Listeria welshimeri serovar 6b SLCC5334

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116871957|ref|YP_848738.1| methylated-DNA-protein-cysteine methyltransferase [Listeria welshimeri serovar 6b str. SLCC5334]
    MIPADFEVRVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATLKHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLLE
    GITFKENGHVKMKDHFWQ

    >gi|116871999|ref|YP_848780.1| rhodanese-like domain-containing protein [Listeria welshimeri serovar 6b str. SLCC5334]
    MYQSITANDLEQELKESTQNILDVRDADAFIEGHIPNAINIPINELPEKLATLDKKKAYTIICYAGGRSERASQFLAAEG
    FDVTNVMGGMGAFRGTTTK

    >gi|116872178|ref|YP_848959.1| hypothetical protein lwe0758 [Listeria welshimeri serovar 6b str. SLCC5334]
    MYIRFTESAKNRLQALRSNLAGQLHLYYDTEGCSCENSGIFTLRLVEAKTAEDNEIDSNIGPVLIKRWTEIFLEEALIID
    YDDTAKTMILKSDGQYYNRNLLLVTDKDEVISCPIS

    >gi|116872306|ref|YP_849087.1| OsmC family protein [Listeria welshimeri serovar 6b str. SLCC5334]
    MDLVKNGKVLELVHPNGNWTLIKEEGFSPVQITVAAVAACSGYVYQTLLEKKRIEINDLSIQTDYEQDQESAVHVLTKIN
    VTFTVDLVDKSNQAKAEKAVHLVKEA
    CPVAKSLDPSIEINEIVVFK

    >gi|116872309|ref|YP_849090.1| glutathione reductase [Listeria welshimeri serovar 6b str. SLCC5334]
    MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNVGCVPKKVMWYGAQIKEAMDLYADAYGYQVDASFNF
    QKLVENREAYIERIRGSYKNGLDNNKVEWIKGYAEFVDEKTLRVNGEIVTADHILIATGGEPVLPSIPGAEYGITSDGFF
    ALKELPKKVAVIGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLTDTLTEIIEQSDMMLHKHAVPQKVEKNSDGS
    LTLSLEDGRTETVDTIIWAIGRKPVITGLQIEKAGVELLESGHIAVDKFQNTNVEGIYAVGDVTGHYELTPVAIAAGRRL
    SERLFNNKKDAHLSYENIPTVVFSHPAIGTVGLTEPEAIEKYGKENIKIYTSSFTSMYTAITDHREPCRMKLICEGNTER
    VIGLHGIGYGVDEMIQGFAVAINMGATKSDFDNTVAIHPTGSEEFVTMK

    >gi|116872384|ref|YP_849165.1| glutathione peroxidase [Listeria welshimeri serovar 6b str. SLCC5334]
    MNVHDFSEKAMNGKEISLSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILGFPCNQFLRQDPGSDEEILEF
    CQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEWNFAKFLIDENGEVVERFSSKMKPEDFEDKVEALVANVK

    >gi|116872397|ref|YP_849178.1| methylated-DNA-protein-cysteine methyltransferase [Listeria welshimeri serovar 6b str. SLCC5334]
    MLRQKNESPVGELFITVEDSYLTSIAYDEPTHWEYSVGEENEQDVYKQVIKQMEAYFEGKLECFDVPLLSRGTDFQKRVW
    QALSEIPYGAVVSYKEIAIRAGSPKAVQAVGQANRANPFPIIIP
    CHRCVKSNGELGGYNGADVDKKQYLLALEKGLSFD

    >gi|116872444|ref|YP_849225.1| molybdopterin biosynthesis protein MoeB [Listeria welshimeri serovar 6b str. SLCC5334]
    MERYDRQMRGANIGKKGQETLLSKTILIVGVGAIGSYAAEICARMGFGELILIDRDYVELSNLQRQSLFTEKDALEKQAK
    AYAAQKALRLINSNIKIDYLVDDANMISLTPFAQKVDYILDCTDNFMTRNFLNQFCLINQIPWIFTSCAGNYANLMPIVP
    PDSACLH
    CLLGDIPQTNTASCDIIGVDGALIPIVAGMQVSLLTQMIINPDFKANTYYQLDNWQFTFQSIEVPKRPDCPGC
    TSEKSLSEVPFSEQTVALCGRDTVQFRLPNKSNYREIKQLLAEQKITYKENPALLSFKYKKFQFVIFKNGRVLLHGTENL
    AEAKKTYQLFFN

