Lysinibacillus sphaericus C3 41 uid58945

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|169825642|ref|YP_001695800.1| copper chaperone copZ (copper-ion-binding protein) [Lysinibacillus sphaericus C3-41]
    MQNVTLNVQGMSCGHCVNAVEKNVGALTGVEQVKVNLAEGLVDVAFDDAQVSLDQIKETIDDQGYEVK

    >gi|169825643|ref|YP_001695801.1| copper-transporting P-type ATPase copA [Lysinibacillus sphaericus C3-41]
    MSSDHKEANLQITGMTCAACATRIEKGLNKMDGVEQATVNLALEKSSIKYDPAKLSEADFEKKIEALGYGVVKQKTELDI
    TGMT
    CAACATRIEKRLNKMSGVSSANVNLALEKAMIEFNPSEVNIADIIAKVEKLGYGAHQKADEQETEDHREKVIKQQQ
    QKFILSAILSLPLLWTMVGHFSFTSFLYVPEFLMNPWVQMVLATPVQFIIGKQFYVGAYKALRNGSANMDVLVVMGTSAA
    YFYSVYQAIVTIGTHHGPHLYFETSAVLITLILLGKLFEAKAKGRSSEAIKKLMGLQAKTAIVVRDGMEREVPLEEVMIG
    DVILVKPGEKIPVDGEVLEGTTAVDESMLTGESLPVDKKQGDQLFGSTINKNGFIKMTATKVGRDTALAQIIKVVEDAQG
    SKAPIQRLADQISGVFVPIVVGIAIVTFIVWIIWVRPGEFTPALEVLIAVLVIACPCALGLATPTSIMAGSGRAAEFGIL
    FKGGEHLEQTQSIDTVVVDKTGTVTHGKPVLTDVLLAPDQEETHFLSLIGAAEKQSEHPLAEAIVHGIEERGIALGDVQF
    FEAIPGYGVQATVSGQGVIIGTRKLMQQYGIQLDNILPKMEELERNGKTAMLAAINGQYAGVVAVADTVKDTSKEAIHRL
    QDMGITVIMMTGDNERTAQAIGTEVGVNQVIAEVLPEGKADEVKKLQAQGKNVAMVGDGINDAPALATANIGMAIGTGTD
    VAMEAADITLIRGDLNSIADAILMSRKTMRNIKQNLFWAFAYNTLGIPIAAIGLLAPWVAGAAMAFSSVSVVLNALRLQR
    VKL

    >gi|169825790|ref|YP_001695948.1| O6-methylguanine-DNA methyltransferase [Lysinibacillus sphaericus C3-41]
    MEKLYFDTLTFAQGSMYIVASNNGLAYIGTPNASFDEVKEWAKKPFKGYSFEENQEQLQPYKEQLTAYFNKELTEFDVPI
    HVKGTPFQLAVWDALKELPYGSTTSYGSIAERIGNPKAVRAVGSAIGANPILAIIP
    CHRVIGKNGQLTGFRSGLDVKQFL
    LELEKA

    >gi|169825934|ref|YP_001696092.1| putative peroxiredoxin bcp [Lysinibacillus sphaericus C3-41]
    MTLQEGQKVPDFSLMNEKGETVQLTDFKGQNVILYFYPKDMTPGCTTEACDFRDRFEDFSHLNAVVLGVSPDDANKHTKF
    IDKHGLPFSLLVDEDHAVAEAYGVWVLKKMYGREFMGIERSTFLIDSEGKLMKAWRKVRVKNHIEEVYAYLAEQEATT

    >gi|169825962|ref|YP_001696120.1| disulfide formation protein (disulfide oxidoreductase) (Thiol-disulfide oxidoreductase) [Lysinibacillus sphaericus C3-41]
    MSKKEENGLLFIWIVSAVATLGSLYFSEIRHYEPCKLCWIQRIFMYPIVIMATVAFIQKNARIAVTTAVFSVIGGCISLY
    HYGIQKLSFLADSAPS
    CGAVSCTGQYINWLGFITIPFLALTAFILIAGASFYLIKATKAVK

    >gi|169825987|ref|YP_001696145.1| hypothetical protein Bsph_0388 [Lysinibacillus sphaericus C3-41]
    MTQKDYRILLYYKYVTIEDPIAFAEEHLAVCQELGLLGRILVGHEGINGTVSGTIEQTDAYMNHMKADPRFSDIMWKIDE
    AEGHAFKKMHVRPRREIVHLGLENDINPLEITGDYLSPKEFMEQMQEENTIIIDARNDYEYDLGHFRGAVRPDIENFRDL
    PAWMETHKEEFTDKKILTY
    CTGGIRCEKFSGWLKREGYGKSVGQLHGGIATYAKDSEVKGQLWDGQMFVFDRRRSVPINQ
    VEHIVIGKDYFTGEPSERYTNCANPECHKLMLCEEKHEAFYMRSCSDECRRAKRNFFVEEHGWTVHQIEEQIARIAVVQN
    AKS

