Macrococcus caseolyticus JCSC5402 uid59003

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|222150255|ref|YP_002559408.1| thiol-disulfide oxidoreductase DsbD [Macrococcus caseolyticus JCSC5402]
    MKNKGSLIFTMIMTLLVIGVIAALIISNQNKKESSVDTESLGTANTNNQQGLKLLDQIDIKDQPMIGKDEAKVTIIEFGD
    FK
    CPACKVFELDIKPDLKKKYIDSGKAKLYFINTPFHGEGSMLGSLAAETLIKQEPDKYSAFQQALFEMQPDTEEEWLTI
    DAVKKAAKTAAVSNIDKLVKDVEALKEKAAVKKDINLVEKHNVTMTPTIIVNGKEVKNPMDPAEVDKVIDEAVKQ

    >gi|222150301|ref|YP_002559454.1| hypothetical protein MCCL_0051 [Macrococcus caseolyticus JCSC5402]
    MSKVLYETTVISKGGRDGKVFSEDNSFYLDIASPKALGGNATTESNPEQLFAAGYGACFNSALTIILKKAGVKNVDPEVR
    ATAMLISDETDGGFKLAANLEVRLDGVPQEDAEKFVATAHDF
    CPYSKALKNSIDVELTVIGD

    >gi|222150313|ref|YP_002559466.1| thioredoxin homolog [Macrococcus caseolyticus JCSC5402]
    MKQIHTYDELQTFLQKNEKALIYVMTTGCTVCHADYPKVKDIVANTHIPSIYLLADKIPEAAGQLSLFSSPVVILFNHEK
    EYHRQARILDFDMLKLRISQLLQEY

    >gi|222150348|ref|YP_002559501.1| alkyl hydroperoxide reductase subunit C homolog [Macrococcus caseolyticus JCSC5402]
    MSLINKEILPFTAQAYDPKSDEFVEVSNESMKGSWSIVCFYPADFTFVCPTELEDLQDQYATLQDLGVNVYSVSCDTHFT
    HKAWHDHSEAISKIQYTMIGDPSHVIARNFDVLDEEAGLAQRATFLIDPDGVIQTMEINNDGIGREASVLIDKVKAAQYV
    ASHDGEVCPAKWKEGSETLTPGLDLVGKI

    >gi|222150349|ref|YP_002559502.1| alkyl hydroperoxide reductase (large subunit) and NADH dehydrogenase homolog [Macrococcus caseolyticus JCSC5402]
    MLDSSLKQQLSQYLELLEGEIILTASKGEDKTSQDMMALLNEISEMSDKISIKEAVLKRTPSFTVARPEEEARVTFAGVP
    LGHEFTSLVLALLQVSGRAPKLDEAVINQIKKIDQPLNFETFVSLT
    CTKCPDVVQALNVMSVLNPNITHTMIDGAVFREE
    SKDIMAVPSIFLDGEEFGSGKMTVEEIVNQVGGGADASEFDAREPFDVLVIGGGPASAAASIYAARKGLRTGIVAERIGG
    QVNDTAAIENFISVKETTGPEFAQNLVDHIKSYDIDVMNAVRVESIEKIDDMSYVTLENGGKLSSKTLIISTGAKWRNMN
    VPGEAEYKNKGVAY
    CPHCDGPLFEGKRVAVVGGGNSGVEAAIDLAGIVKHVTLLEFGEELRADKVLQDRLASLENAEIIK
    SAATKELTGTDKLQALTYVDRTTNEEHTVDLEGVFVQIGLVPSTEFVGDLVERNNRGEIIVDRNGATNVPGIFAAGDCTD
    QTYKQIIISMGAGATAALSAFDYLIRN

    >gi|222150357|ref|YP_002559510.1| hypothetical protein MCCL_0107 [Macrococcus caseolyticus JCSC5402]
    MNFFNFDTTYTNLNEIFYVINNPNPFPHPEYVLFNDGLARELNISFQLKAHPEILTGRTVIEGTAPFSTAYAGHQFGNFT
    MLGDGRQHILGEHITPQNKRYDIQLKGSGRTHFSRSGDGKATIGPMLREYIISEAMHHLNIPTTRSLAICSTGEKVLREN
    MLPGAVLTRTANSNIRVGTFEYAARTSHKHLKELADYTIERHFPNLMSTKNKYLNLLDIVIDKQARLIAQWQSIGFIHGV
    MNTDNMMVSGETIDYGPCAFIDYYHTYTVFSSIDIQGRYAYINQPAIALWNLTRFAEALLPLIHTDGKEAIRLAESALDK
    FQHSYTVYYRTLMGQKIGIKSPSEEDMILIDELLSLMEQYEMDYTNTFLQLQSEDISSLEPLSSWITKWKKRLKVEKNPI
    QLMRKVNPVVIPRNHIVEEALDDAIHGDLSTVKALLQVLSQPFNSEHADKYKHPGPKDKPYQTF
    CGT