    >gi|116872449|ref|YP_849230.1| dihydrolipoamide dehydrogenase [Listeria welshimeri serovar 6b str. SLCC5334]
    MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGGVCLNVGCIPSKALITIGHRFKEAGHSDNMGITADN
    VNLDFTKAQEWKGGVVNKLTSGVKGLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYG
    KRVLSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSLVKRNLKSKNVEMVTKALA
    KSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEIGLEQAGVKVTERGLVEVDKQGRSNVSNIFAIGDIVPGVP
    LAHKASYEAKIAAEAIAGEKSENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVRL
    VTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAELALGRPIHM

    >gi|116872604|ref|YP_849385.1| thioredoxin [Listeria welshimeri serovar 6b str. SLCC5334]
    MVKEITDATFEQETSEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKKDG
    EVVETIIGYHPKEELDEVINKYV

    >gi|116872782|ref|YP_849563.1| rhodanese-like domain-containing protein [Listeria welshimeri serovar 6b str. SLCC5334]
    MISWIIAIIILVILLGYEIYQFVMRRKAVKVLTEEEFKKGYRKAQLIDVREPNEFDAGHILGARNIPVTQMKNRTTEIRQ
    DLPVYLY
    CQTAQRSNRAAIMLYKRGYKDVYQLKGGFRKWTGKTKAK

    >gi|116872802|ref|YP_849583.1| dihydrolipoamide dehydrogenase [Listeria welshimeri serovar 6b str. SLCC5334]
    MATEYDVVVLGGGTGGYVAAIQAAKNGQKVAVVEKGKVGGTCLHRGCIPTKALLRSAEVLQTVKKASEFGVSVEGNAGIN
    FLQAQERKQQIVDQLEKGIHQLFKQGKIDLFVGTGTILGPSIFSPTAGTVSVELEDGSENEMLIPKNLIIATGSKPRTLN
    GLTIDEENVLSSDGALNLETLPKSILIVGGGVIGMEWASMLHDFGVEVTVLEYADRILPTEDKEVAKELARLYKKKNLTM
    HTSAEVQAASYKKTNNGVEIKAIIKGEEQTFSADKILVSVGRSANTENIGLQNTDIATENGFIQVNDFYQTKESHIYAIG
    DCIPTIQLAHVAMEEGTIAANHIAGKATEKLDYDLVPRCIYTSTEIASVGITEEQAKERGHDVKKGKFFFRGIGKALVYG
    ESDGFIKIIADKKTDDILGVSMIGPHVTDMISEAALAQVLNATPWEVGNTIHPHPTLAESFREAALAVDGNAIHG

    >gi|116872816|ref|YP_849597.1| hypothetical protein lwe1400 [Listeria welshimeri serovar 6b str. SLCC5334]
    MSDYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVASEGINGTVSGTVEATNKYMDYMANDARFADMVFKIDAAD
    SHAFKKMHVRPRAEIVSLSLEEDVNPLEVTGTYLEPTEFREALLDEDTVILDARNDYEFDIGHFRGAVRPDIQNFRELPG
    WIEENRDQLADKKIVTY
    CTGGIRCEKFSGWLKTAGFEDVSQLHGGIATYGKNEETKGELWDGQMYVFDERIAVPINQVNP
    TIVGKDYFDGTPCERYINCANPYCNKQILASIENEEKYLRSCSHECRVHPANLYTKELSKEEFTERLQAISETSPEMVQ

    >gi|116872866|ref|YP_849647.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria welshimeri serovar 6b str. SLCC5334]
    MTEYTYDVVIIGSGASGTTVAFEAQAAGLKVAIIEERSWGGTCVLRGCDPKKVLIGAAEARNLSTRLRGKGIKQAASISW
    QDLMAFKETFVEDVPESRLESFQEAGIETFFGQAIFQDSHTLQVGKDLLNAEKIVIATGAVPSSLKVEGQEYIQNSDDFL
    SLKELPESVVFIGGGYISFEFASIALAAGREVHIIHHNSEPLKKFDPDFVAALVSNMKEEGVHFHFDIDITKIVKNNGKL
    HIDGKNNFSLNTDLIIGATGRTPNIAHLALEKANIDYTKKGITVNEKMQTVNNEHIYACGDVAASKGAPLTPVVSMEALL
    VAKNILGKDEKINYPAIPSVVFTSPKLASIGISMEEAKANPEKYQIKSHDTTNWYTYKRTNEQLALAKIIEDRETGQIRG
    AHFLSEEADYMINYIAILMKASLTLADLNSVIFAYPSPASDLTALN

