMIF
    KDGQVVSTKIGAMAKGKISEWVQETL

    >gi|114568707|ref|YP_755387.1| peptide methionine sulfoxide reductase [Maricaulis maris MCS10]
    MSDPIWKSRIIPAEQALPGRADALSPTTSHAITGREIKADTPEGMQEIFLGLGCFWGAERLFWETDGVWHTAVGYGGGTT
    PNPTYQETCSGATGHAELVRVVFDPEMLSLDQVLKIFWEGHDPTQGMRQGNDRGTQYRSAIYATTPEQLVAAHDAAARYQ
    AELDGAGLGTITTEIVKAGPFYYAEDEHQQYLARNPSGYCGIGGTGVVCPIGRHAPT

    >gi|114568792|ref|YP_755472.1| rhodanese domain-containing protein [Maricaulis maris MCS10]
    MTLRELEPQDVSAAIADDKAVVIDVREPGEFATERLHGASLHPLSTFDPQRLPVDVSRDVVLHCGSGKRSMDALKRCQAA
    GVNITAHVRGGLMAWKSAGLPTVRIDPATGQVIDPQAV

    >gi|114569049|ref|YP_755729.1| 1-Cys peroxiredoxin [Maricaulis maris MCS10]
    MGLLLGDIAPNFQAETSEGPISFHDWIGDDWVIFFSHPADYTPVCTTELGFTARLKDEFANRGAKAIALSVDSVEDHKGW
    IKDIEETQNVRMNFPIIADTDRKVSELYSMIHPNADPKLTVRSVYIIDSNKKIRATFTYPPSAGRNFNEVLRLIDSLQLT
    DGYKVATPVNWADGDDVIVVPSISDAEADKLFPAGYNKIKPYLRVTKQPNKVDEPAE

    >gi|114569148|ref|YP_755828.1| cytochrome c biogenesis protein, transmembrane region [Maricaulis maris MCS10]
    MRFLSGLSALIALAGLVATAPASAQSSWSSGEAIIEADLVSDRSIVAPGDSFHIGLHQIMPEGWHTYWRNPGDNGLPVEI
    DWDLPSGVEIGEIVWPVPIELPLTDTIMDYGYKGELVLPMPVTVASDFAGEAIEFRANATWLVCDTICVPEDRELTLTLP
    VGPEAEPDETGYWYIRGALENEPRADPAVAAEFAFEGGRVILELSGGAFANTDAISDLRFFPYQTGLIRNAGAQSVATGE
    GSTLVLLEPGYAVATAANSAQGGVITWQGADGQTRQSVAIEAQPGEGGYDLPAVAGASVPQVMSGGILGLVLLAFGGGLI
    LNLMPCVFPVLSIKVLKFVQAAHADPGAVRRQGAFFLAGVLISFVGLAGMLVILREVGLPVGWGFQLQMPIVVASLALLL
    FAIGLNLLGAFEVGTRLMGLGAGLADKPGWKGAFFTGVLAVVVAAPCVGPLAAGALGLALTQPAPVVLLVAAAMGLGLAA
    PFVVLSLSPGLLRFLPKPGAWMVTFRQFLAFPMFASVVWLAWVLSIQSGPTGLLLLGAAMLALSFAVWAHGQNGRAWSVV
    ALVGLALGVASVVMIARLPATTSTQSLSAREEAWSRARVAELQGMGQAVFVDVTAAW
    CVTCQINKLTVLGSTPVEAAFDR
    FGVASLRADWTNRDETIAALISEHDQAGVPLYLLYPASGGAPRVLPTVLTTGGFVDALEWAADN

    >gi|114569192|ref|YP_755872.1| DSBA oxidoreductase [Maricaulis maris MCS10]
    MTHSVSVDIVSDLVCPWCWLGKRHWDQARKLTADIKVETVWRPYQLDPTLAREGRPYKDYMREKFSGAEASGRWKAMRDH
    LEQAGPAAGIDFRFDDIAMRPNTLDAHRLMRWAGGQGRTAEMAEALFSAFFAQGRDIGDRDTLAALAGDAGLDSAVTADL
    LATDKDEKAVWEEELFYRKLGVSGVPTYIFNGRFAVSGAQEPAVLADAIRQAVKEPAETE