    >gi|222150367|ref|YP_002559520.1| hypothetical protein MCCL_0117 [Macrococcus caseolyticus JCSC5402]
    MRRYDRQIKASQFGEQGQDNLSKSKFLIIGAGALGSTISEMLARSGAGEIIICDMDIVSLSNLHRQSLYDETDVHQYELK
    VDAVKRHLSRINKEVKVTPIPEEITSDNLKQLLEKFQPKIVIDGTDNFNTRYVINDICHQFRIPWIYGACLGSKGTVYAI
    DYSVACLRCLLPDPPDTGEN
    CSIEGILPQTAHLTASLQVSEVMKYIAQGCFSNHFITFDSFNIKFKSTEATFFHNNNCKT
    CGTHDYPATMSDTHNVTKMCYGKYSIKLPSNIFHKEIPNTVKSTSLFKIIKVDHVTVHLLKDGRIIIYNVYSKAEAKSII
    SSLFAISV

    >gi|222150395|ref|YP_002559548.1| molybdopterin biosynthesis protein MoeB homolog [Macrococcus caseolyticus JCSC5402]
    MRYDRQIKFYGIGQEGQEKLSRKTVGIVGCGALGTHLAESLARCGVSKIVVVDRDYVELSNLQRQSLFKEQDAIDATPKV
    IACEREVKAIRSDIQIETYINHLDAPLLEAAFLQCDCILDATDNFETRLLINDFAYKYNIPWIYGACVESTYVACPFIPG
    VTPCFNCVMGMLPVMNRT
    CDTVGIIEPAVSMATSFQMMYALKLLTDTPFDAKLVFGDVWQMDHTALKFSRMFNESCSTCA
    AHATYPALSQQTHETMLCGRDTVQIVTAFSDENLLKHLQSLSIIFQETPYFIRFNFDNHPIVWFRGGRMLIHEVQSMAEG
    KTVYHQLFG

    >gi|222150512|ref|YP_002559665.1| peptide methionine sulfoxide reductase A [Macrococcus caseolyticus JCSC5402]
    MYTIYLAGGCLWGVQAFLKTVPGVAGTEAGRANGETATLDGPYDGYAECVKTICEDTLALHELLDDFFQIMDPYSVNKQG
    IDEGPKYRTGIYSEDEALLQAVRRYINSREDKEKIVVEVLALNNYVRSADEHQDYLDRHPGDYCHVPLEMMRKYR

    >gi|222150513|ref|YP_002559666.1| copper-transporting ATPase homolog [Macrococcus caseolyticus JCSC5402]
    MAKQEVTLPIEGMTCAACSNRIEKVLNKMDGVEAQVNLTTERATVHYDEDKLSLSDISERIDKLGYQVRPAHAEFDITGM
    T
    CAACSNRIEKILNKQPAIQNATVNLSTEVATVDYYPGNMDESNIIEHIKKLGYDATLKSEEQSDHKENELRRKKYKLIL
    SAVLSLPLLLTMLTHLFGIHLPHIFMNQWFQFVFAFPVQFIIGWQFYTGAYKSLRSGSANMDVLVALGTSAAFFYSLYES
    IKWMRGLTNDPHLYFETSAVLITLILFGKYLEARAKSQTTNALSSLLNLQAKDARVMRNGKEQLVSIDALQVGDHIIVKP
    GEKVPVDGVIIKGNSSVDESMLTGESIPVEKHMGDKVIGATMNKNGSFTMEATKVGKDTALQSIVKIVESAQGSKAPIQR
    MADVISGYFVPIVVGIAILTFIVWMLFVKQGFEASLVAAISVLVIACPCALGLATPTSIMVGTGRAAEHGILFKGGEHLE
    RTHEIDTIVLDKTGTITKGEPEVTDFTGDNRALQYLASSEQSSEHPLASAIIKYAEAQGVSLEEVSHFEAVPGHGIHTQI
    DDEDIYVGNRKLMQQYNIEIETFEPNMQLFEAQGKTAMMIAYEGKVQGIVAVQDTVKPSAKDAIDELKAMGIEVIMLTGD
    NTRTAQAIASEVGIDEVIAEVLPEDKAEKVKALQAQGRKVAMVGDGVNDAPALALSDIGIAIGTGTEVAIEAADVTILGG
    ELTLIPEAIKLSHATIRNVKQNLGFAFGYNVIGIPFAALGLLAPWIAGLAMALSSVSVVSNALRLKSVKIK