    >gi|116873012|ref|YP_849793.1| thiol peroxidase, putative [Listeria welshimeri serovar 6b str. SLCC5334]
    MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTSVCSTQTRKFNEEASNLDNTVVL
    TISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVIMKELRLLARSVFVINAAGEIVYKEVVPEGSDHPNYEAAIE
    AAKKA

    >gi|116873036|ref|YP_849817.1| peroxiredoxin, putative [Listeria welshimeri serovar 6b str. SLCC5334]
    MAERLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTVLFFYPMDFTFVCPTEIVAISARTDEFDALNARIIGASTDT
    IHSHLAWTNTPIKEGGIGKLNYPLAADTNHQVASDYGVLIEEEGVALRGLFIINPKGEIQYEVVHHNNIGREVDEVLRVL
    QALQTGGLCPINWQPGEKTIV

    >gi|116873041|ref|YP_849822.1| thioredoxin family protein [Listeria welshimeri serovar 6b str. SLCC5334]
    MKNLESVEQFDVIKSEGKSVFMFSADWCGDCKYIEPVMPEIEAENEDFTFYHVDRDEFIDLCADLAIFGIPSFLVFEDGE
    EVGRFVSKDRKTKEEINDFLAAI

    >gi|116873288|ref|YP_850069.1| copper-translocating P-type ATPase [Listeria welshimeri serovar 6b str. SLCC5334]
    MSDKYVRQDLNVFGMTCAACSTRIEKSLNKAEGVEKANVNLVTENAAVYYDPEVTSTEDLIKVVKHAGYDAAEKMSKEEK
    DAVLEKNFKKEVRRFILSAVLSLPLLLTMVTHIPYIHEMAFAETIANWINPTIQLVLATIVQFYIGWRFYDGAYKALRGK
    SANMDVLVALGTSAAYFYSVVEYIRHMIDPSVMPHYYFETSAVLITLILLGKLLESYATSRTTESIAGLLELQAKEATVI
    REGKEWLVPVDSLKIGDIILVRPGEKVPMDAEIISGETSIDEAMITGEPVPVEKKPGDSVIGATINFDGAFQAKITKRME
    ETVLESIIRLVEEAQGIKAPIQRLADKISGIFVPIVLGIAALTFIIWYLVTGTMDGSLEAAIAVLVIACPCALGLATPTA
    IMAGTGKGAESGILFKGGEHLERTSKVDTIVFDKTGTLTEGKLEVSDKKATSNQFFPYLFLMEQQSEHPIAKAIIKMLTS
    DNMDVSSIKQGKIRAKAGHGMTGTLDEKKVELGAYRYVSSITSIPKEEDDLIASWMNAGKTVVAMAIDGVYAGALALSDT
    PRPEAKEAIQKLKAQGIKTAICSGDQSVVVENMAKDLGTDMFFAEQLPNDKSALVEKLQQEGHIVAFVGDGINDAPALAA
    SDIGISIGTGTDIAIETGDVTLVSHRLTLIPETIELSRATMRNIRQNFFWALAYNCAGIPIAALGLLAPWVAGLAMAFSS
    VSVVTNALRLKRYKFKS

    >gi|116873294|ref|YP_850075.1| methionine sulfoxide reductase B [Listeria welshimeri serovar 6b str. SLCC5334]
    MDESKKNERLKQLTDIQYNVTQKAGTERPFQNEFYDNAAKGIYVDIVSGKPLFSSTDQYDAGCGWPSFTKPIDEAEVKEH
    KDRTHGMIRTEVKSVDADSHLGHVFPDGPQDKGGLRY
    CINSAALRFIPVDKLDDEGYQAYKKIFE

    >gi|116873295|ref|YP_850076.1| methionine sulfoxide reductase A [Listeria welshimeri serovar 6b str. SLCC5334]
    MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIEITFDPAIFPYEKLVEVYWQ
    QTDPTDAAGQFVDRGDSYRPVIFCHNDEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEG
    YQVASGRAAFIDANWKG