    >gi|169826045|ref|YP_001696203.1| thioredoxin reductase [Lysinibacillus sphaericus C3-41]
    MSEEKIYDVVIIGAGPAGMTAAVYTSRANLSTLMIERGIPGGQMANTEEVENYPGFDTILGPELSTKMFDHAKKFGAEYA
    YGDVTEIIDGEEFKTIKSGTKEYKTRAIIITTGAEYKKMGVPGEKELGGRGVSY
    CAVCDGAFFKQKNLVVVGGGDSAVEE
    GVYLTRFADKVTIVHRRDKLRAQKILQDRAFANDKIDFIWNATVKEINEANGKVGSVTLQSTVDGTESEFTTDGVFVYIG
    MLPLTKPFESLGILNDAGYILTNDNMETTIPGIFAAGDVREKSLRQIVTATGDGSIAAQAVQHYVEELLEKINA

    >gi|169826058|ref|YP_001696216.1| hypothetical protein Bsph_0461 [Lysinibacillus sphaericus C3-41]
    MIVQFFSRANCPLCVEGLHTLKLVQEDVAFDIEIVNIEEDDHIHEKYMFMIPVVEKDGTVIQYGNLDYATLMEHLGS

    >gi|169826120|ref|YP_001696278.1| hypothetical protein Bsph_0523 [Lysinibacillus sphaericus C3-41]
    MVQHKFTMDLTWSDGRNGTGTINASNLKTQISIPQEMDGPGIGTNPDEMLLGASATCYLITLAALLERSEVAVHDLSLQS
    EGYVSVVNGVFTYEKIIHKPKIVILNLTEHLETKITRFAQKAEQT
    CMISKALKGNVEIECDAQILGARI

    >gi|169826129|ref|YP_001696287.1| thioredoxin-like protein [Lysinibacillus sphaericus C3-41]
    MVNKESEYLMKTITTAEQFNELINGDQKVLVKFYAGWCPDCTRMNMFIDPIIEEYNQFDWYELNRDELPEIADKYDVMGI
    PSLLIFQNGEKLAHLHSANAKTPQQVTEFLSAQQ

    >gi|169826133|ref|YP_001696291.1| hypothetical protein Bsph_0536 [Lysinibacillus sphaericus C3-41]
    MPNKLFVKVTDKNTKWMDRLTEMSEVPPFSMIMMVYYRKRQQRSILMTIQFFHYPKCTTCKKAQKWLNDHDVSYEEVHIV
    EQPPTKDEITALWQVSGLPLKKFFNTSGMKYRDLGLKDKLADMTEEEQLELLASDGMLIKRPLVTDGKKVTLGFKESDFE
    QAWI

    >gi|169826137|ref|YP_001696295.1| thioredoxin [Lysinibacillus sphaericus C3-41]
    MEEWSKEQWETALQSGEKAAFYLYTPMCGTCAVASKMMSIVEQLLPHLKLGKANINFLEQIAFEHQIESVPCLLVCDGGK
    VTEKIYAFQSVPFLYELLKKSID

    >gi|169826172|ref|YP_001696330.1| hypothetical protein Bsph_0577 [Lysinibacillus sphaericus C3-41]
    MMGMTSTKQVIEITQAAGFHINEMMEHNEEQGSFLRVVVNGGGCSGLSYGMHFDQEKKEDDFVDVQHGLTILVSREDAPI
    LMGTKIDYKQSLMGGGFTIDNPNAIASCGCGTSFKTAKREGTPEICE

    >gi|169826276|ref|YP_001696434.1| coenzyme A disulfide reductase [Lysinibacillus sphaericus C3-41]
    MKYVIIGGDAAGMSAAMEIYRNVPGAEITTLERGFIYSYGQCGLPYVVDGRISSTKRLIARDVETFRGKYGIDARVGYEV
    EKVDIENKVVSGIQASGEVFEISYDKLLIATGADPVVPVRSGVNLEGIHTVKTIPQLEDLMADLTPDIEQVTIIGGGYIG
    LEMAETLQTCGKKVRLVQRGSHVAKILDEELAQHVHEEAKKNNVELLLNTDVEAFEGNKRVERVITNNGILETDLVIVAS
    GIRPNTKFLEGTGIAFAKNGAIIVNRHLETSVENVYAAGDCATHFNIVKERIDYIPLGTTANKQGRLAGLNMSGKFAPFR
    GIVGTSILKFFNLTIATTGINERHAKELGFDYEAFKLSARHIAGYYPGAQRMYIKVVVRKRDQLLLGAQIVGPAGVDKRI
    DVFATALYSKMTLPDLLDLDLAYAPPFNGVWDPLQQVARMNGRL

