Mannheimia succiniciproducens MBEL55E uid58197

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|52424210|ref|YP_087347.1| AHP1 protein [Mannheimia succiniciproducens MBEL55E]
    MSNMEGKKVPQVTFHTRQGDAWVDVTSAQLFDNKTVVVFSLPGAYTPTCSSSHLPRYNELTPEFKKLGVDDVICVSVNDT
    FVMNAWKCDEDADNITVLPDGNGEFTEGMGMLVDKEELGFGKRSWRYSMLVKNGVIEKMFIEPNEPGDPFKVSDADTMIK
    FIKPDWEPKPSVALFTKPG
    CPFCAKAKALLTEKGYPFEEIVLGKDATVTSVRAMSGRATFPQVFIGGKHIGGSDDLEAYF
    ANK

    >gi|52424319|ref|YP_087456.1| thioredoxin-dependent thiol peroxidase [Mannheimia succiniciproducens MBEL55E]
    MNTLKIGDFAPHFSLSNQHNETVSLTDFQGKKVLVYFYPKALTPGCTTQACGLRDAKAELDKSGVVILGISPDSPKKLAQ
    FAEKKELNFTLLSDENHQVAEQFGVWGEKKFMGKIYDGIHRISFLIDEKGVIEQVFTKFKTGEHHQVVLDYLTQNS

    >gi|52424360|ref|YP_087497.1| Na(+)-translocating NADH-quinone reductase subunit E [Mannheimia succiniciproducens MBEL55E]
    MEHYISLFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLGISVPVNQLVYTHILKDGALIEGVDLSFLNF
    ITFIGVIAALVQILEMFLDKFVPSLYEALGIFLPLITVN
    CAIFGGVSFMVQREYNFPESVVYGIGAGTGWMLAIVALAGL
    TEKMKYADVPAGLRGLGITFITVGLMALGFMSFSGIQL

    >gi|52424361|ref|YP_087498.1| Na(+)-translocating NADH-quinone reductase subunit D [Mannheimia succiniciproducens MBEL55E]
    MAGSNLKKLLLSPIADNNPIALQILGICSALAVTTQLQTAVVMAIAVSFVTGFSSFFISCIRNYVPNSIRIIVQMAIIAS
    LVILVDQILRAYAYDLSKQLSVFVGLIITN
    CIVMGRAEAFAMKSGPVESFVDGIGNGLGYGAILLIVAFLRELIGSGKLF
    GVTVLETVQNGGWYQANGLFLLAPSAFFIIGFVIWGLRTWKPEQVEK

    >gi|52424397|ref|YP_087534.1| hypothetical protein MS0342 [Mannheimia succiniciproducens MBEL55E]
    MNSPQKSSNAKFWAICTTALTAAVASTLCCIGPLIYLAFGLSSAWLMDLSEYSYLQIPMLIISLVTFSYGFWLLNFSDKI
    ICTKYLSRRTLQILYWIMAPVILFFLSYPYVLPYILELLE

    >gi|52424484|ref|YP_087621.1| disulfide bond formation protein B [Mannheimia succiniciproducens MBEL55E]
    MLSFFKTLSMGRSGWLLLAFSALVLELVALYFQYGMQLQPCVMCVYERVALGGILFAGIIGAIAPSSWFFRFLGIIIGLG
    ASVKGFLLALKHVDYQLNPAPWNQ
    CAYLPEFPQTLPLDQWFPYLFKPIGSCSDIQWSFLGFSMAQWILVMFAFYSILLAI
    ILISQVKAGKPKHREIFR

    >gi|52424662|ref|YP_087799.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
    MNKKLYLPLLIFLILVGAFFIQLRQNASGGDPKLLESALVGKPVPEKVMQGLFDNKDYTSEVFKQGKPILLNVWATWCPT
    CYAEHQYLNELAKQGITIIGVDYKDDSAKAVKWLKDLDNPYQLVLKDEKGSLALDLGVYGAPETFIIDGKGVIHYRLAGD
    VNEKVWKNTLLPIYNQLFEDGK