    >gi|222150629|ref|YP_002559782.1| hypothetical protein MCCL_0379 [Macrococcus caseolyticus JCSC5402]
    MGWTIFSGLIIGLLLGFVMQRTRFCLTGGFRDMYVQKNNKMFYALLVAITIQAIGLAILTSLHVLEIPYDAYSVIGTIFG
    SFIFGVGIVLAGG
    CATGTWYRAGEGLIGSWIALFMYALFAAITKNGALKPALDKVNGMTVVESKMSTMFGLPYWVLVLIL
    SALTLFFVVKTLRRPKVAVPKLKQKFTGVRHLFFEKKYHPFFAAVLIGLIALAAWPMSYSTGRNYGLGITTPSAKLLQFL
    VNGDVTLLDWGVYLVLGILIGSYIAARGSREFKWRLPDKITIRNSAIGGALMGIGAAFAGGCSIGNGLVSTATMNTQGWL
    SLLFIILGTWFMSYFLYVKPMKQAKSEIAATKIKTQTV

    >gi|222150633|ref|YP_002559786.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase homolog [Macrococcus caseolyticus JCSC5402]
    MRKIMIIGGVAAGASVAARLRRLNEQDEITIIERGPHVSFANCGLPYYIGDEIQDRDKLLIQTPELMNERMNINVRTNTE
    ATQINPDNKTVLLKTQNGVEEASYDVLILSMGARAIEVPIEGAKQNHVFTLRNIPDMDKIKSYINEHDVKTASVVGGGFI
    GLEMAENLHALGIDVTLFELGDQVMTGMDKDMTKLLETHMVQRGVHLKLKSSIKEINEHNVIAENGDVIQSDMVIMAIGV
    IPESAIAQEAGIETGAKGAIKTNDVFETSIKDIYAIGDVAEITHKISQQDVHIPLAWIANREGRLLADYLNGKVIEKIKP
    IGTAIAKVFDLTAASTGLNERTLKMQGLDYHIIHVSGQSNATYYPGAEPMTIKALFSPEGKIYGAQIVGRKGVDKRIDLI
    ASAMTFNQDIRSLAQIEIAYAPPFSSAKDPVNMVGYIAQNVLDDEMKMVQYDEIENFNQLIDVREPIEYDMGTIGSAKNI
    PLGTLRDRLAELDINEPVAIF
    CQVGQRGYNAARILQNNGFDVVNLDGGYKHYKAMHETVNRPEVRAVEQTQIEEGTKKEQ
    PMKKDDRRIIEASGLQCPGPILKVKENMDEMKDGEQLEIHVTDFGFCTDIEAWAKNTGNTMISNEMKDGKVVAVVQKGAD
    LPINVMNGREGHQLVETKNGATMVVFSGDLDKALASFIIATGAASYGKEVTMFFTFWGLNVIKKPGVTVAKEGLDKMFSK
    MMPKHAGKLPISKMNMGGAGARMIRHVMNKKKVDSLETMIEKAQSMGIKMVACTMSMDIMAVTKEELIDGVEFGGVATYL
    GDTEQSNLNLFI

