Magnetospirillum magneticum AMB 1 uid58527

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|83309106|ref|YP_419370.1| thioredoxin domain-containing protein [Magnetospirillum magneticum AMB-1]
    MDLIFNSGAQGAAGAAQNVPGDLIKDTTTATFVADVIEMSQKVPVIVDFWATWCGPCKTLGPALEKVVREARGAVRMVKV
    DVDKNQDLAAQLRIQSVPTVYAFKGGRPVDAFTGAQPESQLKAFVKKLMSGSNAGPTIDDYIAEAKRVLEEGDPQTAATI
    FNQILQEAPDNASAMAGLLRCLIAVGQTAQAESMLGRLAPEIARHPDITAVATALELARHAGGVGEAAELRRRLAADPDD
    HQARYDLALAYYAAGEVETAVDELLDLFKRDRAWNDDAARKQLVKIFEVLGFSHPLAKSGRARLSTLLFS

    >gi|83309297|ref|YP_419561.1| dinucleotide-utilizing protein [Magnetospirillum magneticum AMB-1]
    MDFTEEQIHRYARHIILPEVGGIGQAKLLGSSALVIGAGGLGSPVILYLAAAGVGTIGVIDDDDVELSNLQRQIIHRTSN
    VGAAKVASAAAAVADINPDVKVVPIRARLGKDNARDIFRDFQVIADGSDNFPTRFLVNDAARLEGKTLVSAAILRFDGQL
    STYRPGGPCYRCIYREAPPEGHVPT
    CSSAGVLGAIAGTMGAMQATEVIKELLGIGESLAGKLVIYDALSVAFRTVRVPRD
    PGCPLCGDHPTITDLSSHGSTANVCG

    >gi|83309316|ref|YP_419580.1| rhodanese-related sulfurtransferase [Magnetospirillum magneticum AMB-1]
    MTLVKTHRQLIDEANALITTIPTNEAIALHGDPGVVFVDIRDVRELEREGMIPGAFHAPRGMLEFWVDPTSPYYKEVFGQ
    AKRFVFY
    CQSAWRSALATRAVQDMGLAPVAHVEGGFKGWKDAGGPVGPKPEHKKGG

    >gi|83309378|ref|YP_419642.1| rhodanese-related sulfurtransferase [Magnetospirillum magneticum AMB-1]
    MTKPWPCWRWGGRCISDTSTSEVPMRILTTAALLLSLACPALAAEVKSISAPEALAALKKGEVVLVDIRQPEEWKQTGVP
    DGARLIPMRHPEGGAGFVRDLLAATKGDRNAPVALI
    CRTGNRSGATARALSDAGFTHVLDVSEGMAGSGAGPGWVKRELP
    MTRCPVC

    >gi|83309762|ref|YP_420026.1| thioredoxin reductase [Magnetospirillum magneticum AMB-1]
    MAHHHSKVLILGSGPAGCTAAIYAARANLEPMLVAGLQPGGQLTITTDVENFPGFAEAVQGPWLMEQMQAQAEHVGTRFM
    DDTIVSVDLSKRPFTAVGDSGDTYAGDTLIICTGATARWLGLESEKKFSGFGVSA
    CATCDGFFFRGKEVAVMGGGNSAVE
    EAIYLAGIASKVTLIHRRDTLRAEKIAQDRLFANPKVAVVWDSVIDEIVGDDNPPGVTGVRLKNVKTGALSVLPVDGVFI
    AIGHTPNTELFKGALEMDSEGYLITKAGATSTNIPGVFAAGDVQDKIYRQAVTAAGTGCMAALEAERFLTAHGHTG

    >gi|83309763|ref|YP_420027.1| peroxiredoxin [Magnetospirillum magneticum AMB-1]
    MSDTIQSPTSLVTKAAPDFTAPAVMPDNEINPAFNLKSYLAGSYGIVFFYPLDFTFVCPSEILAHDHRVKAFAERNTKVI
    AVSVDSHFTHLAWKNTPVDKGGLGNVQFPMVADLTKDIAKSYGVLLPGGVALRGTFVIDKNGVVQSAHVNNLPLGRNVDE
    ALRLIDALQFSEEHGEVCPAGWNKGKAGMKPNPNGVAEYLAKHASEL

    >gi|83309956|ref|YP_420220.1| transporter component [Magnetospirillum magneticum AMB-1]
    MNPIRLGGDSPLSEIALTTLVGSAGFAVGAVFGWAARASDFCTMGALSDMVFLGDRRRLRAWVLAMAVALLGSQALQAGG
    WINLDKSIYLGASLPWAGAILGGLMFGYGMTLAGG
    CGSKTLVRLGGGNLKSLVVVLVTGLFATMTLKGLLAMERIALEQA
    TNIAATRLGASGQSLPALLAGWGLPEAVGRPLAVAVLAGGALIWCLKDAAFRTAGSTLAGALVIGLTVPAGWAVTGILGA
    DDFDPVQLTSLSFISPMGDGLMYLMTYTGATISFGVAAVGGIVAGSFLAARLGGSFALEGFADTADLLRHLGGAALMGIG
    GIMAMGCTIGQGLTGLSTLSATSFLALASIILGGVIGLRSLDEGGLRGGLRSFLSR