    >gi|114569260|ref|YP_755940.1| dihydrolipoamide dehydrogenase [Maricaulis maris MCS10]
    MQTRSCQVLIVGGGPGGYPAAIRAGQLGLDTIIVDKHGLGGTCLNRGCIPSKAMIHAATKFEEMGKHADSDVLGISLAEA
    PKLDMGKLVGWKDGIVSKLTGGVGQLIKAAGAEHLAGWAEFSNAKTCVVTQDNGEKVEITAENVILATGSVEVELPFLPF
    GDTVIGSTEALNLTELPEKLVVVGAGYIGLELGIAYRKLGSDVTFIEASDGILPLYDKEITRPITMWLKKHKVAVNLSCK
    AKGVTEKGGKAVLAYEDAKGAAQTIEADKILVAVGRKACLDGWGLENMGLDLEGGKFIKVDSQCRTGMRGVYAIGDVVGE
    PLLAHKATAQGEMVAEIIAGHRREHDPVSIAAVCFTEPEIVGVGLTPDEAKAKGEEIITGKFPLAASGRYLSMEAGLDGG
    FVRVTARKEDHVILGIHAVGTHVSELSGEFALAVEMGARLDDIAGTIHVHPTLTEGFAEAALTALGHPIHISAPKK

    >gi|114569430|ref|YP_756110.1| methionine-R-sulfoxide reductase [Maricaulis maris MCS10]
    MPRLSAAEIEALKARLDPHTYAIAFEEGTEHAFTHPFNAEKRDGSYHCKVCDTPLFASDHKYDSGSGWPSFWQPLDSDTV
    ETKTDFKLRLPRTEIHCANCGAHLGHVFPDGPQPTGQRF
    CTNGGVLDFQPAASEE

    >gi|114569492|ref|YP_756172.1| OsmC family protein [Maricaulis maris MCS10]
    MAQTRRVDFEGALGETLAARLEMPHGRPRAYALFAHCFSCSKDILAASRIARRLTAAGFAVLRFDFTGLGQSDGDFANTN
    FSSNIADLIAAAGYLEAEHAAPSLLIGHSLGGAAVIAAAGQLPSVRAVATIGAPADAAHVTQQFAADVDAIEREGVARVE
    LAGRTFTLKKQFLDDIGGHRVEDAAAALHRPLLLLHAPTDAIVAIDNASRLFRAARHPKSFVSLDDADHLLGNRPDAEYA
    ADMIAAWAERYLPETRPEPPESAGEGVVVVRETGAGPYENHVVAGEHVMLADEPASVGGLDAGPSPYGYLSAALGS
    CTSM
    TLRMYADRKGLPLDRVTVSTGHHKGHADDCADCVDGQERHVDIFEREITLEGELDAAQTARLLEIADKCPVHRTLHSPVV
    VRTRLKDDG

    >gi|114569524|ref|YP_756204.1| NADPH-glutathione reductase [Maricaulis maris MCS10]
    MTQYDYDLFVIGAGSGGVRAARMAKQHGAARVAVAEEYRVGGTCVIRGCVPKKLLVYASEFAKTFKLAESYGWSVGETSF
    SWERLIAAKDAEIDRLSGIYSRNLNNSGVEVIEERAEFEDAHTIRLVKSGRTVTADKILIAVGGTPYVPELEGAELGISS
    NEAFHLESLPRHVVIAGGGYIACEFAQIFAGMGAEVCQVYRGDTVLRGFDDDVRSHVHEELVRSGVRVITHTVFEKIEAL
    PDGRKRVHLDNGNHIDTDVVMYAIGRSPHVDGLGLDKAGVALDPNGAIKVNAYSKTTADNIYAVGDVTNRVNLTPVAIRE
    GAAFAATVFGDTPTAYDHEDIASAVFTQPPVGSVGLSEVDARKKIAQVDVYKTSFRPMKSSLTSDASRMLMKLVVDGETQ
    RVLGVHIVGPDAPEMIQLAGIAVKAGLTKDQYDAACAVHPTSAEELVTMKEKWTPPELKAAE