    >gi|52424692|ref|YP_087829.1| Ada protein [Mannheimia succiniciproducens MBEL55E]
    MDSIYYSYYSSPVGNLLMIAQQGKLTNLDCELEQTAPNPKWILNNELPLFRQVKSALDRYFSGEKEDFSDIPLNPQGTTF
    QQSIWQALRRIQLGKTTSYGELARLINNPKAVRAVGGAVGSNPISIIIP
    CHRVLGKNGQLTGFGGGLPMKRFLLNLEKIR
    YVDKGVEYVKQKLLKKYTA

    >gi|52424716|ref|YP_087853.1| Glf protein [Mannheimia succiniciproducens MBEL55E]
    MKKYDYLIVGAGLFGSIFAYEATKRGKKCLVIEKRDHIGGNCYTQNVEGINVHKYGAHIFHTSNKVVWDYIQQFAEFNRF
    TNSPIARYKDELYSLPFNMLTFNKMWGVITPQEAEAKIKEQIAQESITEPKNLEEQAISLVGRDIYEKLIKGYTEKQWGR
    KCTELPAFIIKRLPVRYTYDNNYFYDTYQGIPIGGYTGIFERMLDGIEVKLGVDFFTEREYYENLADKIVFTGMIDEYFG
    YQFGKLEYRSLRFDNEVLDMPNYQGNAVVNYTEAEVPYTRIIEHKHFEYGTQPKTVITREHSKEYEEGDEPYYPINDARN
    NELYAKYKELADEKSNVIFGGRLAQYKYFDMHNIIAEALECVNAHFR

    >gi|52424727|ref|YP_087864.1| ArsC protein [Mannheimia succiniciproducens MBEL55E]
    MITVYGIKNCDTVKKALKWLTDNNIEHKLHDYRTDGLDPEFLINAEAQFGWQTLVNKRSTTWRNLDSQIKENMEKHTALS
    VLAEQPTLIKRPIILQDGIALIGFNIKEYKKAFG

    >gi|52424810|ref|YP_087947.1| glutaredoxin 1 [Mannheimia succiniciproducens MBEL55E]
    MFVVIFGRPGCPYCVRAKNLAEKLKNSLDDFDYRYVDIIAEGISKADLSKSVGKEVETVPQIFIDEKPIGGCTDFEALMK
    EQFNIVA

    >gi|52424943|ref|YP_088080.1| ZntA protein [Mannheimia succiniciproducens MBEL55E]
    MQQTVQIDDRAEQTTLMLEGMSCAACVRKVEKALLAVPEVAAAQVNLAENTALVYGNGDVELMLQAIENAGYHAEVVEDE
    NSRREKQNVQAEHEINQRKWQSIVALIVGFGLFFWGIFGGTTVATAENHWNWVMVGLIVLVTMLCTGWHFFERAWKNLLK
    GNATMDTLVALGTGVAWLFSMFISLTPDFFPDGSRHLYFESGVMIIGLINVGKMLEAKAKQRSSKALERLLDLTPKTTRI
    IDELGEREIPLKDVKTGMRIRLQTGDRVSVDGIVLQGSGWIDESMLTGEPIPVQKQEGDKISAGTLVTDGALQFRAEQVG
    NKTMLANIIRLVRQAQSSKPEIGQLADKIAGIFVPVVICIAVFAALIWYLVGPEPQISYALVVLTTVLIIACPCALGLAT
    PMSIIGGVGRAAELGILVRNADALQKASNVDTIVFDKTGTLTKGEPKVTALLTFNHFDESVALEYAASIEQGANHPIAKA
    VLSLAQEYNLNLEHEPEDFRTLKGLGVSAKVDQQNILLGNYTLLQQHNIDASAANRFFQTESEKGATVIFLAVNNVLAGV
    FAIRDPLREDSVEAIQRLHKQGYHLIMLTGDQEKTAQAIAKEAGIDQVIAGILPEGKANVIRQLQEQGGKVVMVGDGIND
    APALAQADVSIAIGSGSDIAIETSELTLMRHSIHAVADALALAKGTLHNMKQNLFFAFVYNVICIPVAAGVFYPLFGFLL
    NPMFGGAAMACSSITVATNANRLLKFQPKD