    >gi|83310398|ref|YP_420662.1| rhodanese-related sulfurtransferase [Magnetospirillum magneticum AMB-1]
    MMHPNSDALVSTEWLASHLSAPDVRVVDASWYTPGQNRNAREEYDAEHIPGAVFFDIDEIADTDSTLPHMLPAPEKFSSK
    VRKLGLGNGNKIVIYDGSGFASAAARAWWMFRTFGHRDVSVLDGGFPKWLREGLPVEDLPPVPRTRHFISHYNHLLVRDL
    DHMKANLESKRELVIDARAPARFKGEAAEPRPTKHQGHIPGSVNVPFADLIDERTRCMLPTEQLKARFDAAGIDSKQPVT
    IS
    CGSGVTACTVALALHLVGHENVAVYDGSWAEWGNRDDTPIEK

    >gi|83310440|ref|YP_420704.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum magneticum AMB-1]
    MAVTTPACAEDWVAPDFALPGVDGRTWRLDDVRGARGTVVAFICNHCPYVVAIIDRLVRDADLLRKEGIGVVAISANDPT
    QYPEDSFDNMKVFARTHCFGFPYLFDESQEVARAYGAVCTPDFFGLDCLGRLRYRGRLDESGRQPGTPDARRELLDAMRL
    VAQTGRGPDKQVASMGCSIKWRDP

    >gi|83310491|ref|YP_420755.1| protein-disulfide isomerase [Magnetospirillum magneticum AMB-1]
    MPMIAKTFAAALMVSGLALASLPAAAQEVPLTPKQAEAVKKVVRDYLMEHPEVLGEALEALREKMRAQAEADAHKMLEAR
    KDEILKNADDPQGGNLKGDLTVVEFMDYN
    CGFCKQAFDPLWEAVKADGKTRVVIKEYPILGPDSVLAARVALVAKAQSQA
    KYDDVHRAFMKFRGRLDEKAIYKIAADQGFNAEQLKKDINGPEIEKALKKNMDLARSLEIGGTPTFIVGDRIISSALDQQ
    TLKQLMDAARRSAAKQGG

    >gi|83310662|ref|YP_420926.1| hypothetical protein amb1563 [Magnetospirillum magneticum AMB-1]
    MMNLTDKAIDVIREVCNGEYLGLRIMVNKSCSGFSYNMGLEENAAEDDQVLEFSDVKVFIDPGSALWLTGATMDYVDSSA
    MGSGFVFDNPNQPPAPTTTAGGGCSCAMKSCG

    >gi|83310676|ref|YP_420940.1| hypothetical protein amb1577 [Magnetospirillum magneticum AMB-1]
    MREGQAMALIVFYEKPGCMNNTRQKQLLAKSGHDVVALDIRAQGWSPDTLRPFFDGLPVAQWFNRAAPRVKSGAVVPEAI
    GADEALAEMCMDPLLIRRPLMESSGRRMAGFDEAAVDAWLGLAPAPEPLSETCPRSDGICSVPGR

    >gi|83310694|ref|YP_420958.1| rhodanese-related sulfurtransferase [Magnetospirillum magneticum AMB-1]
    MSFSEAGLIELEPTQVKALLDAGEAVLVDVREDDEFAEEHIEGAVLVPMSDFEVETWPSFPGRKVIISCLGGVRSAAVAR
    KLIAAGQGWAVHLKGGLNAWRDCGLPTVAGA

    >gi|83310705|ref|YP_420969.1| glutaredoxin-like protein [Magnetospirillum magneticum AMB-1]
    MAEIEIYTTDVCPYCVKAKKLFAKKGVAYTEINVSTDDGLRQYMTNRAGGRRSVPQIFIDGVHVGGCDDLYALDKDGKLD
    PMLAGVQ

    >gi|83310765|ref|YP_421029.1| glutathione reductase [Magnetospirillum magneticum AMB-1]
    MAAYDYDLITLGAGSGGVRASRMAAAAGRKVAVVESSRVGGTCVMRGCVPKKLLVYGAKFAEDLTDSLGFGWSLEGADFD
    WARLVVAKNAELQRLEGVYLRLLKESGVTVVEGKGHLLDAHTVQVGLRVLTAETILVATGGRPALPDVPGIEHAVTSNEA
    LDLMQLPEKVVIVGGGYIAVEFAGIFNALGVAVTLVLRGDTLLRGFDADIRATLAEEMTRKGVDLRTTTQVRAIRRHGHG
    YGVELSDGQTLDADLVMYATGRVPNTEGLGLEKAGVVLNSKGAVMVDGLSRTSVRNIWAVGDVTDRVNLTPVAIAEAMAF
    VRTAFSGQTTPMDYENIPSAVFSLPPVGTVGLTEAEATKRYGAVDVYLSRFKPMRNILAGREERSMMKLVVDRATDRVLG
    VHMVGADAPEIVQGFAVALKCGATKAQFDATVGIHPTAAEEFVTLRDKRAENGRA