    >gi|114569572|ref|YP_756252.1| glutaredoxin-like protein [Maricaulis maris MCS10]
    MSATAHDSIKSTIDGNEVVLFMKGTPVFPQCGFSSVVARVLDHLQVNFESVNVLEDDGIRQGIKEFSNWPTIPQLYVKGE
    FVGGCDIIKEMFETGELQAYFKDKGVLADA

    >gi|114569645|ref|YP_756325.1| hypothetical protein Mmar10_1094 [Maricaulis maris MCS10]
    MRSTQKNLIPSSFVSGSGAVSGFLAFVGASCCVVPILLVQLGVASGLVAKLGFFARWQDWFAWGATGMLAFSLTLALWCG
    SPGRIFWIWWIVGAVFLAVSLTLPNYEMRLQSWLLDWLRA

    >gi|114569706|ref|YP_756386.1| heavy metal translocating P-type ATPase [Maricaulis maris MCS10]
    MTAAVAGAAMAGHADPQAFVRESDGEASLDLLVRGATCAGCIARIEGGLKADARVTQARLNLSTGRLNLRWTGSADLARD
    YVDTLGRLGYPATPYEPESEADPQKEDERKLLYALAVAGFGMANVMLLSISVWAGGEEMSASLQALMHRGSALIALPVAA
    YAGQPFFRSAVTALRSGHVNMDVPISLAVLLACGLSVWETFIGHGQTYYDAAVMLLFFLLIGRFLDMRLRARAGEAARGL
    AAMQAATANRLEADGRVRAIPARDVKAGDRLVLAAGDRVPVDATICEGEGALDGSLVTGETAPVIAKPGLDVFSGMLNLD
    GKLVLEARSDRDHSLLAEITRLVEAGEQARSRYVRLADQAARLYVPVVHGLAALTLIGWLVIGGEARPAIINAIAVLIIT
    CPCALGLAVPAVQVVASGRLYREGVLVKSGDALERFAGIDTVVFDKTGTLTEGRPRLINQDALPDGMLEQAARLARTSRH
    PLSRAIADAAGMGEAAAGVREVPGGGLEAEQDGMLVRFGAANWMGIDAHSDPHTEAWLQVGTDRPVRFCFEDSLRPDAKA
    VIAGLKARGCGVTLLSGDRPGPVNAVAMELGIDDWHAGLQPRDKIDRLEALKAQGRVVAMIGDGINDAPALAAAHVSVSL
    ASAAEISQAAADFVLQGDKLAACLVTLDVSRSARRRVLENFGLAAAYNAIAVPMAVAGLVTPLIAAIAMSASSVLVTLNA
    LRLARRTR

    >gi|114569739|ref|YP_756419.1| uncharacterized peroxidase-related enzyme [Maricaulis maris MCS10]
    MSRLPIPDFDSAPAASRPILEAVHKQLGVVPNMFRLIATSPAALEGYTGNNGALCRALDVKTRERIALAVAQVNGCDYCL
    SAHTYLGLNLANLTPEEVARNRTGRSGEAKADAAVGFAAKVVRERGRVSESDITGLREAGYADGQIVEIVALAAENVFTN
    LINNVAETDIDFPVVTASQAG