    >gi|169826277|ref|YP_001696435.1| glutathione peroxidase bsaA-like protein [Lysinibacillus sphaericus C3-41]
    MTLEDGTDYSLERYKGKPMLIVNTASKCGFTPQFEELEGLFEKYQDEGLVVLGFPSNQFKQELATAEEAASQCRLEYGVT
    FPMHKIVKVNGKEAHPIFDYLTSHSKGFLGNSIKWNFTKFLVNRDGEVVGRYASADKPSSFEDDIKKVLA

    >gi|169826469|ref|YP_001696627.1| transcriptional regulator Spx [Lysinibacillus sphaericus C3-41]
    MTVTIYSQASCSSSRKALKWLKDHNIEYKEKRITSHPLTLAEFKEILSMTEDGTDEIIATNSNDFKNLNIDIDQLSIQEL
    FAIIQAHPRMLRSPILIDEKRIQVGYNEMDIRRFIPRKVRAYELNAMTRLAQES

    >gi|169826769|ref|YP_001696927.1| Thiol-disulfide oxidoreductase resA [Lysinibacillus sphaericus C3-41]
    MKKNIGLLIVVLLVVAMIGTYVKQQIDEDRAIEKSALGKDIEERKIGLGNGDTPPDFSLTSLDGKNVKLSDLRGKKVVLN
    FWATW
    CPPCKAEMPHMQSFYDEYGKEKNVEIIAVNLTSAERDVTADAKVDTVMTFRDSFELTFPILLDPENSAGSDYQII
    TIPTTYFIDSNGYIQRAIKGPMDVDMLKEYVDALD

    >gi|169826796|ref|YP_001696954.1| regulatory protein Spx [Lysinibacillus sphaericus C3-41]
    MSEGMIVTLFTSPSCTSCRKAKAWLEEHEIPYTERNIFSEPLSISEIKKILRMTEDGTDEIISTRSKIFQKLNVDVESLP
    LQRLYELIQEYPGLLRRPIILDEKRLQVGYNEDEIRRFLPRKVRAYQLQEAQRMVN

    >gi|169826857|ref|YP_001697015.1| hypothetical protein Bsph_1277 [Lysinibacillus sphaericus C3-41]
    MIHEVKNMEKFDIAIIGAGPGGYVAAIHAAKNGKKVALIERDKLGGACYNVGCIPSKILLEHSKLVQAINRGNSWGIETD
    NVKINFPRLMQRKDTIIQELLTNIEHYIINNHITLYRGEATLTKDLLITVGNETLTASDIILATGSKPYVPPFEGLESAT
    YFTTDTFFNLKELPAQLTIIGGGVIAVEMAFSLAPLGTKITMLNHSEDILQTEEPEARPLIREKMKKLGIELITDFQFEK
    FEGHTIHTTKGIYTYENLLFATGRRPNTEIAQHLELTFEGRLIAVNEHLQTSQPHIYAIGDLVGGYQLAHSASAEGIYAV
    DYIMGNQPALIDQASIPRCVYTHPEIATFGLLEEQVKVPYTMTKMPLQTNPKALMEGNTEGFVKLITKEGSGQILGACVV
    GDGATEMLNAILAAKNSGGTALSLAQMIFPHPTVSEHIGDTAKAVFGKAIHQ

    >gi|169826913|ref|YP_001697071.1| putative peroxiredoxin in rubredoxin operon [Lysinibacillus sphaericus C3-41]
    MAERMVGKQAPDFTMEAVLSDKSFGKVSLEDIKAQDKWTVLFFYPMDFTFVCPTEITAMSDRYDEFEDLDAEVIGVSTDT
    IHTHLAWINTDRTQNGLGELKYPLAADTNHQVSKEYGVLIEEEGIALRGLFIINPEGELKYQTVFDNNIGRDVDETLRVL
    QALQTGGLCPANWRPGQATL

    >gi|169826914|ref|YP_001697072.1| Thiol-disulfide oxidoreductase ykuV [Lysinibacillus sphaericus C3-41]
    MKLREQMPELVGATTWLNGEVTKAELVGKKPTLIHFWSVSCHLCKEAMPDVNNFRDQYKDELNVVAVHMPRSEADTDLET
    IKAVAAEHDISQPIFVDSEMKLTDAFENQYVPAYFVFDKDGQLRHMQAGGSGMKMLEKRVNRVLDEMRNAE

    >gi|169826946|ref|YP_001697104.1| dihydrolipoyl dehydrogenase [Lysinibacillus sphaericus C3-41]
    MVVGDFPIETDTLVIGSGPGGYVAAIRAAQTGQKVTIVEKNVLGGVCLNVGCIPSKALISVGHRFEQAKHSDDMGIIASD
    VKLDFSKAQAFKDSVVKKLTGGVEGLLKGNKVEIVQGEAYFVDAHSVRIINGESAQTYTFNNVIIATGSRPVEIPTFKFS
    ERVLNSTGALSLQEVPGKLVVIGGGYIGTELGSAYANLGSQVTIIEGGKDILAGFEKQMTQIVKKGLKKKGVEIEVNASA
    KGVEETENGVVVTYEVGGEEKKVEADYVLVTVGRRPNTDEMGLAEIGVEFGERGLINVDKQCRTNISNIYAIGDIVAGPQ
    LAHKASYEGKVAAEAIAGEKSVVDYLAVPAVCFTDPEMATVGYNEEQAKAEGIEYTAAKFPFAANGRALALNQSEGFVKL
    VARKEDGLLIGAQIVGAGASDMIAEMGLAIEGGMTAEDIALTIHAHPTLGEITMETAEVLLGNPIHIVAKK