    >gi|83310906|ref|YP_421170.1| cation transport ATPase [Magnetospirillum magneticum AMB-1]
    MGHESDVEDTVMTSQSLSLPVKGMTCAACSTRLERVLGKVDGVEQALVSLAAERADIRFDGERARPEDLVSAIVKAGFQA
    DLAQSGDEDLDREEAEHAEESARHLRLLMLSALLTLPLIGQMVLDMAGLHIMIPPLIQLALAAPVQFWIGARFYTGAWAS
    LKGGAGNMDVLVVLGTTAAFGLSAWHVAAGDAHHGNLYFEGASVVITLVLLGKLLEGRAKRSAAGAIRALMRLKPDTARV
    ERDGLVIEVPAALVAVGEVVLVRPGERAPVDGTVVDGESQMDESLITGESLPVPRGPGDEVVAGAVNGEGLLRVEATRVG
    AQSTISRIIRMVQGAQAAKAPVQKLVDRISNVFVPVVTVIAALSFLGWWLIGGNLQVAFVAAVSVLVIACPCALGLATPT
    GIMVGTGLAARHGILIKDAEALELAHKVQVMVFDKTGTLTEGHPAVAAITAADGNGPELLRLAASAQQGSEHPLARALLS
    AATGGLAPLGSFRSLPGRGLEAEVEGSSLLIGSRRLMTERSIDPGTLADAAEAEEAQGRTLMWVAEGARMLGFIAVADPI
    KASAADAVARLRRLGIETVMLTGDNARAAQAVARAAGVDRVLAEVLPEDKEAEIRRIKESGKVVAMVGDGINDAPALAAA
    HIGIAMGTGTDVAMQAAGITLVKGDPSRLPEAIAISRATTSKIRQNLFWAFAYNVVAIPAAALGLLTPVIAGAAMAMSSV
    SVVSNSLLLRRWRMT

    >gi|83310909|ref|YP_421173.1| copper chaperone [Magnetospirillum magneticum AMB-1]
    MSATYRVTGMSCGGCSKSVTSAIQEITPGAKVEVNLEAKAVTVEGADEAQVRQAVDAAGFGFEGRV

    >gi|83310930|ref|YP_421194.1| arsenate reductase and related protein [Magnetospirillum magneticum AMB-1]
    MSSEITIYHNPACGTSRNTLGLIRNSGEEPRVVEYLRTPPTRDELVGLIARMGIPVRDLLRKKGTPYADLGLDNMALTDD
    QLIDAMMAHPILINRPIVVTPLGVKLCRPSELVLDILPQPQKGAFTKEDGEQVVDGQGKRIL

    >gi|83311052|ref|YP_421316.1| peptide methionine sulfoxide reductase [Magnetospirillum magneticum AMB-1]
    MSLWGPSKTVMVSADKALPGRASEIRVPERHYVLDTLLKPPFPVGMEVACFGMGCFWGAERLFWKTGGVYSTSVGYTGGF
    TLNPTYEEVCSAQTGHTEAVLVAFDPAEVSYTALLRLFWEGHNPTQGMRQGNDIGTQYRSAIYWTTPEQQAAAEASAKAY
    GEALRRAGFGAITTEIAPAGRFYWAEGYHQQYLAKEPGGYCGLGGTGVRYG

    >gi|83311216|ref|YP_421480.1| glutaredoxin-like protein [Magnetospirillum magneticum AMB-1]
    MNNPVFDRIRQDLSENDVVLYMKGTPMFPQCGFSAAVVQVLTNLGVKFKGIDILVDPSLRDGIKQFTNWPTLPQLYVKGE
    FVGGCDIVREMAESGELKQLMTDKGVATA

    >gi|83311270|ref|YP_421534.1| rhodanese-related sulfurtransferase [Magnetospirillum magneticum AMB-1]
    MLSRLFGLSSSPASDKVHVVDPSQIRLWWEAGSVVLVDVREPDEHAAESIAGSINLPLSTFDPARMPEIGDGKRLVIHCR
    SGVR
    CGTATEKLLAAGWQGEIHRMQGGILGWKATGGPTAPRR