    >gi|52424972|ref|YP_088109.1| SoxR-reducing system protein RsxE [Mannheimia succiniciproducens MBEL55E]
    MEKEQSIWHDLLSQGLWRNNPAIVQLLGLCPLLAVSNSATNALGLGFATLLVLTCTNTMVSLFRKQIPHEIRIPIYVMII
    ATTVTAVQLLMNAYTYSLYQSLGIFIPLIVTN
    CIVIGRAEAFASKNSVLHSAFDGFAMGLGMTLSLFLLGALREVLGNGT
    LFDGIHLLLGDWAKPLRIEFFHNDSNLLLAILPPGAFLGLAVILALKNVIESRTK

    >gi|161510988|ref|YP_088114.2| Na(+)-translocating NADH-quinone reductase subunit E [Mannheimia succiniciproducens MBEL55E]
    MTDYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGLATTFVLTVASLCTYLADSYILAPLNASFLRTLVFILV
    IAVVVQFTEMVINKTSPTLYRLLGIFLPLITTN
    CAVLGVALLNINLAHNLTESVIYGFGASLGFALVLVLFASLRERLAA
    ADVPAPFKGASIALVTAGLMSLVFMGFTGLIRV

    >gi|52425006|ref|YP_088143.1| TrxB protein [Mannheimia succiniciproducens MBEL55E]
    MSDIKHSKLLILGSGPAGYTAAIYAARANLNPVLVTGLEQGGQLTTTTEIENWPGDFAETTGPELMQRMLQHAEKFDTEI
    VFDHINRVDFSSRPFKLYGDVQTFSCDALIIATGASARYLGLPSETEYKGRGVSA
    CATCDGFFYRNKPVAVIGGGNTAVE
    EALYLANIASEVHLVHRRDAFRAEKILIDRLYKKVEEGKIILHTNRNLDEVLGDNMGVTGVRLKDTQSENTEEIKIDGLF
    VAIGHAPNTAIFADQLELNNGYIVVKSGLNGNATATSVEGIFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDALEA

    >gi|52425059|ref|YP_088196.1| molybdopterin biosynthesis protein MoeB [Mannheimia succiniciproducens MBEL55E]
    MSELTHAEELRYNRQIVLKSVDFDGQETLKDSKMLIVGLGGLGCAASQYLAAAGIGHLTLLDFDTVSLSNLQRQVLHNDE
    RLDMPKVESAKIALQAINPHIEINTINGLLSEEKLAEIIPHFDLVLDCTDNVAARNQLDLCCRQAKVPLISGAAIRMEGQ
    VSVFTYEPGTPTYGHLSRLFGENALS
    CVEAGVLSPIVGIVGSIQALEAIKVRLKIGKNLCGRLLMIDGLNMSIREIKIPS
    I

    >gi|52425074|ref|YP_088211.1| DsrE protein [Mannheimia succiniciproducens MBEL55E]
    MQKLLFILNESPYGTEKTFNGLRHAVNLLEEHGKEVEVKVFCFSDAVLAGLSGQNPNDGPNVQQTLEVLAGLGAEVKLCT
    SCTKARGITQLPLVKGVSLGTLDDVSDWTLWADKVINF

    >gi|52425107|ref|YP_088244.1| glutaredoxin 2 [Mannheimia succiniciproducens MBEL55E]
    MKLYVYEHCPFCVRARMIFGLKNLPFEQEVLSNDDEATPTSLVGKKVVPILVKDDGTAMPESLDIVKYVDENFGDKLLTE
    QIRPELEVQLKQIGSYYNHLLLPRFVKLGLAEYNTQSALNYFIQKKTKSIGDFAENLANTPQYLDKLNRDLTLLDNLILA
    QDKVNGEQLSVEDIILFPMLRNLTCVKGVIFPTRVKNYVDCMAKMSKIDLFYGNAV

    >gi|52425137|ref|YP_088274.1| hypothetical protein MS1082 [Mannheimia succiniciproducens MBEL55E]
    MIAFGYITALSLSYFLLAPDFKGLSFTEYFIQSEAKPIFLTLGLLLPIGFIVMSKAVEYGGIVRTDAAQRLALFLQIIAA
    VILFGETLNNMRVGGVIVAFFALFCLLTKPTKSIENALKAVFALAAVWLIWGVTGILFKKIALMGGAFPTTLFVTFSIAA
    VLMFTYLLIKRTFWNASSLVGGIILG
    CLNFGNILFYIYAHQYFKENPTIVFATMDIGVICLGMIVGALVFKEKISKINML
    GIVLGITAILLLRV