    >gi|169827231|ref|YP_001697389.1| hypothetical protein Bsph_1661 [Lysinibacillus sphaericus C3-41]
    MIKEIDIWRTILMKSMETTQLLELLDANEDLYIIDVREEDEVAHGMIPGAQHIALGTIPERLEELDETKPYIIVCKAGGR
    SANACSYLEAQGFDVTNLEGGMLAYDGELEFK

    >gi|169827291|ref|YP_001697449.1| Thiol-disulfide oxidoreductase resA [Lysinibacillus sphaericus C3-41]
    MEKKKKRLVLRTVILAVLALAIGYTVYGTATKEKVELVAVGSEAPDFTLVDLDGEKHKLSDYKGQGVFLNFWGTWCKPCE
    KEMPAMDRQYQIFKDQGVQTLAVNIAQTDFEVQNFVDRYKLSFPVVIDKTKSVMTAYNVGQLPATVLIDPEGKVVKIITG
    EMTDANIASYMELVKPK

    >gi|169827406|ref|YP_001697564.1| thioredoxin reductase, putative [Lysinibacillus sphaericus C3-41]
    MEEKRMNKYDCVIIGGGPAGLSAALTLGRARRKIAIFDNGTNRNRVTQESHGFLTRDGIKPQEFKNIASKEIKSYPSISM
    LDQTIIEITKNDKSGLFLVKTSENKSYMSAKVLLATGIQEEFPLPQIRQYYGKSLFS
    CPYCDGWELRDKPLAIIAEKEEH
    IKHMTKLVFNWSQDLIVFTNGHQLSDNVQSEFERKKIKLYTECVKNLHGEDSNLISIELETGEHILRSGGFVVPNFYRPN
    KFAKQLNCQVDENGIIITDGAGRTTAAGIYVAGETEKGGASSLMIAAAEGFKTASSINLDITIDRF

    >gi|169827407|ref|YP_001697565.1| hypothetical protein Bsph_1841 [Lysinibacillus sphaericus C3-41]
    MKRGITMKLYTKTICPKCLWVKSELQRAGLEAEIVNIDHDEQAKQTIIDAGFLSVPVLEVDETFIGDVQEIVSRIEMITL


    >gi|169827557|ref|YP_001697715.1| methylated-DNA--protein-cysteine methyltransferase [Lysinibacillus sphaericus C3-41]
    MPPFTYGGHYMKRFKLDYQSPIGMIEIEGNTEAIEGINFAEREELIHAPQQDTPTVLLECLKQIHEYFIGERREFSFSYV
    FKGTDFQQAVWHALPNIGYGETASYKDIAVAIHNEKAVRAVGRANGKNTISIVVP
    CHRIIGSNGSLTGYGGGIWRKKWLL
    QHEQSHHLTSNTK

    >gi|169827689|ref|YP_001697847.1| 3-mercaptopyruvate sulfurtransferase [Lysinibacillus sphaericus C3-41]
    MGKVFKSVDEIQFDGVRFIDARFDLQDKEAGKKAFEEGHATGAIHMDLEQQLSDMDSQDGRHPMPNKEKLTSVFQELGLR
    YEDQIVIYDQGAAPFAPRAWWMLKYAGFPNVVIVNGGASALETKVPFTKDVVKYPPTIIDFDWKDELYAPRQAVKAIVDG
    EVKATLLDARAAERYRGEFEPLDKVAGHIPTAKNFDWEQLKKDGQLQANDALRQKVAQDEHVVVY
    CGSGVTASPLYAVLA
    DEGYENIQLYVGSFSDWITQYEVEKGTNE

    >gi|169827805|ref|YP_001697963.1| accessory protein required for the expression of cytochrome c oxidase [Lysinibacillus sphaericus C3-41]
    MKHKRMGLVLLLACVTVLGACGNSKFKADYSLEIPDFEHVNQRGETVSLESLKGKPWIGMYIFTNCVSICPPMSLNMAQV
    QEKLQKKGVEDYNIVAFSVDPDVDTPEVLANYISKYNVPDDSKWNLLTGYSQKYIEQFAVKNTKILVKNDPNSDQVIHGN
    QFFLVDKEGTIVKMYNGFAENIEDVPIDTIASDIETYIDENL