    >gi|83311272|ref|YP_421536.1| NAD(FAD)-dependent dehydrogenase [Magnetospirillum magneticum AMB-1]
    MTAPLSRRAVLGGGAALLAAPAFLXGPAPEAKTASVVIVGGGFGGATAARSLRRAMPDLRIVLIESTPVHVTCPGSNGVI
    GGLGELSRLEHGYDQLRSWFGIEVVHDSVAAIDGERRRVRLAGGGVVAYDRLIVSPGIDLRWNDIEGYDEAAAAIMPHAW
    KAGAQTALLRRRLEAVEDGGVVIIAAPGNPFRCPPGPYERASLMAWHLSRTRKGCKILVLDAKDSFSKQALFQEGWKSLY
    GDMIEWVSGANNGRVVRVNAAEGWVETDFDRFTPALANIIPPQGAGRIAQAAGLADASGFCPVDPATFESRQAPGIHVIG
    DACVAGEMPKSASSANGQAKIAAAAVVASLAGRGASNAKAINVCYSLLAPDYAISVAGVYEASNGRRVAVPGSGGVSPLG
    ADAHLRKAEAEYASGWYAGICADAWGG

    >gi|83311317|ref|YP_421581.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum magneticum AMB-1]
    MSDRILILVALSLIIAMVAGTAIQIRKPQPTPILVKESMRRPDYAIPLDNPMTTDMAGVTVPFLSRITKPTVVNFWATWC
    IP
    CVRELPLFAKFKPIAEAAGIQVLTVNVDKEGAPVAKKFLEERGIADMPMILDPDGSVSKVLKVRGMPTALLVNAKGEE
    TARMEGEADWAGPGVIDVVRELLALPSHPVMAK

    >gi|83311420|ref|YP_421684.1| dihydrolipoamide dehydrogenase [Magnetospirillum magneticum AMB-1]
    MAENSFDIIVIGGGPGGYVAAIRAAQLGMNTALVEREHLGGICLNWGCIPTKALLRSAEIYRNMQHAESYGLSAPGATFD
    LAKIVARSRGVSAQLQGGVKHLLKKNKVTVIEGTAKLAGGSKVAIEGKPTISAPHIILATGARARILPGFEPDGKFIWTY
    KEALVPDTMPKRLLVIGSGAIGIEFASFFNALGAQVTVAEAMDRVLPVEDAEISAMAQKSFEKQGMKILAGANIKGLKKN
    AVDVTVTIEAGGKTHEVTVDRIITAIGIVGNVENVGLEATKAKVERTHVITDEYCRTGEPGLYAIGDIAGAPWLAHKASH
    EAIICVEKIKGLPDVHPLDMRKIPGCTYCHPQVASVGLSEAKAKEKGYAVKVGRFPFMANGKAIALGETEGMIKTVFDAK
    TGELLGAHMIGAEVTELIQGYVVAKTLETTEAELMHTVFAHPTLSEMMHESVLDAYGRAVHF

    >gi|83311562|ref|YP_421826.1| polyketide biosynthesis dithiol-disulfide isomerase [Magnetospirillum magneticum AMB-1]
    MRIEYVFDTVCPWCYVGKRRLERALAQRPETRARIIWRPFLLNPDLPPEGIDRRTYLDRKFGGSARVQRVHAAVAAAGKT
    EGIEFDFESITRMPNSLNSHRLIRYAGASGREGELVEALYQAYFSQGLDIGDVEVLTSLGATIGLEREALHAFLTSDADA
    ASVLNDNARAHRLGVNGVPCLILDSSYALAGAQEPDILLRLIDIVRESQPEAAFS

    >gi|83311630|ref|YP_421894.1| hypothetical protein amb2531 [Magnetospirillum magneticum AMB-1]
    MAEAEHNYAARVSVTESAAERVQTLIKMEGKPNMMLRLGVSGGGCSGFSYGISLDDTVNDDDRLFSEFGITLVVDQTSLD
    MLDGSVVDFVEDLSGSSFQVKNPNATSTCGCGSSFSV

    >gi|83311712|ref|YP_421976.1| NADH:ubiquinone oxidoreductase [Magnetospirillum magneticum AMB-1]
    MQHYLLLIISAALVSNVVLMRFLGLCSFMGVTTRVDTAVGMGAATTFCITVSAMLDWGLEHFLLEPYELGYLRTVAFILV
    IAAAVQFTEAVVRKVSPAMFQMLGIYLPLITTN
    CAVLGVNLLLVEGKMNFIESTLFALASSLGYSLVMVLFAGLRERIAL
    NAVPRLFAGPPIGFITASLLALAFMGFSGMSTN

    >gi|83311717|ref|YP_421981.1| SoxR-reducing system protein RsxE [Magnetospirillum magneticum AMB-1]
    MSASYGRIIKDGLWENNGVLCMLLGMCPTMAMTGTATNGLGMGLATAAVMAASNLMVAMFRNYVTHEVRIPVYILIVAAN
    VTFVDLGMNAWMHELYKVLGLFIPLIVSN
    CLPLARLEAFAAKEPVLPSFLDGLFMGLGFTLALTAIGAVREMIGQGTLFA
    DAALLLGPWAKLLELRVMPADWGILVLILPPGGFLIAGLMVVAKRLVDLAGGKEIKMAGAHSV