    >gi|52425195|ref|YP_088332.1| SseA protein [Mannheimia succiniciproducens MBEL55E]
    MNIKLTLIATAVALTLSACDDKSVKEIKTDELLKNLDNPEFVIIDGRSDSLYNGFKDGDAKRGGHIKGAVQFSCNWLAHI
    ADDKFEKFAKDKGLTKDKTLVFYDSNSEQLNCLSDKFAEKGYKVRVFKDYLSYANSDNPLEAFPNFEYSVSPEWVNAVIK
    GEKPESYQNDDFIVFHVGWGPVEKSEEYKQHIPGAFHFNTDWVENDPVWNLSDPKIIEQNLLNAGINKDKTIILYSDNQL
    AAYRIFWALKWAGVKDVRVLNGNLTTWTKAGFATETAVNTPTPVSQFGAEIPLNPQINISMPQEAIARQKQGLKLISNRA
    WDEYTGKISGYSYIPGKGEPQGAIWGFAGTDASNMADYYDVDGTLRNPKEIFALWKEQNINQGDPIAFY
    CGTGWRAGVSW
    FMTQLAGWDNAYVYDGGWNAWQMDSVFPVQKGAPNNMAKPDSKNDFGQK

    >gi|52425196|ref|YP_088333.1| SseA protein [Mannheimia succiniciproducens MBEL55E]
    MAGMVGDLDDYDRLLANISLSETDTMPHLRIFMKYTALFAIFSLFLTACNDNKVQPIDTAELLQNLNNPQYVIIDSRNDS
    LYNGFKDKHASRGGHIKGSIQFTCSWFDSIEAGKFDSFAESKGITKNKTLVIYDSNPDNLA
    CISAEFAAKGYKVRTFSDF
    ISYVNAGYPLESLLNFQYSVSPEWVYSVLQGEKPESYTNDDFMLFEVSWGALENAKAYTQHIVGAYHFDTDWVEGEAPVH
    NLLEPATIERNLLKNGITKDKTIILYSDNPLAAYRIFWALKWAGVEDVRVLNGNLSTWMDSGFPTETKVNIPQPVNNFGG
    HIPTNPQLSIAQPQQAYARQQQGLKLISSRAWEEYIGEVSGDDAIQATGEPQGAIWGFSGSAPSNVADFYDPDDTLRNPK
    EIEALWQELGIVQGDQLAFY
    CGTGWRASVPWFMTQLLGWRNTAVYDGGWNAWQMTELPVQKGAPTGLLKPDAKNDSGRML
    KKTNSCRG

    >gi|52425197|ref|YP_088334.1| hypothetical protein MS1143 [Mannheimia succiniciproducens MBEL55E]
    MLIGLFIGLLFGFFLQRGQFCFVSGFRIIYTQRNFRFLTALLIAVSIQSIGFFSLSGLDLITIPNTPMPLLATLIGGLLF
    GIGMVLANC
    CASGGWFRTREGAVGSWIALICFALTMAATQTGALKQWINPLLLETTTLDNIYNTFNLSPWILVTVLVLIT
    VVMIVYHIKHPRYQFPQEPTTALIPHRIFTKHWHPFTAAVWIGLLGVLAWLVSEQYGRSYGYGVAVPTANVVQYIVIGQQ
    RYLNWGSYFVLGILLGSFIAAKLSGEFEIRLPEPKAILQRMLGGVIMGIGASLAGG
    CTITNALVSTAYFSWQGWLATLMI
    MIGCWLTSVLVKPTQCRI

    >gi|52425267|ref|YP_088404.1| hypothetical protein MS1212 [Mannheimia succiniciproducens MBEL55E]
    METLDKIKKQIAENPILIYMKGSPKLPACGFSARAVEALINCQVPFGYVDILQHADVRAELPKYANWPTFPQLWVEGELI
    GGCDILLEMYQAGELQTLLKEVAERHKEQV