    >gi|169828143|ref|YP_001698301.1| HesB-like domain-containing protein [Lysinibacillus sphaericus C3-41]
    MKMSPEGKNYLEQVLADSEVKTLRFFGIAGCCGVNLGVGLEAPVAEDAIHTIEGIEVAIHPDIAPQLTDVTIHAEEENGE
    LGLVLVGYSPTSC

    >gi|169828168|ref|YP_001698326.1| hypothetical protein Bsph_2656 [Lysinibacillus sphaericus C3-41]
    MNYQVLLYYHYTTIEDPAEFSATHLAMCNEIGLKGRILVANEGINGTVSGTIEQTEQYMANMQADPLFEGIVFKMDAADG
    HAFKKMHVRPRPELVNLGLEEDVNPHELTGRYLSPEQFLAEMQDENTVVLDVRNTYEYDVGHFRGAIRPEVENFRDTPEW
    VRANRELFEGKNVLTY
    CTGGIRCEKFSGWMKREGFGNVGQLHGGVATYGKDPVAKGQLWDGKMYVFDERLTVPINQVEHV
    IIGRDHYDGEPCERYINCANPECNKQIIASEENEAKHLGGCTIECTKHARNRYIVRHHLTEEQVAQTIEALQAEA

    >gi|169828242|ref|YP_001698400.1| peptide methionine sulfoxide reductase msrA [Lysinibacillus sphaericus C3-41]
    MAKQYATFAGGCFWCMVKPFDETPGIESVLSGYTGGHVVNPTYEQVCSETTGHVEAVQIVYDDDLYSYEQLLSIYWTLID
    PTDAGGQFYDRGESYTTAIYYHNEEQRQLAERSKADLEASGKFDKPIMVKILPASTFYPAEDYHQYYYKKNPMHYERYSV
    GSGRRAFQEHHWGNKHE

    >gi|169828243|ref|YP_001698401.1| peptide methionine sulfoxide reductase msrB [Lysinibacillus sphaericus C3-41]
    MNKEQRLKELTDMQYYVTQENGTEPPFRNEFDEHFEEGIYVDIVSGKPLFSSLDKYNSGCGWPAFTKPIQKEEVTEHFDT
    SHGMRRVEVRSKEADSHLGHVFPDGPSELGGLRY
    CINSASLRFVAKEDLEKEGYGQFLSLFK

    >gi|169828263|ref|YP_001698421.1| methionine sulfoxide reductase A [Lysinibacillus sphaericus C3-41]
    MGLFFTKKGGMRLEVVYFAGGCLWGVQAFIKTLPGVVFTEAGRANGTSFTLESDYDGYAECVKTGFDPSVVSIRELMGYF
    FEMIDPYSLNKQGQDVGEKYRTGVYSENPEHLLEAQAFLCKRNDYDLIVVEVLPLTNYVRSAEEHQDRLARCPNDYCHIP
    VELLNKYQ

    >gi|169828346|ref|YP_001698504.1| peptide methionine sulfoxide reductase msrA [Lysinibacillus sphaericus C3-41]
    MIEKATFAGGCFWCMVKPFVEWDGIHKVTSGYMGGHLENPTYEDVKKGTSGHLEVVEIEFDPAIFSYEQLLDIYWMQIDP
    TDAFGQFHDRGESYSTAIFTYTDEQKKIAEASKEKLATSGRFDKPIVTKIRDAERFYPAEDYHQDYYKKEANHYQQDRAI
    SGRDEFITKHWDQ

    >gi|169828431|ref|YP_001698589.1| methylated-DNA--protein-cysteine methyltransferase [Lysinibacillus sphaericus C3-41]
    MNKPTLYWSLLKFKEWKFYVASTSKGLVFVGSQNNPFEELLEWASKHFPGSPLVEDAEKLEPFVDEITQYLEGTRKTFTI
    PFEYVGTPFQLAVWQALCDIPYGETKSYSDIANAINNPAAVRAVGAAIGANPVLITVP
    CHRVIGKNGSLTGYRGGLEMKT
    LLLDLEKRALSSIM

    >gi|169828501|ref|YP_001698659.1| hypothetical protein Bsph_3000 [Lysinibacillus sphaericus C3-41]
    MKKKSILLVLVLAISSILAACGSYKFEPSLNIEVQDFNVTNQKNEQVSLDDLKGKPWLAMFIFTNCTTICPPMTFNMTEV
    QQALQDEGLEDYQIVAFSVDPEVDKPDVLTNYLNTYNVADESKWQLLTGYQQKFIEQFARKSFNSLVKNDPNSDQVIHMS
    SYYLVNADGTVVKDYDGATNVPVETIVGDMKALIKESK

    >gi|169828687|ref|YP_001698845.1| hypothetical protein Bsph_3206 [Lysinibacillus sphaericus C3-41]
    MKQRIDYYDIAPDAMKIMMEMEKYTKKNSIDRKLRELIKIRASQINGCAFCINMHTADAKKMGETEQRLYCISAWRECTF
    YSEEEKVALELTEHITLVSEMRVPDDVYKRVRNYYTEKEYVDLVILINQINSWNRISIAMGNFAE