    >gi|83311783|ref|YP_422047.1| peroxiredoxin [Magnetospirillum magneticum AMB-1]
    MTTALGTPAPDFAMECDDGKTALADYKGKPLVLYFYPKDDTSGCTSEAKAFRDAMAEYQAAGVEILGVSKDSVASHAKFR
    TKHELPFRLGSDPDGAVCEAYGVWKKKSMYGREYMGIERSTFLIDKDGVLRAEWRKVKVTGHAEAVLKAAKGL

    >gi|83311848|ref|YP_422112.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum magneticum AMB-1]
    MVKRIVAAVLLMLVAAMPAQADPRPFSRGSWQSLLQAHAGRPVAVHFWSLTCAPCLVELPQWRDTAKASGLDVVLVSTDP
    PEDWPKVERTLKRAGLDKVESWAFADSFVEKLRFEIDRNWAGELPMTVLVSATGTSESRTGAVRRQDVESWLGH

    >gi|83312010|ref|YP_422274.1| cation transport ATPase [Magnetospirillum magneticum AMB-1]
    MEAIQVVHQLRRRVRVVVPALKGEAERLCLLEILLRKHAAIGEVRVVPALASLAVRFDPRRMPAENLLRLLDTVAGNVAR
    APRQKPPPPALGDDSQQAEVSVAVEGMT
    CASCAALIQMSLNRDPAIRSANVNYATATATVVGTLDRPALEARIGALGYEA
    RPMDTLSQRRMIVERERRHVQDAKRRAVVACLLSLPVMVIGMAMPRSRFWHVVEFALTTPVVLGAGRPFFSRAAKLAKSR
    AANMDTLIALGSGAAYGHSVASLLAGRHHLYFEAAAGIVSFVLLGRWLEERAKGKAGDAIRRLLDLQPPTATLVRDEVEV
    VVPVDDLVVGDILVVRPGERVPVDGTVTGGRTTLDESMVTGESMPVVKGPGDGVIGGCINGAGSFRMRATAVGQDTVLAG
    IVRMVDHAQAAKLPVQRLADRVSSVFVPGVVAVAGVTFATWLAGGARVSTALGNAVSVLLIACPCALGLATPTAIMAATG
    QAARRGIYIRNGEALETASKLGVLVFDKTGTVTEGRPVVSHFSARPGFDPDQVLALVAAAEAGSEHHLGRSVVDYARSRG
    IEPSSAEEFMAEIGRGIRARVGRHVVQVGSAAFLAEEGVGVDQLPSLDGQTPVLAAIDGKFAALFAISDRPRPTSAAAIA
    RLHEMGIRTIMVTGDVEAAARHIAAEVGIPEVVAQASPSRKQEIVAELRAAGEAVGMIGDGINDAPALAAADVGFAIGTG
    TDVAIEAAPVTLVNGDIAKVAEMIELSRKTMRIIRQNLVWAMGYNTIAIPGAALGELSPMVASSAMALSSVSVVTNSLRL
    QKDR

    >gi|83312013|ref|YP_422277.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum magneticum AMB-1]
    MRAFRLLAVLLLLAGCGEEGGKAPHVGDAPPAFKLSALDGAVVDYPAQLSGKVVVVRFWATWCPFCKDEMKMIQAVWSQS
    RDRGFEVLAVNAGQDKGDIDGFVAKLGVTYPVLLDPGSKVTRQYGVTGLPMTLFVGRDGRIKGRILGETDEATFRRKLEE
    LL

    >gi|83312023|ref|YP_422287.1| NAD(FAD)-dependent dehydrogenase [Magnetospirillum magneticum AMB-1]
    MARRYVIVGGGPAGVIAAETLRHQDASGSVTLVCGEPGPPYSRMAIPYAMAGKIDEAGTWLRKDWNHYEALGIRLLHDRV
    ATVEPAAKRVRLAAGGELSYDALLIATGSSPARPRIPGLDLPGVHS
    CWTLEDLRRIDPMLQPGRRVLLLGAGFVACIILQ
    SLVQRGVKVTVSCGASGRMVRSMMDETAGGMIMRWCRAKGVEVLTAGRPTAIEQRDTGLRITLDSGKTTEADLVIVGTGV
    KTNTAFLDGSGIAVDDGIVVDQYLRTSVDGIWAAGDVAQGFNCCTGLREVHAIQPTAVEHGRIAAMNMSGIPTEFGGSLS
    MNTLETLGLISCSFGQWMGRDGGEQVRVVDEDHFRYLRLEFFDGRLVGANTVGMTNEIGIIRGLIQTRLRLGAWLERLKR
    DPSRLAEAYVACAQGV

    >gi|83312125|ref|YP_422389.1| hypothetical protein amb3026 [Magnetospirillum magneticum AMB-1]
    MAPAPMTITDAAAERVKVLLEKRGKPSVGIRIGVRSKGCSGMSYTLEYADEKTQFDEILEDKGVTVLIDPKATMFILGTE
    MDFVEDKMQSGFVFKNPNEKGRCGCGESFHV