    >gi|222150634|ref|YP_002559787.1| hypothetical protein MCCL_0384 [Macrococcus caseolyticus JCSC5402]
    MYFKQFFNEQLAQYSYLVGCQKTGEAIVIDPLRDITPYIEAAEKEGLRITHVTETHIHADFASGIREVINMGTQSYVSGH
    GGLDWTYQDIEADIIHEGDVIKVGNVKLEVMHTPGHTPESISFLLYDNGMDVPMSLFTGDFIFVGDVGRPDLLEEAAGIK
    DTTEIGARQMFQSLKKVNDLPDFIQIWPGHGAGSACGKSLGAVPMTTLGYERTNGWAFQIEEEDAFIKALTSDQPEPPYY
    FAEMKRMNRDGVALMHHNIVTPVETLTEQAIDLRAKETYANNMSEGINVPYNKKFLSFAGWYLDYSRPLQLIGELDEVQE
    AAHDLKMIGFDDVHTYVNVVDGTAYQTIEPEAFKQLNKDDINILDVRTKKEWDEGHFDGAVHVHYGKLQQASIPFAKDEE
    IYVH
    CQSGVRSAIAMSILENEGYTNLINVNGGYAAVK

    >gi|222150643|ref|YP_002559796.1| hypothetical protein MCCL_0393 [Macrococcus caseolyticus JCSC5402]
    MKIYISCFLVQDIEFIIASDECGVIYLANEHTHEYVNRHIERFFSQATKVTGYEADQYNTHYIEELNLYFAGKKQQLEWP
    LNLAGTDFQKSVWQTLLTIPYGETRSYSDIALQSGNVKAVRAVGGAIGANPVMIVVP
    CHRVIGKDGTLTGFSGGLDLKDK
    LLNIEKIQL

    >gi|222150757|ref|YP_002559910.1| hypothetical protein MCCL_0507 [Macrococcus caseolyticus JCSC5402]
    MKRLITILLATIFVALASYSIYTVIQFNRSNEEPANIVTHNHPLNNKRINEMSVTNMKGQKKEVASLLKHDITIINMWAS
    W
    CEPCKKEMPEFVTYGKEMPNHVGLIGFNVQDNPENRDAFIDKYQPTYPMYILDEATMKRYKIYNIPTTIFVDKQGKVLK
    TYVGELNQQKIEEIIRQIQ

    >gi|222150765|ref|YP_002559918.1| thioredoxin reductase [Macrococcus caseolyticus JCSC5402]
    MSEIKEYDVIIVGAGPAGMTAAVYASRANLSTIMIERGMPGGQMANTADVENFPGFDLITGPDLSTKMFSHAQKFGAEYT
    YGDIKNITVEGDDKIVDLGDKQLKAKAVIIATGAEYKKIGVPGESELGGRGVSY
    CAVCDGAFFKQKNLVVIGGGDSAVEE
    GVYLTKYADKVTIVHRRDTLRAQKILQERAFKNDKIDFIWNSTLKSINEKDGKVGSVTLIDNEGKETDVETDGVFIYIGM
    QPLTKPFQHLGITDEVGYIITNEEMETNIPGIFAAGDVRQKKLRQIVTATGDGSIAAQNAQHYIESLND

    >gi|222150784|ref|YP_002559937.1| thioredoxin homolog [Macrococcus caseolyticus JCSC5402]
    MRTISQYEEFKEIIASEEPVVIKFFADWCPDCTRMDFWIDPIVDEYHNYNWYKINRDQVPEAADENDVMGIPSILIFKNS
    EKLAHLHSANAKTPESVKAFLAEHLTK

    >gi|222150785|ref|YP_002559938.1| hypothetical protein MCCL_0535 [Macrococcus caseolyticus JCSC5402]
    MIKFYQLPSCTTCRKAAKYLADNGVSFEPIHIVEHTPTAKEFDTIVKNTGVDVDLLFNKLGTKYKELNLKETLQDKSYEE
    KLELLASDGMLVKRPLAVNKDKITLGFKEADYKQTWL

    >gi|222150788|ref|YP_002559941.1| hypothetical protein MCCL_0538 [Macrococcus caseolyticus JCSC5402]
    MNGKVSRNPMSIRTHLQSKDLERIQDNYIIFGYTPFCGTCKLAEKMLDIVNMSLKLDILKLDLNYYESLSTQYKISSVPV
    LIIVKDNEVVDTIFRFESVTSIYEILSKSIDE

    >gi|222150815|ref|YP_002559968.1| hypothetical protein MCCL_0565 [Macrococcus caseolyticus JCSC5402]
    MSTVILTKAAAYEVKSMMEQNGMPEGFLRISVKGGGCTGLSYGMSAEEAPADNDEVLNFYDVKVLVDKADAPILKGTTVD
    FKQSLMGGGFAIENPNAIASCGCGSSFRTKDVAGTPENC