    >gi|169828690|ref|YP_001698848.1| organic hydroperoxide resistance protein [Lysinibacillus sphaericus C3-41]
    MINEGGRSGTSYAEDQSLSLKIAPPGSKLDNVTNPEQLFAAGYSACFNSALDLIKRQKKLKHASTIQVTVKLMEQATFDY
    VLAVDIEGHIEGVELEEAQQLLELTHTV
    CPYSKATMGNINVTIKAV

    >gi|169828789|ref|YP_001698947.1| molybdopterin biosynthesis protein [Lysinibacillus sphaericus C3-41]
    MLMNNRYSRQQLFSPIGQAGQQAMKQKHVLIVGVGALGSASAEALVRAGVGKLTLIDRDYVEWSNLQRQQLYTEQDAQEK
    LPKVIAAKNRLQQINTEVAIHVAIMEACTESLLPLLDDIDVIVDATDNFDVRFLMNDLAQQHRIPWVYGSCVSSYGATYT
    IVPGKTPCLRCLLKVMPQTGMT
    CDTVGIISPPVQIVAAYQVAEVLKLLVGDDKALRKSYLTFDVWQNQHYEINVDKIRQD
    DCPTCGHHPTYPSLAYENQTKLEVLCGRDAVQIRPPNPTHYNLEQLADQLRPYGDIHMNPYLLSCQTEEYRIVIFQDGRV
    VIHGIQEIQKAKTIYYRLLG

    >gi|169828811|ref|YP_001698969.1| ArsR family transcriptional regulator [Lysinibacillus sphaericus C3-41]
    MHERHLKDLLYQEFARIGKSLSSPKRLEILDILSQGPKSVDALAKSTDMSVANVSQHLKTLFNARLVKFSKEGNFVIYEL
    ADEVIAKFLTTLHALSEKQLIQVQQIKEEFFNEHLGIEGVTPSDLVLRMDKGEVLLLDVRPKEEFEQAHIPGAVSMPIEE
    LENQLSTLPTHIDIVAY
    CRGPYCLMSAEAVKMLKAKGINAFRLEEGVLEWQRLARE

    >gi|169828955|ref|YP_001699113.1| dihydrolipoyl dehydrogenase [Lysinibacillus sphaericus C3-41]
    MAQNYDVVILGGGTGGYVAAIRAAQLGLKTAIVERDRLGGTCLHKGCIPSKALLRSAEVYRMANKTASEYGVDIEGVTLQ
    FDKVQARKQAIVEQLSQGVNTLMKKGKIDVYHGTGRILGPSIFSPMPGTISVEMSNGQENEMLVPTNVVIATGSKPRGMA
    GLTVDGQYVMNSDHALELDNLPKSLLIVGGGVIGIEWASMLCDFGVYVTVLEYGPTILPAEDADIVKEVTKQLEKRGVRI
    VTNARLDADTFKIENDNVFISAKVNEQEEIFEADKLLLCVGREANTQDIGLENTEIEVENGFIKVNDSYQTKESHMYAIG
    DVIGGLQLAHVASHEGLSAIEHIATGKAEHIDDLKVPKCVYSYPEVASIGLTESAAKERGFSLKIGKFPFKAIGKALVNG
    EAEGFVKIIADEETDDILGIHMVGPHVTDLIGEASLAKLLDATPWEISQAIHPHPSLNEVLVESALAVDGRAIHF

    >gi|169829018|ref|YP_001699176.1| hypothetical protein Bsph_3558 [Lysinibacillus sphaericus C3-41]
    MDILITIGVVLVVIIAYIGINALRLKKAVTNLTQEQFIEGYRKAQLIDVREQKEFDAGHILGARNVPSTTLRQRYKEIAQ
    IYQVYLY
    CQNTGRSSRAALFLKKRGYNQIYQLQGGFKTWTGKIKTKKY

    >gi|169829116|ref|YP_001699274.1| hypothetical protein Bsph_3660 [Lysinibacillus sphaericus C3-41]
    MKKLLIIGSVIVVLFAAIIVLTNVSNKSKLESANNPYGDKKLKQETIDQLDDKNYQNIMLPDELEAKIKAGEPVNAYFFS
    PI
    CVHCQAFTPELMPIADELGVDIAQLNVYEYEDLWDKYHIEATPTFIRFEDGKEVNRFVGALKEEDLRNFLNTVVLKK