    >gi|83312187|ref|YP_422451.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum magneticum AMB-1]
    MKRRAFILSAAALAAMRTLPARAASKSLRGLVIHDRPQPVPAIEIRDAESRPAGLDTLKGKPILLNLWASWCMPCVAELP
    ALDRLKPALGAKGVALVALSLDRGGKVAVTNTFARLGIKNLDIRTDENRVAAEKLDAPALPVTLLIDAEGREVARFIGAA
    EWDGPQAARLMDALAAGSRLTPDMAPPPVRLGTAP

    >gi|83312402|ref|YP_422666.1| redox protein, regulator of disulfide bond formation [Magnetospirillum magneticum AMB-1]
    MVTKLEKILYTAKAHTTGGRDGRSVSDDGLLNVKLSPPKAMGGAGDATNPEQLFAAGYSACFMGALKFVAGVKKITVPAD
    AAIDASVSIGPIPQGFGISAQLVISLPGMDRQVAQELLEAAHQV
    CPYSNATRGNIDVVLILA

    >gi|83312458|ref|YP_422722.1| hypothetical protein amb3359 [Magnetospirillum magneticum AMB-1]
    MMLKDWNELANGLSKMVGQVRGGVPEVMKGFSAMAKAATADGALDGKTKELIALALGIAARCDGCLAFHAKAVVDLGGTR
    DEVMETIAMSVYMGGGPSLMYGALALEAYDQFAAKKQAAE

    >gi|83312468|ref|YP_422732.1| intracellular sulfur oxidation protein dsrE [Magnetospirillum magneticum AMB-1]
    MKFAILVNEGPYNHQAADSAFQFCKAAIDKGHEIFRVFFYYDGVNNATSLGQPPSDDRNVTKNWQKLAEENKVDLVVCVA
    AGLRRGITESNLAQGFRISGLGQLIEAGIHADRLVTFGD

    >gi|83312481|ref|YP_422745.1| Thiol:disulfide interchange protein dsbD 1 precursor [Magnetospirillum magneticum AMB-1]
    MAWLKSIGAWIKAIGIAATLMLTGLSAWAAEPGGSDWATSESGKVRLVSAATATGESGQLRLGLHFKLEPGWKIYWRTPG
    DAGYPPKLDWTGSDNLDTPRPSWPAPHRFVLSGLQNYGYVGEVILPLDARAPDASRPVAARLAVEFLACSQICVPQKVDL
    RLDLSPGAGQPSAFAHDIGRFAALVPGDGRRHGLTLDSAEALGGGETSALRLAVSSTERFDAPDAFVEAEEVAAFGQPKV
    SLSSDRRRAVFEIPVSPGGLLKPLAGAPMTVTVTDGLRAFETPIQPVPGSAAPASAGGEAPGLAGMLLVALLGGLILNLM
    PCVLPVLSIKVLGVLGHGGGERGHVRASFVASGIGIVASFLALAGLAIGLKQAGAAVGWGIQFQQPGFLALMVVLLALFA
    ANLWGLFEIPMPAFLFNRGGGVAHHTVLGHFLSGAFATLLATPCSAPFLGTAIGFALARGPSEIVAIFTALGLGMAAPYL
    AVAVWPDIALKLPRPGRWMVGVRKALGLALAGTGLWLLSVLMVQAGGLAALATGGAMAAAVVLLALRSRLPAAARSAVGA
    CVVALAGLALAAPFHGTAGSDGGTGSGGAVAWERFDSQTLARLVSDGKVVFVDVTADW
    CITCKVNKAAVIERGEVASRLS
    APGVVALRADWTKPDESISRYLASFGRYGIPFNAVYGPSAPDGIALPELLSEAEVLAALDKAR

    >gi|83312702|ref|YP_422966.1| hypothetical protein amb3603 [Magnetospirillum magneticum AMB-1]
    MPQPDHVVRIDLPEAKDYPEDIAAYFAKCDEKLGMRPNVLLAYTARPEKFRTFSRFYNQLMLAEDSGLSKLEREMIAVVV
    SSANRCYY
    CLVAHGQALRQLSGDPQLGEMLVMNYRVAELPPRQRAMLDYAWKLTKTPHDIAETDRAALRAAGFSDADIFD
    ITDTTGFFNYTNRMAHGLDMMPNPEYHAMDRHDLNQK

    >gi|83312726|ref|YP_422990.1| phospholipid hydroperoxide glutathione peroxidase [Magnetospirillum magneticum AMB-1]
    MGLLHHLQESTEVLMHRFLPANPLGSFVASMVATIGLAGSLAAATPNDRLDWASVPLPAINGGQLPPASLKGKVVLVVNT
    ASQ
    CGFTPQYQGLEALWRRYRERGLVVLGVPSNDFGAQEPGSNTEVASFCEINYGVDFPLLEKQAVTGAGAHPFYRWAAE
    RTGPLGVPRWNFHKILVGRDGGMVDWFASTTAPDAERLRAAIDKALSP