    >gi|52425354|ref|YP_088491.1| thiol:disulfide interchange protein precursor [Mannheimia succiniciproducens MBEL55E]
    MRNFLLFLILSLTTFVAHSGLFTGKPQFLKPHEAFILSANKQDAQINLHWKIADNYYLYKKELRITGENSKIGEIIYPQA
    DKHQDEFFGETEIFRHELFLAVPVNEQNAASRLEVTYQGCTKGFCYPPETTVLELASLPVGQESQTLTAQDSLSQNLLKS
    KYAVFGFFLLGIGLAFTPCVLPMLPLLSAIVIGQGKRASTGRSLLLSFVYVQGMALTYTLLGLIVAAIGLPFQVALQSPY
    VLVTLSAVFVLLALSMFGLFNLQLPSSLQTKLALFSQKQQSGALGGVFIMGMIAGLIASPCTSAPLSGALLYVAQTGDLF
    FGAITLYLLALGMGMPLVLITVFGNRILPKSGAWMEKVKTAFGFVLLALPVFLLARVLPGIWENLLWSLLTVSFFAWLSF
    SMPKGKLGRSLRILFLILAMIAVRPLQNFIWGDYSAPAGNPQSAVEKSEISSSTRFKQINNYAQLKQALTSNPKAIAMLD
    LYADW
    CVACKEFEKYTFSHPDVKHKFEQVLLLQVDMTKNSPENAELMEKLSVLGLPTIIFFDRQGNEIVNSRITGFLNAK
    QFLSLIEKYL

    >gi|52425362|ref|YP_088499.1| IscA protein [Mannheimia succiniciproducens MBEL55E]
    MTDMTIPLTFTDAAAKKVKNLIIEEENQDLKLRVYITGGGCSGFQYGFTFDEKVNDGDLTIENDGVKLVIDPMSLQYLIG
    GTVDYTEGLEGSRFVVHNPNATTTCGCGSSFSI

    >gi|161510977|ref|YP_088526.2| dihydrolipoamide dehydrogenase [Mannheimia succiniciproducens MBEL55E]
    MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVLVERYSTLGGVCLNVGCIPSKALLHVAKVIEDAKHVEHHGIVFGEPT
    IDLDKVREGKNAVVGRLTGGLAGMAKMRKVTVVEGLAEFADSHTLVAKDREGNPTTIKFDNAIIAAGSRPVQLPFIPHED
    PRVWDSTDALALREVPKNLLVMGGGIIGLEMGTVYSALGSQIDVVEMFDQVIPAADKDIVKIFTKRIEQKFNLLLETKVT
    TVEAKEDGIHVSMEAKDGKVETRVYDAVLVAIGRTPNGKLIGAEKAGIEVTDRGFINVDKQMRTNVPHIFAIGDIVGQPM
    LAHKGVHEGHVAAEVIAGKKHYFDPKVIPSIAYTEPEVAWVGKTEKECKAENLNYEVATFPWAASGRAIASDCADGMTKL
    IFDKDSHRILGGAIVGTNAGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEVFEGSVTDLPNPKAKKK

    >gi|52425576|ref|YP_088713.1| AhpC protein [Mannheimia succiniciproducens MBEL55E]
    MVLVTRQAPDFTSAAVLGNGEIVDNFNFKQHIAGKPAVIFFYPLDFTFVCPSELIAFDHRYEEFKKRGVEVVGVSIDSQF
    THNAWRNTAVDQGGIGQVQYALAADTKHEIAKAYGIEHPEAGVALRASFLIDANGVVRHQVVNDLPLGRNIDEMLRMVDA
    LQFHEQHGEVCPAQWEKGKEGMKDSPEGVAKYLKQNADKL

    >gi|52425593|ref|YP_088730.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
    MFSMKIKFCCYLFLVCLAPAVFAQKNTAGTHAAQAIASPGNRAAKNEFQDGQDYFSYSTPIHTENRRDGKILIQSFFDYD
    CRVCVNTLDILELYSKINPNKVVVEEYPIATKETTFSAQVYYSLKRMNHEDIAELLLFETTDIERYRELTKFENLLAYLK
    QQNVDEKLFTDIYQSAEIRRQVSEAIYRTEKYGVFTYPFVVIGGKYVLTNSTLYNDDYTFAVLDFLVHELSAVSTATHSK