    >gi|222150847|ref|YP_002560000.1| coenzyme A disulfide reductase [Macrococcus caseolyticus JCSC5402]
    MKIIIIGAVAGGATVASQIRRLDADADITIYEKDRDMSYANCGLPYYIGETVASRDNIVMATPDTFNDNRNIQVHTYHEV
    TRLYPDDKKIEIYNHQTKETITDTYDYLILSSGASQIVPDLYRHDHVFQVRNLEDTDKINQYIERMDAKRALVVGGGYIS
    LEMAENLKHRGLDVTLVHRSSHFLKQMSRDITDTVPQVLEDNGIHLKLEDEVARIDEHTVTFKSGDTDTFDIIITALGLK
    PNTKFIDDAIELNDKGYIKVNRYFETSNPAIYALGDAIETFYRHIDKKATIALAWGTHRAASIIAHNLFHKDKEAFQGLL
    GSNILRLFDHTYASVGLNEMLILEMDNIAHVSHTQKHKASYMPYSSPLSITVYYEQSTGKILSASASGKSGVDKRIDILS
    TAMIGGLTIYDFKDIEIAYHPDYSSPKDIINMLGYKAK

    >gi|222150861|ref|YP_002560014.1| transcriptional regulator Spx [Macrococcus caseolyticus JCSC5402]
    MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSENLSIDEIKAILRMTEDGTDEIISTRSKTFQKLNVDIDSLPLQDLY
    DIIQKNPGLLRRPIILDEKRLQVGYNEDEIRRFLPRKVRTFQLLEAQRMVD

    >gi|222150963|ref|YP_002560116.1| dihydrolipoamide dehydrogenase subunit E3 [Macrococcus caseolyticus JCSC5402]
    MVVGDFPIETDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKAMLSASHKYETAKHSEDYGIKAEN
    VTLDFSKVQEFKNGVVERLTGGVGSLLKGRKVEIVQGEAYFVDQNNLKVMTEKASQTYTFKNAIIATGSRPIEIPNFKFN
    KRVIDSTGALALPEVPKHLVVVGGGYIGSELGTAYANFGSKVTILEGAKDILGGFEKQMTQVVKKGLKAKGVEIVTEAMA
    KSAEESENGVKVTYEAKGETHTIEADYCLVTVGRRPNTDELGLEGLGIKMTDRGIIEVDAQSRTSVENIYAIGDIVPGPP
    LAHKASYEGKVAAEAISGEKSEVDYLGIPAVCFTEPELATVGYTEAMAKEEGLDFKASKFPYAANGRALSIGETDGFLKL
    ITLKEDGLLIGAQVAGAGASDVIAELGLAIETGMTAEDIALTIHAHPTLGEITMEAAEVAMGHPIHTM

    >gi|222151145|ref|YP_002560299.1| glutathione peroxidase [Macrococcus caseolyticus JCSC5402]
    MSIYEYTVTKANHESYSLAEYKNQVVLIVNTASECGFTKQFDGLEKLYQEYKGQGFTVLGFPCNQFGGQEPGSGAEAEQN
    CRLNYGVTFPIHEKIEVNGDNAHPLFKYIKEETKGIMGSKIKWNFTKFLVDRQGNVVARFAPTTTPEQLKKHIEKYL

    >gi|222151266|ref|YP_002560422.1| peptide methionine sulfoxide reductase I [Macrococcus caseolyticus JCSC5402]
    MKKKIYLAGGCFWCMVKPFDTYDGVFSVTSGYMGGHIENPTYEQVKTGTSGHLEVVEIQYDDQVFTTLQILEIFFKIIDP
    TDNEGQYQDRGSQYRTAVFYSDEHQRKIAEDYISNIQAQFDKQIVTEIREAQTFYKAEEYHQDFYQKDPERYKREQETRQ
    KIKDKKN

    >gi|222151319|ref|YP_002560475.1| peptide methionine sulfoxide reductase MsrB [Macrococcus caseolyticus JCSC5402]
    MKSIGGIKMKDKDLNELTEMEYYVIKENGTEPPFQNEYWNHFDKGLYVDKLSGKPLFTSEDKFDSSCGWPSFSKAISDDE
    IIELVDKSHGMTRTEVRSDASDSHLGHVFNDGPVDRGGLRY
    CINSASIQFIPYDKLEALGYTQYLSLFNNK