    >gi|114569820|ref|YP_756500.1| DSBA oxidoreductase [Maricaulis maris MCS10]
    MMLRFAGAFAAIVFLMGCQQPAASAQLSEPERDEVRELIRSYILENPEIIEEALIELQRRARAREMQSVYDALSANEAAI
    YNDPRDPRLGPDDAEVVIVEFMDYK
    CSYCRVAASWVESVREEYGDRVQILFKEYPILGDESVEASRAAIAALRQGDEVYA
    AFHMALIRSSGPLPGTRIDQLAAVSGVDVAQMRTDMEDPEILAHINQVRSLGRALNVTGTPFFIVDGVVVPGANEMALNE
    ALSAALRG

    >gi|114569856|ref|YP_756536.1| redoxin domain-containing protein [Maricaulis maris MCS10]
    MSELKTGDLAPTFKLPADGGGTIDLADLRGQIVVLYLYPKDDTPGCTTQALDFTAASAAFREAGATIIGLSKDSVKRHDN
    FKAKHGLEVSLVSDPEAEVIEAYGSWVLKKLYGREYMGIDRSTFLIDRDGHVARIWHKVKVKGHVDEVLEAVRELG

    >gi|114569871|ref|YP_756551.1| iron-sulfur cluster assembly accessory protein [Maricaulis maris MCS10]
    MAVRERPKAVSLTEAAAERVKALMAQRGAGFLRVGVKNGGCAGMEYEMAYVDAPGPLDERVEDHGVEIVLESKALLFLLG
    TQIDYEISPLHAKFVFNNPNQTDACGCGESVTIVPVKEV

    >gi|114569975|ref|YP_756655.1| dihydrolipoamide dehydrogenase [Maricaulis maris MCS10]
    MSAGAFDVIVIGGGPGGYVAAIRAAQLGFKTAVVERDNLGGICLNWGCIPTKALLRSAEVYHLMQNAADFGLSAEKIGFD
    IEAIVQRSRKVSSRLTGGIGMLMKKHKITVIEGSAALDRGKDAPTVVVGKDRYTAKHVILATGARARTIPQAGLEPDGDK
    IWTYREAMVPTEMPKSLLVIGSGAIGIEFASFYRTMGAEVTVVEMMDRVLPVEDEEISAFAAKSFKKQGLKLKVSAQVEK
    LEKTAKTVKVHVKDAKGKVEIVEVEKVIMAVGIAANIENMGLEALGVKIDRGHVVNDGFGRTNVKGLYAIGDVAGPPWLA
    HKASHEGVVCIEKIAGENVHAFETGNIPGCTYCHPQIASVGLTEAKAKAAGHEIKVGRFPFVGNGKAIALGDDQGLVKTV
    FDAKTGELLGAHMVGPEVTEMIQGYVVGRQLETTEAELMHTVFPHPTLSEMMHESVLDAYGRALHI

    >gi|114570044|ref|YP_756724.1| 3-mercaptopyruvate sulfurtransferase [Maricaulis maris MCS10]
    MAQTLISAADAMSRLGDADTVFLDGSWTFPGGPQDGAEGCIPGSRPFDIDQVRDTANPLPHMLPDAETFTRHVRAMGINA
    DSRLVIYDRFGLFSAARVWWMFKAMGHDQTQVLDGGLPAWVAAGGTIADSHDTSQQVGDFVACFKPERVIDRVGVEAAIR
    DGSAQILDSRGKARFTARVPEPRQGMRSGHMPGARNLPFTRLIGAGGRLAPDPALFESAGLDPHRPVITT
    CGSGVTACIL
    SLALDCLGRQSAVYDGSWSEWGSRPDTEIETGRAPS

    >gi|114570168|ref|YP_756848.1| rhodanese domain-containing protein [Maricaulis maris MCS10]
    MTDHTEFEPAEIQAGLKAGRYRLIDVREPGEHASERIPEALLVPLSRFRPGEIPEGEGCAVVLHCRSGVRSARALDMCRS
    QGIELAGHMRGGILKWKAAGLPTERADRGASGLTVPQAVAASATVLVVISVGLAASVSPWWLILAAGVAVLLFQARLTGF
    CPFSRFFAGLGLRSR