    >gi|169829484|ref|YP_001699642.1| hypothetical protein Bsph_4044 [Lysinibacillus sphaericus C3-41]
    MNDVEIEKIKGKGNKGENMEKTIGWNLDNSYVQLPSIFYSEMTLNPVPSPKLVLLNETVVASLGLNSQALKNEEGIAVLA
    GNKAPSGSNPIAQAYAGHQFGHFNMLGDGRALLYGEQITPSNERMDIALKGSGRTPYSRGGDGRAALGPMLREYIISEAM
    FGLGIPTSRSLAVVSTGDTIIRETDLPGAILTRIASSHLRVGTFQYAAQWGTDEELQTLADYTLERHFPNYLGDTNPYLY
    LLQEVIKKQASLIAKWQLVGFIHGVMNTDNMTISGETIDYGPCAFMDAYDPATVFSSIDRQGRYAYGNQPSMGGWNLTRL
    AEALLPLIHENQEQAIELAQAALEQYPQLYVQNWLKGMRAKLGLFDEEQDDMKLIEELLQLMQQDKADYTNTFIALSFDH
    IDKTSLWRTSAFKEWHQKWLARLARQPQTKDMSQQLMRQHNPAVIARNHRVEEALEAAVEREDFSVMNKLVTALSQPFAH
    TNEQQEYASLPETSSQPYRTF
    CGT

    >gi|169829498|ref|YP_001699656.1| thioredoxin (TRX) [Lysinibacillus sphaericus C3-41]
    MAIVHATDATFQSDIKEGLVLVDFWAAWCGPCKMIGPVLEEMDAAGSAAKIVKVDVDNNQGTAAEYQIMSIPSLLLFKDG
    ELVDKTVGFQPKEALEAFIAKHA

    >gi|169829529|ref|YP_001699687.1| glutaredoxin family protein [Lysinibacillus sphaericus C3-41]
    MSVTRDIIVWSKQGCSYCDDIKAYLQEQHLPYKTVDVTNHDSFRDILDLKYGVRYVPIVEIGSRESGVYRAITEIGLEHV
    KNALAVSLPSQT

    >gi|169829576|ref|YP_001699734.1| thiol peroxidase [Lysinibacillus sphaericus C3-41]
    MAQVTFKNGPVTLVGNEVKVGDLAPAFTVLANDLSPVTLKDSEGKIRLFSVVPSLDTGVCDAQTRRFNEEAANLGDNVVI
    YTVSVDLPFAQKRWCGAAGIDAVQTVSDHRDLSFGEAYGVYIQELRLLTRAVFVVDENNKVTYVEYVPEATDHPNYEAAI
    AAVKALA

    >gi|169829762|ref|YP_001699920.1| cadmium-transporting ATPase [Lysinibacillus sphaericus C3-41]
    MVATPTKQEYRLQNLSCASCAAKFEKNVKAIPEVEDAQVNFGASKITVVGNISVNQIEEAGAFDGIKVSQSAVRAVEKSI
    PFYRKKENILAGVSLFFVILGYLFVSIQGETNPIPIAMFIIAILVGGMGIFKTGFRNLARFEFDMKTLMTIAIIGAAIIG
    EWEEAAVVVFLFAVSEALEAYSMDKARQSIRGLMDIAPPTAIIKRAHGEHFHELELRTEDIEIGDILIVKPGQKIAMDGI
    VISGLSAVNQAAITGESIPVNKTVNDEVFAGTLNEEGALEVRVTKRVEDTTIAKIINLVEEAQAEKAPSQQFVDRFAKYY
    TPAIIIIAFLVAIIPPLFMGDWQHWIYQGLAVLVVGCPCALVVSTPVAIVTAIGNAARQGVLIKGGIHLEQLGHIEAVAF
    DKTGTLTEGQPAVTDIVTMEGWSEDYVLQLVAAVEKQSQHPLAKAILNRLHDKNLSELVPTDFQSVTGKGAFATVDQQII
    YVGSMKWASTLGSIDKNIENQVKKLQEQGKTVVAAVSKSQLIGLIGIADQLRHESKDVLLKLKALKVKHMVMLTGDAEPT
    AQAIATSLQVTDVRAGLLPEEKLMAIKDLRAQFGAVAMVGDGVNDAPALATANVGIAMGGAGTDAALETADIALMGDDLT
    KLPYTIGLSRKTLRIIKENIIFALALKLIALLLVIPGWLTLWIAIFADMGATLLVVFNSLRLIKAKK

    >gi|169829772|ref|YP_001699930.1| protein-disulfide isomerase [Lysinibacillus sphaericus C3-41]
    MKIEIWSDYVCPFCYIGKKQLEQAIEDTGLGGQVELVYKSYQLDPNTPVDSNITVYESLAKKYGMSLEKAKEMTLGVTAR
    AKEVGLNYDFSNLMEENTLKAHRLVKWAEQQGDVTALVEALLHSHFIEGKRIGQEEVLLDIAEQVGLQREQVAKILAVDE
    FKNEVEADIQEGLQLGVRGVPFFVLNRKYGISGAQPQEVFEDTLCKVAEEEGLQPGLKMAGTGNAGVCTDDNCKL