    >gi|222151320|ref|YP_002560476.1| peptide methionine sulfoxide reductase MsrA [Macrococcus caseolyticus JCSC5402]
    MQKATFAGGCFWCLVKPFDTFPGVHSVVSGYSGGHVDNPSYEEVCTNTTGHREAVQVTYDESQISYEDILKVYFMTFDPT
    DDKGQFYDRGESYTPAVFYHNNQQKIEALEYIRKLDDAGIFAQKITTPVLPYKNFYAAEKEHQDYYKKAPGHYERYQVGS
    GRKAFIEKHWGNKDER

    >gi|222151335|ref|YP_002560491.1| hypothetical protein MCCL_1088 [Macrococcus caseolyticus JCSC5402]
    MKIWIDEREALEYYISDQAVIFDCRGIMDNNTQSLEQFNQQHIQNSIFSFPILTGNNPMSSGRHPLPDLNEFYRFVKIHA
    QDKMIIAVDNKDSFFGTRFLYLCHLVGLDCYIIDGGYENLDGFSQYFVSETDFLSVNRVVMSDKNIDTDNKNMNYNKAIF
    IDIETLLKNDEERILIDARSKERFIGLFEPIDTVAGHIPEAINIPYNDCFEDGYIKDRAALTTLFQVTQDNPVTVY
    CGSG
    LSATPLYAALRSLDRDVALYAGSFSEWISFYPDKIETGD

    >gi|222151388|ref|YP_002560544.1| cytochrome c biogenesis protein ResA [Macrococcus caseolyticus JCSC5402]
    MQKSQKKWIQYIIMLLILVAIGFILYVSVAKDGEKVVKVGDKAPLFELKNLEGEKVALSDYKGKGVILNFWGTWCNPCKE
    EMPDLNRMNKIYHSKGVEVLTVHVKDSPQQVKQFFSELPEEVELMVALDGSGDVMRAYNANDLPNTYIIDKNGIIKAHHK
    GQMSRADIKKYMDMVQP

    >gi|222151568|ref|YP_002560724.1| thioredoxin [Macrococcus caseolyticus JCSC5402]
    MALINATDSNFEDNIKEGVTLVDFWAPWCGPCKMIAPVLEDLAKDIEGKANIVKVDVDENQATAAKFEVMSIPTLIVFKD
    GQAVDKVVGFQPKEQLQAVLAKHY

    >gi|222151627|ref|YP_002560783.1| thiol peroxidase [Macrococcus caseolyticus JCSC5402]
    MAQVTFKNNPMKLSGEPVTVGTAAPDFSVLANDLTVRTLADYEGKKKLISVVPSIDTGVCSTQTRKFNEEAAGIDNAVVL
    TISVDLPFAQAKWCAAEGLENVITLSDHKDLSFGTNYGVVMEDLRLLARSVFVLNDANEVVYTEVVPEGTDHPDYDKAIE
    ALKSI

    >gi|222151638|ref|YP_002560794.1| hypothetical protein MCCL_1391 [Macrococcus caseolyticus JCSC5402]
    MKHTFNCTAKFTGGYHGVGTIENRNLKSKISIPKEMDGPDIGTNPDEMLLSSAVTCFTITLSSMFERNNIPVEIDYVDAS
    ATINNEKQVLTYESITYKVYLISTAQIDEKKIVRYVNKSEES
    CMITRALKGNVEVSIENIYLNNNILI

    >gi|222151668|ref|YP_002560824.1| hypothetical protein MCCL_1421 [Macrococcus caseolyticus JCSC5402]
    MKEITSVEMFRESIEQPTIAMFTAGWCPDCHFIAPLLPEIESENEAYHFVSIDRDEFIDLAVEYDVMGIPSFIAFDKGTE
    IGRFVSKDRKTKDEVNAFIKGL