    >gi|114570208|ref|YP_756888.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Maricaulis maris MCS10]
    MNRILLFVPLAIFAVTLVYFGMGLRQDPSAIPSQMIDRPLPAFDLAGIADGDPGLSNTDLLGQVSLLNVFGSWCPPCAIE
    HPMLMQISRSGRVPIYGVDWRDEPGAGAAWLTRHGNPYSRVGDDAQGRLAIDLGITGAPETFLVDADGRVRHHHVGIITE
    DVWRNTLLPMIEELERS

    >gi|114570228|ref|YP_756908.1| glutathione S-transferase-like protein [Maricaulis maris MCS10]
    MSTGLPILYSFRRCPYAMRGRLALDVSGLGVEHREILLRDKPQAMLDASPKGTVPVLVLDDGRVIEESLEVMLWALGQND
    PENWLEGRERSLDLIAACDDQFKPHLDRYKYATRYEGADPLEHRAAASEFVTVLDKRLQQHRCLTGDRDRLADYGIFPFI
    RQFANTDRDWFDAQSWAALKSWLARHLGSERFARIMEKHPLWSGTG

    >gi|114570370|ref|YP_757050.1| glutathione S-transferase-like protein [Maricaulis maris MCS10]
    MTELTLYHCPKTRGFHALWMLEEIGEPFEVRIVNIRDDIQSEAYGAVNPMRKVPALDVGGELITESPAICAWLADRYPEK
    GLAPAIDATGRGSYLRWLFFTGSVIEPSFIDKAMSRETPRQMAGWGDLASVKATLADALDGRDFLVGDKFTAADLMIGST
    LNFMMNFNLLERVEPFAGYVGQLVERPAYKRAMAREAAFAG

    >gi|114570419|ref|YP_757099.1| uncharacterized peroxidase-related enzyme [Maricaulis maris MCS10]
    MSWIKTLDRKAADGRLSAIYDRVAGKTGQIDNILAVHSLRPHTLEGHMALYKAVLHHYGNSLDKAYLETIGTWVSSLNKC
    AY
    CVEHHFAGLKRLLNDDARAAEIRDAIDAGIPERAFSGRELAGLRYAELLTRQPDKLTQMHAMALREAGFEDGEILEIN
    QVTAYFAYANRTVLGLGVNPAGEALGLSPNTSDDPDNWSHD

    >gi|114570465|ref|YP_757145.1| iron-sulfur cluster assembly accessory protein [Maricaulis maris MCS10]
    MSANVTLSASAAKQIKTIIAAQAAAGLLRIGVVGGGCSGFSYTFDLDDAVNGDDMIIERDGAKVVIDEASLPFLDGSEID
    YVDELIGASFKIHNPNATAACGCGTSFSV

    >gi|114570475|ref|YP_757155.1| selenophosphate synthase [Maricaulis maris MCS10]
    MMDDTRPIRLSSLAHGGGCGCKLDPAVLSDILGGPSGFPLPKELIIDASTRDDAAVWRINDETALVATTDFFTPIVDDPE
    VFGKIAATNALSDVYAMGATPIFCLALVGMPVGKLPPEMIRAILAGGRSVAEAAGAPIAGGHSIDAAEPIYGLVALGTVH
    PDRLLSNAGAKPGDVLILGKPIGIGVFSAALKQDRLSDEGYAQMVASTTRLNTPGAGLAALGGVNAATDVTGFGLLGHLS
    EMCEGAGVRAVIERAAVPVFEEARALAADGVKTGASGRNWAAVGGGVERPADWSAMDEVLWCDPQTSGGLLVSCTPESAE
    AVLEHFRQAGHVDAAVVGRIEAGEGIQVI