    >gi|52425595|ref|YP_088732.1| DsbG protein [Mannheimia succiniciproducens MBEL55E]
    MKKFVTALSLMAISMAATADNAQITTQLKKLGATNIEVKDSPISGIKTVVTNEGVLYTTEDGKYVLQGKLFELTDKGPVD
    VTGKALLATLESYKNEMIVYPAKNEKHVVTVFMDIT
    CGYCQKLHSEIKEYNDLGITIRYLAFPRGGLGTKTAKEMEAIFT
    AKDPAFALDEAEKGNPPKELKAVNITKKHYELGVQFGVRGTPSIVTRSGELIGGYLPPKELLSALESVK

    >gi|52425681|ref|YP_088818.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
    MSEVLHATDASFEADVLRSDVPVLVDLWAPWCGPCRMVAPILDDLAAELAGKVKIVKINIDENQGTPAQFGVRSIPTLLM
    FKDGQLVGTQVGALPKNQLAAFVEKNL

    >gi|52425778|ref|YP_088915.1| IscA protein [Mannheimia succiniciproducens MBEL55E]
    MSVEQFSVEDAEQSSQSASIGMTESAAKHVKKCLESRGKGIGLRLGIKTSGCSGLAYVLEFVDELNSDDNVFEQHGVKVI
    VDTKSLVYLNGTQLDFVKEGLNEGFKFTNPNVKDQCGCGESFNV

    >gi|52425868|ref|YP_089005.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
    MKRKVFLFLPLIVLLVICIFLIMGLKQDPKKIASALIGKPVPEFFQADLLDNNRIISNKHLPKQPYLLNVWGSWCYYCQQ
    EHPLLMELAEQRIPIVGLNYRDKKQGALEMLTKKGNPFALVIDDSRGELAMKLGVDGAPETYVIDENGVIRYRYSGAVDK
    TILQKEILPEFNKLRN

    >gi|52426014|ref|YP_089151.1| ArsC protein [Mannheimia succiniciproducens MBEL55E]
    MSVIIYHNPRCSKSRETLKLLQDQNINAEIVLYLEKRFSVSELQSLMKKLNIHSPKEMMRIKDALYQELQLNNEHISEQE
    LLEAIGNHPALLERPIVINGDKAKIGRPPEAVLSIL

    >gi|52426040|ref|YP_089177.1| glutathione reductase [Mannheimia succiniciproducens MBEL55E]
    MTKHYDYISIGGGSGGIASINRAAGYGKKCAIIEAKHLGGTCVNVGCVPKKVMFYGAHIADAINHYAEDYGFDVSVNKFD
    FAKLVESRQAYIGRIHTSYGNGLSKNKVDVFNGFARFVDAKTVEVSYEDGSSEQITADHILIATGGRPSIPNVKGAEFGI
    SSDGVFALNELPKRVAVVGAGYIAVELAGVFNSFGVETHLFVRQHAPLRNQDPLIVDTLVEVLVQDGIQLHQKAIPQEVV
    KNADGSLTLKLEDGRETVVDSLVWAIGREPATDVINLQAAGVETNDRGFIKVDKYQNTNIPGIYAVGDIIEGGIELTPVA
    VAAGRRLSERLFNNKPDEHLDYNLVPTVVFSHPPIGTVGLTEPKAIEKYGAENVKVYTSSFTAMYTAVTQHRQPCRMKLV
    CAGADEKIVGLHGIGFGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|52426062|ref|YP_089199.1| FrnE protein [Mannheimia succiniciproducens MBEL55E]
    MKKIKIEMYSDYACPFCYIGKSHLEQALAQFEHADKVEIVHKAYELYPQTGETVTSTTQGRIEWKYHKTPEQALEMIRHI
    ENLAKRAGIAMNYENVQNTNTFKAHRLTKFAASKGKENEMYNRLMKAYFTDNLPLADRKTLLQCAEDVGLDLAETEAFLN
    SNDFADSVTADETQARHIGVRSVPFFVINGVEVAGSQPPARFLALLQQVYAANNM