    >gi|222151681|ref|YP_002560837.1| hypothetical protein MCCL_1434 [Macrococcus caseolyticus JCSC5402]
    MFNTIVIGGGPSGLMAAISASENGKSVLLIDKKDKLGRKLQISGGGRCNVTNRVSHEELIQHLPGNGKFLYSAFNTFDNF
    AIIDYFENLGVRLKEEDHGRMFPVTDNAKDVVNALKQQLVKNNVDIRTNQKVASLLVQDTVKGVRLEDATEIYADNVIIA
    TGGKSVPHTGSTGDGYEFAKQAGHTITELFPTEVPITSNAPFIKAKTLQGLSLRDVALSVLRKNGKPRITHQMDMIFTHF
    GISGPAALRCSQFVYKEQKSQKKQDITMMIDCFPQESIGALKNRITKMIDTNKDKAIKNSLKGLVSERYLLFLLEQAGLN
    LEDNGHHLKKEAVEQFCELLKGFKFTVNGTQSIEKAFVTGGGVSVKEIVPATMQSKLHDNLYFCGEVLDIHGYTGGYNIT
    SALVTGYIAGLNCR

    >gi|222151836|ref|YP_002560996.1| hypothetical protein MCCL_1593 [Macrococcus caseolyticus JCSC5402]
    MLEKGMLLPDFKMENQDGEIITNQDLFGKKTVLYFYPRDNTPTCTTQACDFNDNLDVLNALDAQVYGVSGDSKVKHSNFI
    SKYNLKFDLLVDEDYAFSKQLGIYRLKKSFGKESMGIVRTTIILDDDTRILQVFDGVKVKTQMEEIKKVLQGEK

    >gi|222151922|ref|YP_002561082.1| hypothetical protein MCCL_1679 [Macrococcus caseolyticus JCSC5402]
    MKNKEVYRLEGLSCTNCAAKFQDNVKSIPGVEDVTLNFGAAKLEVTGDASIEALEAAGKFDNIKVRPAHIKRVKKVPFYK
    KRENIPFILSAIIFLVGMLCSLNFGEDHTVTRAVFIIAILVGGYHLFIEGVKGLFKLNFDMNVLMTVAIIGAALIGELQE
    GAMVVVLFAISEALEGYAMEKSRAGIASLIDISPDVALIAREGKFIEVDVDSIIPGDIVKVLPGKKIPVDGVVTDGQSNI
    NQASITGESIPVHKQEGDTVYSGTLNESGQLTVRVTKRNDETKLAQMIHLVEEAQSEKAPTQKFVDRFAKYYTPIIMLIA
    LTIIVVPPLFGGDFNHYLYQGLSVLVVGCPCALVISTPVAIVTAIGRAAKEGMLIKGGVHLENAGHISTVAFDKTGTLTK
    GTPAVVSRRDFEAGQKDDIIYTLEKEAGHPLSRAVVDSLEVRTLVPVTDYEVVTAKGVKGVFDGVEYRIGQRSFFDLTDD
    AQTEIENMHETGATMVLFGTVNRIYSVFFIKDTLREEAGSVIRTLEQMNIDTVMLTGDHKSVAETIGKEIGLTQVHAGLL
    PEDKLDIIKNYQQHGRVAMVGDGVNDAPALAQADVGFSMGGAATDTALETADIAFMKDNLDDLPRVIQLSKRTLKIIKQN
    ITFALGLKLLAILLVIPGWLTLWLAIFADMGATILVTLNSLRLLKRK

    >gi|222151929|ref|YP_002561089.1| hypothetical protein MCCL_1686 [Macrococcus caseolyticus JCSC5402]
    MNNKHYDVIYIGSGHAAWHGALILNQMKKRVAIIEKDKIAGTCTNYGCNPKILLEGPFEAIESLKHYGDIVDTLPQVNWS
    KLMDYKRETINPMHEGLEQIFKDQGIDIIKGEGLLKDAHTVSVDGTEYHAKFIVLATGQRSHILDIEGKELMHNSTDFME
    LDTFPESITFLGGGYISIEFASIAAKMGSEVSVIGHSDTVLKQYHQPYVQKLVKKLEGEGVTFHLNIDVNKLEQTEDGLK
    FTDDKGFELYTDYVVDATGRVPNVEGIGLEQVGVDYDKHGIKVNKFMQTSVPNIYASGDVVSKKTPKLTPTATFESNYIA
    LNILGNDADKKKFPLKALKLLPIKYPAIPNVVYSLPRIAHVGMTVEEAERKSGYKVKTIKFGEQLEFQYKHERDAEMKII
    LDGRNRLKGAVIYGSAADDLINILTLIINKKMSGREVNKMIFAFPSASSGVIQLLGMHMMGVDIDL