    >gi|169829825|ref|YP_001699983.1| glutathione peroxidase-like protein [Lysinibacillus sphaericus C3-41]
    MSIYNYLVRKPNGEILSMETFRGKTLLIVNTANQCRFTYQFEDLQKMYDKYGKNNFVVLGFPCDQFGHQNPEDGEETAHL
    CKVNYGVTFPIFELIQVNGETTHPLFNYLKHEVDFREFGKASMQEKMLAEAIVQFAPSFLDGRNIRWNFTKFLVDASGKT
    VARFEPTDSQLDIEQAIEKVL

    >gi|169829830|ref|YP_001699988.1| coenzyme A disulfide reductase [Lysinibacillus sphaericus C3-41]
    MSKKFLIVGGVAGGASTAARIRRLDERAEIIMFEKGPNVSFSNCSLPFHLSGIVENSDKLILMTPQGFQAKYNIEARVQQ
    EVVRINREQKTITIKDLTINREYEESYDTLILSPGASPIVPDLEGIHSEHVFTIRNVTDIERLNRYLQTDHVQDIAVVGG
    GFIGVEVAENLKLAGYNVSLVEFGQQIMAPFDVDMAQILHKEMIDKGVQVIVNDGLAKVTPDYVTLNSGKQLTAQAVVLA
    IGVRPEIHLAKEAGLTIGELGGILVDANYVTSDPSIYAVGDAIEVFHQLTHKQTRLALAGPAQRQARAAANHMFNITQHN
    KGVIGSSSVQIFDLVCASTGLNEKTARANGFQSKSVYLIAPDKVGLMPNSHALHFKLVYETPTGKILGAQAIGKGNADKR
    IDVIATLISMGGTLEDLKELELSYSPMFSTARDIVNLAALVAQNLLHGYFKQIKVDEVRPLIENQAYFLDVREKNEFESG
    HLLHAHNIPLSELRERMHEIPQDQPVYVH
    CRSGQRSYNAVMALQNSGFSNVFNVSGSFLGISLYEYFTDITTNRDKIVTA
    YNFK

    >gi|169829832|ref|YP_001699990.1| peptidoglycan hydrolase [Lysinibacillus sphaericus C3-41]
    MKIEVFTDFTCPFCYIAKLELERAIDTSGYSGQVEIEYKAYQIAPDTPKVSAPTFLDALAIKYNATREEVYDMTANMASR
    AAEVGLYYNFEKMKTAHTEKAHRLAKWTQQFGQASAYTEALMAGHFMAGEDVNDDSFLLKVIGQLGLDINGAQEVLATNA
    FLEALNLDRYDAQQLGIQSVPFFVFENRYGIKGAEPNEVFVRTLHQTAKIVGIQPSIKLVGTGEDTCTNGACNL

    >gi|169829835|ref|YP_001699993.1| hypothetical protein Bsph_4412 [Lysinibacillus sphaericus C3-41]
    MQKWNASQIAKKVINNEELFILDVRNADAFEDWKIEGHRFEYLNVPYFELLDGVEEILPKIPSNKKILVVCAKEGSSLMV
    AEMLSEAGRDVAYLAGGMKSWSEYLEPIKVGDLTGGGELYQFVRLGKGCLSYMVISEGEAAIIDAVRFTDVFISFAEQKN
    VKITHVFDTHLHADHISGGRHIAEATGAVYYLPPKDAEEVVFSYIPLVDGVTVQIGNSKIDVGAIYSPGHTIGSTSFVVD
    SKYLLTGDILFIDSIGRPDLAGLAEDWVGDLRDTLYKRYRELSGELIVLPAHFMIIDELNEDGTVAKRLGDLFVQNHGLN
    IYDEVEFKRVVTDQLPPQPNAYQEIRQVNMGKITPTPDEQTEMEIGPNRCAVR

    >gi|169829837|ref|YP_001699995.1| hypothetical protein Bsph_4414 [Lysinibacillus sphaericus C3-41]
    MEVVMRMKADFQLDAKGLSCPLPIVKTKKAMADLIDGQILEVCATDRGSKADIAAWAETVGHQYIGTLENEGVLKHYIRK
    CTNDQIEEISFDQTIDLEQIINRDGLILDVREEAEFAFGHIEGAKSIPMGELEARLSELDKEQEIYVI
    CRTGKRSDMAAQ
    KLALHGFIKVFNVLPGMTSWQGKLTKNI

    >gi|169829838|ref|YP_001699996.1| rhodanese-like domain-containing protein [Lysinibacillus sphaericus C3-41]
    MKEITAKEVEQAIIQGKKLSLIDVREVEEVAAGHIPGIIHIPLGLLEFRVQDLNKDEPYIMVCRSGARSARATEILEGKG
    FHVSNMVGGMLSWEGEVQY

    >gi|169829839|ref|YP_001699997.1| rhodanese-like domain-containing protein [Lysinibacillus sphaericus C3-41]
    METWIVIAIIAAFFIWRMKPTKGVQSISTVQLKNMLNDKDKIFIDVRTPAEFKGRHISQFKNMPLGSGFNKLPKDKEVVV
    I
    CQSGMRSSQACKQLKKQGFERVTNVRGGMSAY