    >gi|52426114|ref|YP_089251.1| TrxA protein [Mannheimia succiniciproducens MBEL55E]
    MALSNNFRFILRIYRMKKLFLACFAALATVTFQVQAADLTEGKQYEVLALEHSAQPEVVEFFSFYCPHCYSFEMQYKIPE
    KIKQAIPANASFKQYHVNFLGSQGENLTRAWALAMAIGAEDKIRAPLFKAAQANSLRSMDDIRQIFIDNGVTAEQFDGSI
    NSFAVTALVNKQTNLAEQFKVRGVPDFYVNNKFHINMEGLSHDNFVQDYVDTVNELLSK

    >gi|52426156|ref|YP_089293.1| OsmC protein [Mannheimia succiniciproducens MBEL55E]
    MKIFYHTSATATGGRDGHTRVDDGSIGFDLVGFQNESGKVGTNPEQLFAMGYAACFDSAMNHVAPTLNLKPTKSSTTVGV
    GIGQKPDGAFGLDLDITITVEGLSLEDAKTLINKAHEV
    CPYSNATRGNVDVRLHVNVIQSFDL

    >gi|52426238|ref|YP_089375.1| PspE protein [Mannheimia succiniciproducens MBEL55E]
    MFKEITPQQAWQLMIEENATLVDIRDEQRFTYSHAKGAFHLTGQSYGKFQIQCDFDDPVIVSCYHGISSRNVAAFLVEQG
    YDNIYSIIGGFEGWQRAGLPIETAY

    >gi|52426270|ref|YP_089407.1| PspE protein [Mannheimia succiniciproducens MBEL55E]
    MEEFMPMATEFAKNHTLLIAAWVAIFVIVIFQLVKSFTSKVKILSNAEATSLINNEDAVVIDLRSIDEFKRGHIAGSLEF
    IPTDIKNRNLGKLEQHKDRHVILV
    CANGFTARSSAQLLTKQGFAHVYVLNEGIMGWKSQNLPLVK

    >gi|52426338|ref|YP_089475.1| NapF protein [Mannheimia succiniciproducens MBEL55E]
    MMDRELPRRQFLRGGFLKSLQSETVKQQGFLGVRPPWTVAEAQFVADCTRCGDCIAVCETQILVKGVGDFPEVRFSRGEC
    TF
    CMKCVEVCRQPVFRPTEEAAWQHKVEIQTGCLANNQVECRSCEDNCERRAIRFKREIGSVAKPQIDLELCNGCGACLS
    VCPVLAIKVLTTSAGE

    >gi|52426419|ref|YP_089556.1| hydrogenase 2 protein HybA [Mannheimia succiniciproducens MBEL55E]
    MDRRKFIKAGMLGGVASALPLNAAHAEVKNQEPIPGALGMLYDSTLCVGCQACVAECQKINGTPVNPKGEQTWSNNDKLS
    PFTRNVIQVWSEGEGTNKDQPQNGYAYIKKQCMHCVDPNCVSVCPVQALTKNPKTGIVGYDPDICTGCRYCMVACPFDVP
    KYDYDNPLGQISKCELCNQKGVERIVQGKLPGCCHVCPTGAIIFGSREELMAEAKRRLSMTQGTDYEFPRQHVNSKDKYQ
    AKIPAYEQHIYGEIEGGGTQVLVLSGVPFENLGLPQLDEIATGARAAHLQHTLYRGMILPLVGLAGLTFITYRNMHGKKP
    EHHQEEDNNE

    >gi|52426303|ref|YP_089440.1| PspE protein [Mannheimia succiniciproducens MBEL55E]
    MFPVVSYLSIILMIKEFMMNITKITARQLQEKLAQGALLIDIRDADEYSHECIEQAVSQPLTGLKPEICNNSPCVIFHCQ
    SGMRTQANMALLAKASAAAAEVYILDGGLNAWKKAGFATVVNKAQPLPLMRQVQIAAGSLVLLGVILGYSVSPWCFLLSG
    FVGAGLIFAGVSGFCGMAVLLSKCPWNK