    >gi|114570695|ref|YP_757375.1| thioredoxin reductase [Maricaulis maris MCS10]
    MSETRHSRLIIIGSGAAGYTAAIYAARAMLEPTLIAGLQPGGQLTITTDVENYPGFADVIQGPWLMDQMREQAEKVGTDM
    VADIIVEADLKARPFVLKGDSGTVYTADSVIIATGAQAKWLGLESEQKFQGFGVSA
    CATCDGFFYRGKEVVVVGGGNTAV
    EEALFLTNFASKVTLVHRRDSLRAEKVMQDRLFKHEKIEIVWDSEVEEVLGDSDPAGVTAVRVKNVKTGATTDIPAHGFF
    VAIGHAPATELFLDQLETKDGGYLVVEPGTPKTSIPGVFAAGDVTDDVYRQAVTAAGMGCMAALDAERFLASQE

    >gi|114570747|ref|YP_757427.1| protein-disulfide isomerase-like protein [Maricaulis maris MCS10]
    MSLTRRLFSAAAMTAVLAVSACGSSDAPVDGQSRFERAGDRGLGSPDAPVTMIEYASVACGHCATWHNEVYPMLESDYIE
    TGQVRFVLREMITGSAQFAIAGFSLAHCVPEDRYYDMVDLLFQQQNAIFQAAQTQGSARNQYLAIARSMGMSEADFTQCL
    SDETITQDILDANDRAGAEGITGTPRFIFNGEMLDSRRAPGESAYTYFLGNEQLIIDGEPVPNFSDAETFRRILDHLIAE
    NTEAAMPGDDAATSGEE

    >gi|114570748|ref|YP_757428.1| protein-disulfide isomerase-like protein [Maricaulis maris MCS10]
    MSVTRILTSLFLLVAGLALPSIAQAQLAEGAAELRPTDRVIGGADADLLIIEYASFACPHCAHFQTEVWPMIRSEFVETG
    LIRYSVRPMLTSPPQIAGAGVILSECVPDDRYFDAVDLLFHEQANIFETAREGGDVLAVYNRIAAATGGSAETLLACFQD
    TAANEHVNAVAVQASEDGIRSTPAFIIAGDLLAIGHPGDGEAGHNHATAGPTVFLHGGEPLMIDGETVPGRLDEDSFRRI
    ILHFLDESDSAD

    >gi|114570772|ref|YP_757452.1| redoxin domain-containing protein [Maricaulis maris MCS10]
    MTISVGDRLPAASFMTMTADGPNKLSTDDVFAGKTVALFAVPGAFTPTCSAKHLPGFVEKAAEIRGKGVDTIACLSVNDV
    FVMDAWGKSQNAGDDVVMLADGNGEFAKAVGLEMDGTGFGMGVRAQRFSILVKDGVVAELNVEAPGEFKVSSADHILGQL


    >gi|114570805|ref|YP_757485.1| arsenate reductase and related [Maricaulis maris MCS10]
    MTRSRLPNRRVVLQKQEFDVTGLTVYGLKNCDSCKKAVSALNAAGLAHTFVDIREEADRVVKVPDWLDAVGAKVLVNTRS
    TTWRNMAEEDREIAAEDPAGVLIANPTLIKRPVIEAGSTVLVGWSTTSLDALLAGASE

    >gi|114570813|ref|YP_757493.1| glutaredoxin 3 [Maricaulis maris MCS10]
    MTDITIYTRPMCGYCARAVSLLKQKGVAFTEIDAGFDQAKRQEMIQRSNGGRTFPQIFIGDMHVGGCDDLMALERGNKLD
    ALLQA

    >gi|114570877|ref|YP_757557.1| mercuric transporter MerT [Maricaulis maris MCS10]
    MTEIEQSSDQTPAPRQKRGWLAAGGIIGAIVASSCCILPLVLVLAGVSGAWIGSLTALDPYKPYFIVVTLAFIGAGFWHV
    YFKSEPPCEDGSYCAKPQSNIITQIALWVGLAIVLLAATIDWWAPFFY