    >gi|116873360|ref|YP_850141.1| hypothetical protein lwe1944 [Listeria welshimeri serovar 6b str. SLCC5334]
    MDYDVIVIGGGPSGLMAAISAAEKNKRVLLIEKGPKLGRKLIMSGGGRCNVTNRRPAEEIIKHIPGNGRFLYSAFHAFDN
    EDIIRFFERLGVALKEEDHGRMFPVSNSARSVAEAMIQRMEKLGVKIYMQTTVKQVDYEGGHVKGVTLKDGQEISASAVI
    VAVGGKSVPRTGSTGDGYAWAKKAGHTITELYPTEVPITSSEPFIKQKVLQGTSLRDVSLSVLNAKGKPIITHQMDMIFT
    HFGVSGPAALRCSMFVLRELKKTGASKVKMRLDLFPNVSAGELAKDVYKMLKENPKKALKNSLSALLQEKLLLFLLEKAE
    LDETAEYKQVSPKKIEQFIHLLKDFTFEVNGTLDFEKAFVTGGGVSVKEIKPKEMQSKLMEGLFFCGEILDINGYTGGYN
    ITCALVTGHTAGAYAAEVSNA

    >gi|116873585|ref|YP_850366.1| thioredoxin, putative [Listeria welshimeri serovar 6b str. SLCC5334]
    MTSIEIKSLEEFQAHISGEELVYVDYWKDNCPNCKMLDLSFAEFKNSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLV
    LYKGGEEIHRLNGFIPPNKIEEAISLNA

    >gi|116873624|ref|YP_850405.1| transcriptional regulator Spx [Listeria welshimeri serovar 6b str. SLCC5334]
    MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLF
    ELIQKNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRRVRTYQLREAQKMVN

    >gi|116873632|ref|YP_850413.1| OsmC/Ohr family protein [Listeria welshimeri serovar 6b str. SLCC5334]
    MKKLYETTVINTGGRSGEVHSLDNVFYFDISAPTELGGDGGGGTNPEQLFAAGYGACFNSALELVLGKAGIDAKSTVTAT
    VSLYSDPEDNGFKIGVVLEGTIEGQDKEKTEALLKKAHEV
    CPYSKATRGNIDVEIKVG

    >gi|116873675|ref|YP_850456.1| O6-methylguanine DNA methyltransferase [Listeria welshimeri serovar 6b str. SLCC5334]
    MEIYYDSIRFLNKEIYFMASEKGLTYVGVDKKQIQHATLDPKQTMKYKEEIVAYLNGELNEFSLATDVNGTALQLEVFEA
    LKTIPYGETRTYTEIAAQIKRPKAVRAVGAAIGKNPVLIVIP
    CHRVIGKNGKLTGYRDGLELKEALLALEKTV

    >gi|116873787|ref|YP_850568.1| thioredoxin [Listeria welshimeri serovar 6b str. SLCC5334]
    MEIWEKETLRAAQKNGANFVVFFFTPMCGSCQIASRLVDVVLEADGIHPDVAKVDLNYVPDIAQHLEITSVPALVKFKSG
    QPVDLSYKLHDATTIYEFLYSE

    >gi|116873789|ref|YP_850570.1| ArsC family protein [Listeria welshimeri serovar 6b str. SLCC5334]
    MINFYWYPKCSTCKKAKAWLENEHVDFNEVDIKTETPSAEELQQWHEANGLPIRRFFNTSGIKYRELGLKDKLDTLSPEE
    AYKLLASDGMLIKRPLTTNGKEVTLGFKEEEFEATWK

    >gi|116873842|ref|YP_850623.1| thioredoxin reductase [Listeria welshimeri serovar 6b str. SLCC5334]
    MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEY
    AYGDIKEVVDGKEFKTVTAGSKTYKARAIIIATGAEHRKLGAAGEEELSGRGVSY
    CAVCDGAFFKNRELVVVGGGDSAVE
    EGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFVWNSTVEEIIGDGKKVTGAKLVSTVDGSESIMPVDGVFIYV
    GLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVRAKSLRQIVTATGDGGLAGQNAQKYVEELKEALEAETAK

    >gi|116874176|ref|YP_850957.1| thioredoxin [Listeria welshimeri serovar 6b str. SLCC5334]
    MAIIFAKEDNLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFSEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLV
    DGEIKGAIAGIVSCDELRSRFKSLAK