    >gi|83312975|ref|YP_423239.1| peroxiredoxin [Magnetospirillum magneticum AMB-1]
    MGAPGAKSSPSNNKIRGSAMAAITLKGNPINTNGTLPAVGAAAPAFSLTTVDLADIGLDSVAGKTVVLNIFPSIDTPVCA
    ASVRRFNAELDKLGSVAVLCVSADLPFAHKRFCGAEGLERVQSLSDMRDKGFGERYGVKIVDGPLAGLLARAVVVIKGGK
    VAYAELVPEIAQEPNYDAAIAAAK

    >gi|83313041|ref|YP_423305.1| glutathione S-transferase [Magnetospirillum magneticum AMB-1]
    MRTLYHHPLCPFSRLVRIVLAEKKLDFEPQIEKTWERRPEFLALNPAGVLPVLVEEDGAALADATAIVEYLEETSRETPL
    LPAEPLARAEVRRLVAWFGQKFHAEVTDHLVGEKVFKRLESGRNEPDSRRIRAGFGNIHRHLDYLGTLTERHGYLAGGAF
    TLADIAAAAQISAVDYLGDVPWDQHAPAKDWYARVKSRPSFRVLLADHLPGLPPPRHYANPDF

    >gi|83313062|ref|YP_423326.1| pyruvate/2-oxoglutarate dehydrogenase complex [Magnetospirillum magneticum AMB-1]
    MSDTSFDVVIIGGGPGGYVAAIRAAQLGLKTACIEKRGSLGGTCLNVGCIPSKALLTASHHYHAAAHELGSFGIKVAKVE
    MDVAGMMGHKDKVVSDNTKGIEFLFKKNKVTYIVGAGAITAPGQIEVTAKDGAKSNVAAKHIVIATGSDVTPLPGVEIDE
    EVIISSTGALALSKTPKHMVVIGGGVIGLELGTVWGRLGAKVTVVEFLDRILPFNDGEVSKQMQRLLAKQGMEFKLGTKV
    TGIAKKGKTATVTVEPAAGGAAEKIEADSVLVAIGRKPYTEGLGLDKVGVALDKRGFVQIDGHFRTNVPGIYAIGDVVGG
    AMLAHKAEEEGVALAEILAGQHGHVNYEAIPAVVYTWPEVASVGKTEEQLKAEGIAYKAGKFPFTANGRARSMNEVDGFV
    KVLACATTDKVLGAHIVGPNAGDLIAEVVLAMEFGAASEDIARTCHAHPGLGEAVKEACLAVDGRPLHT

    >gi|83313081|ref|YP_423345.1| protein-disulfide isomerase [Magnetospirillum magneticum AMB-1]
    MKPFYRLLAAVAALFLVTQTAAAAADLSYSIDQVLGKPDAPITVIEYASTTCPHCATFHKTTLPKFKSEWVETGKAKLIY
    RDFPTGPRGLSVGASMIAHCAGPDRYFGLLALIMEQQEKWMNSQNPLVELKKLAKLAGLGEDKVDDCLKRQDLANAINER
    AKEGNEKLGVESTPSLIIAGKVIPGAIPYDELDKLLKAASK

    >gi|83313218|ref|YP_423482.1| methionine sulfoxide reductase B [Magnetospirillum magneticum AMB-1]
    MVTMTDKVVKTEAEWQAQLSPGQYAVTRQKATERPFSGQYDHHFQPGKYACVCCGQELFLSEAKFNSGCGWPAFSMPAAP
    QAVTEERDRSHGMIRTEVLCSRCDAHLGHVFDDGPGPTGLRY
    CINSLSLKFEAP

    >gi|83313300|ref|YP_423564.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum magneticum AMB-1]
    MRRLLYILPVAVFAILALFFLKGLTLNPRDIPSVLINRPVPEMALAPLPGRGETSGLTTQSLKGRVSLVNIYGSWCISCV
    QEHPVLMEIKKRGDVPIHAVDWRDDPVLGAAWLKKNGDPYERVGIDPPPGRTAVDFGVTGAPESFIVDRDGIIRYKHVGP
    ISKEIWAKTLLPIIRELEKK

    >gi|83313385|ref|YP_423649.1| Thiol-disulfide isomerase and thioredoxins [Magnetospirillum magneticum AMB-1]
    MFPVRRWNSTRNLPMKIVTDSSFEAEVLKAPGPVLVDFWAEWCGPCRQIAPALEELSKDRADKITIAKINIDENPGTPGK
    YGVRGIPTLMIFKNGQVAATKIGALPKSKLYEWVDSSL

    >gi|83313410|ref|YP_423674.1| glutathione S-transferase [Magnetospirillum magneticum AMB-1]
    MKLYYKVGACSLASHIALEEAGIPYAVEAVDLVAKTTESGGDFLAINPKGYIPALVIDDGIVLTEGVAILLRIAAMAPEK
    GLSPAVGTQDYMKLVEWLVFIATELHKPAGIQFNPAMPEEGKVALRTVLSRRLDYLDKALGKGPFLMGERITVADFYLFT
    VFSWLPRLKIDTTPWPHVAALFERIRTRPAVQAVLKAEGLA