    >gi|114570879|ref|YP_757559.1| mercuric reductase [Maricaulis maris MCS10]
    MKDCCSDGNNGEYDIAVVGAGSAGFSAAITAAEAGARVAIIGHGTIGGTCVNVGCVPSKALIRAMEAAHSGAAARRFAGV
    SVASRVDDWPAVQAQKDALVSGLRDKKYEALLPEYENIDYIETKAPARLVEGGVAFDGRAIRAAKIIIATGSSSSIPPIP
    GIENVQTLDSTSALELDRLPESMIVIGGGVIGCELGQMFARAGVHVTICCRTRLIPEAEPEISAALQASFEAEGITVCSG
    VGYQRIEQSSSGVQLHCETTGGTDVVVAQSVLIAAGRRPNTQHLGLGDVGVETDARGGIAVDLLMRSSNPSIYAAGDVTG
    RDQYVYMAAYGAKLAAKHATSQPVKPYDNRAMPWVVFSDPQVAGVGFTAAAAEAAGYDVKTSVAPLDQVPRALAAADTRG
    LIKLVADRKTDELLGAQIMAPEGADSIQTLVLALKFGMTTKELGDTIFPYLTTVEGFKLAAQGFDKDVAKLSCCAG

    >gi|114570920|ref|YP_757600.1| redoxin domain-containing protein [Maricaulis maris MCS10]
    MKMSPIGLGILGMTVLAIGWFLYVMVSGASKGETGPLDSYAHGEMRAFVSIDDAPAQPDLVYRDGDGGEVRLSDYRGQVI
    LVNYWATW
    CGPCVEEMPALSGLQAELGGEQFQVVTVTLDRSIEDAREFLTRMELDNLPLIHDETFSSPNRVRAIGLPMSI
    LYDGLGREIGRVPAPAEWNSDDAHALIRAAIRRNI

    >gi|114571352|ref|YP_758032.1| dihydrolipoamide dehydrogenase [Maricaulis maris MCS10]
    MSDTYDIVIIGGGPGGYNCAIRAGQLGLKTACVEMRGTLGGTCLNVGCIPSKALLHASELYEVAGSQFANLGIKTGAIEL
    DLDAMLGQKDEAVDGLTKGIEFLFKKNGVEYIRGRGRIAGPGKVEVDAEGGKSTLETKNIVIATGSEVTPLPGVTIDEKR
    VVSSTGALALEQVPDKLVLIGAGVIGLELGSVWRRLGAQVTVVEYLDRILPGMDSELAKTAQRTFAKQGMDFKLGTKVTG
    VDTSGDRLGVTLEPAAGGEAETIEADTVLVCIGRRPFTDGLGLETVGIETDQRGFIANDQYRTSAENVWVVGDCTHGPML
    AHKAEDEGVACAERIAGKAGHVNYGVIPGVVYTAPEIASVGLTEDELKKSGRKYKKGKFPFQANSRARTNHATDGFVKIL
    ADAETDEILGAHMIGANVGEMIGELCVAMEFRAASEDIARTCHPHPTLTEAIRQAAMGVEGWTMQS

    >gi|114571396|ref|YP_758076.1| redoxin domain-containing protein [Maricaulis maris MCS10]
    MQTIRIAAWLALIGLVAALGWRFWDDRSAPVPIPMPALTTTPLEGRESFDAALVDGVWLLNVWGSWCAPCHAEHPVLMAL
    RSEGIAIYGLNWRDTPEAANQFLDVLGDPFVGVMQDDNNQSVRALGIEGAPETLVIANGEILARWPGPLTPDALRQVIYP
    ALDRALRN

    >gi|114571422|ref|YP_758102.1| arsenate reductase [Maricaulis maris MCS10]
    MTDSTIIWHNPRCSKSRQTLALLEARGGDLEVRDYTEDMPSVAELKAVMKKLGFVSAHEWLRKAEPDYRELGLKAIEDEE
    ALFKAMAKYPKLIERPVVIHGDRAMIGRPPEQVLELF