    >gi|83313467|ref|YP_423731.1| cation transport ATPase [Magnetospirillum magneticum AMB-1]
    MTQAVLCRHCGGPMPADLAGDFCCRGCEGAFHLLEGLGLEQYYSRRTNDPAARLLRPDDDADRYHDFSAHVITDGDKGES
    SLHLMIEGLH
    CGACIWLIESLLNKQTGVTWARVNMTTRRLVVRWHTGETEPGVLLAPVISVGYRLVPYDPERLGLETQRQ
    EKELLRAMAIAGFAAGNVMLLSVSVWAGHFSYMGPATRGLMHWISALVVLPAVAWCVRPFARSAVAALRAGRTNMDVPIT
    IGVTLACLMSLWETINGGEYAYFDSAITLLFFLLIGRYLDSRARGRARTTVEHLLALDAVAVTVLEDDGSQRMLPPHKVA
    PGSRVLVAAGERIGVDGRIIDGRSDVDTSLLTGESLPVSVTAGAQVFAGTINLSAPLRLEVSAVGERTLLAEIVRMMEVA
    EQGRARYVALADRVSRWYAPVVHVAALATFTGWTVFTNTPWQEALLYAVAVLIITCPCALALAVPVVQVIASGRLMRQGV
    LVKSATALERFADADTVVFDKTGTLTLGKPSLTEDGGWTRDDLTAAAGLTPASRHPLARAITAACPTAPVADGVVEVPGM
    GLEIPAQGIRLGSRKFVGVADDASGDGPELWLARPGHAPVRFAFSDALRADAVAVVAELRRLGISVELLSGDRPAAAAKV
    AEALGLAEWRAGCTPAEKCARLAELAGQGRKVLMIGDGLNDAPALAAAHVSMSPSTAVDVSQTAADVVFQGGRLAPVIET
    LDVARLSRILVKQNFGLALGYNLFTVPLAIAGMVTPLIAAIAMSTSSLVVIGNALRLSRRRG

    >gi|83313655|ref|YP_423919.1| methylated DNA-protein cysteine methyltransferase [Magnetospirillum magneticum AMB-1]
    MPQLAFNSPIGPLALFEADGAIVAVDWGFLPENDETPLLLKARDQLEEYFDGKRTSFDLPLAPHGTAFQQKVWAALSRIP
    FGQTRSYGELAEELGTAPRALGGACGRNPIPVIIP
    CHRVLGANGAMGGYSGIDGVETKEFLLRHEGVPLK

    >gi|83313656|ref|YP_423920.1| hypothetical protein amb4557 [Magnetospirillum magneticum AMB-1]
    MSHNRLAAETSPYLLQHAHNPVHWWAWGPEALAEAKASNKPILLSVGYSACHWCHVMAHESFEDAGIAGLMNRLFVNIKV
    DREERPDLDALYQNALGLMGQHGGWPLTMFLTPDAEPFWGGTYFPATTRYGRAAFPDVLEGIAHSFHRDPEKISHNVERI
    RESLEKMARSPGPLALDMEVVDLGAAQCLRLIDFEDGGTVGAPKFPQPGLFRFLWHSYLRTGNSSLKDAVTVTLNHICQG
    GIYDHLGGGFMRYSTDEFWLVPHFEKMLYDNAQLLSLLTKVWKHTGSPLYRTRIFETVGWLLRDMMAEGDAFAAALDADS
    EGEEGLFYTWTSEELSALMDMDTAIRFGTLYDVRAHGNWEGRTILHRNHPRGGGDDGDLAEAKAVLLAARDKRIWPGRDD
    KVLADWNAMAISALAEASLAFDRPDWLTAARKAFEVITTRMTRPDGRPAHSLCQGRAETAAVLDDYAWLILAALSLHEAT
    AAPEYLERALVWADQVHAHHWDGAEGGYFLSADDAGDVVIRTKPAFDSAVPSGNGMMAEALARLWLVTGDEAWRERSQAV
    IDAFGAAIPEQIPHMTSLLEAFAILAEPLQVVIVGPLDDSGGRALLRTFATTPLPPVSLLRVDNGAALPPGHPAHGKSLV
    DGRAAAYICQGSTCRAPVTDPDQLAALLSKK

    >gi|83310936|ref|YP_421200.1| hypothetical protein amb1837 [Magnetospirillum magneticum AMB-1]
    MDCRGRSITSRNISSASSVQWALRPVQENAMPMTMLEKELVALAISVAAGCRPCVTHHLVEVRKAGADDAAIEQAVAGAV
    RVRKTATEGMRRHALGLDPVTDGCGCGAADPLAELIALGAALAVNCTAGIDRHLAAARSLGIPQDRLDEVLGLASMIRSR
    AISHAEARLGATGQGNWGEAPKAARCC