    >gi|114571426|ref|YP_758106.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Maricaulis maris MCS10]
    MLGIGEKLPDFEIVGVKPGFNAHEENGESAFEPINQESFDGKWKVIFFYPKDFTFVCPTEIVAFANLAEEFADRDAVIMG
    GSSDNEFCKLAWRREHPDLDKLGMWQFADTTGSLIDSLGIRSEEGVAYRATFIVDPHNVIQHVYVTNLNVGRNPEDTLRV
    LDALQTDELCPCNRPVGGDTL

    >gi|114571427|ref|YP_758107.1| alkylhydroperoxidase [Maricaulis maris MCS10]
    MSIDALKNELPEYAKDLKLNLSSLGRETELDDQKKWGTFLASAHAVGEPKTLAAIKAEAETRLSDEALTAAKAASAIMGM
    NNVYYRFVHLSKNKEYATLPAKLRMNILANPGVDKADFELWSLAVSAINGCGL
    CIDSHEAELRKHGLTTTQVQAAVRIAA
    TVNAIAAVLAAES

    >gi|114571477|ref|YP_758157.1| thioredoxin [Maricaulis maris MCS10]
    MTPDKNKDCSMTLIGGTGDNEIDSNDLVRDSSDQTFMQDVIEPSREVPVIVDFWAPWCGPCRQLGPLIAKCVMEAAGAVR
    LVKINIDENPGIAQQLRVQSIPAVFAFKDGQPVDGFTGALPESQIKDFIARISGKGPSEAELRALVDRALASIEAGDLNG
    ASQDLAAVLQADPGHPGAIGSLVRLWIKAGDTDKAASILAQVPADRADDPAIDGARAALELATGAPVDDAETAALRQAVA
    ADSSNFQARYDLAEALLTGGDHKGAVDQLIAITALDREWNEQAARTLLLKVFEAAGPASDVTRDGRRRLSAILFS

    >gi|114571532|ref|YP_758212.1| AraC family transcriptional regulator [Maricaulis maris MCS10]
    MTAELYTLDASSKDYHRIAGALAFLGDNWRDHPDLDRAARAAGLSPHHFQRVFTRWVGVSPKKFVGALAHDTAREALEDG
    ACMLDAAFEAGLSGPGRLHDLFIAHEAVTPGDAKRRGAGLQFTWGVAPSPFGDAVMLVAPRGLSAMAFADPDVESGFADL
    EARYPAAEYTRDDTVARQWAERIFTPTGPEKLPLALYGTPWQRQVWRALLTIQPGETTSYKSIAEHVKSPKASRAVGAAV
    GANPISWLIP
    CHRVLASNGKLTGYHWGVERKRAMLAYETARG

    >gi|114571604|ref|YP_758284.1| UBA/THIF-type NAD/FAD binding protein [Maricaulis maris MCS10]
    MTSEIDIDRFARHLVLKEIGGPGQQALARAHVAIVGAGGLGAPAALYLAAAGVGTISLIDADTVTVDNLQRQIIFRTRHI
    GSAKAKTGARELRALNPGSRVRAIVKALDDENAKRLIGKADLVLDGCDNYETRFAVNAACLAGGKPLISGAVGRWDGQVS
    LFNARPDAPCYRCWVPETPPDVET
    CEQVGVVGALTGIVGSMMALEAIKHICGAGQTLDGRIKLFDGLSMDSRTVTLDKDP
    ACPTCGG

    >gi|114570725|ref|YP_757405.1| glutathione S-transferase-like protein [Maricaulis maris MCS10]
    MYTLYFHPYSQHSRRVVALLDACRLPYEPRLVALENGEHMSDAYLAVNPNHQVPTLVDGDLVLHESTAILRYLCNRHRLD
    DWYPTGLGRRAMVDQWTDWGQSRMAPAVFDIVFNSVFAAPDARDLDAVKLGKTVMTELVPLMETALGEANWIAATPGPSI
    ADLVLGSNITQLGLAGWRPAGGRIKAWYARLCEVKAFADTLPVELEAV