Listeria monocytogenes uid43671

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284800282|ref|YP_003412147.1| hypothetical protein LM5578_0027 [Listeria monocytogenes 08-5578]
    MAIIFAKEDDLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLV
    DGEIKGAIAGIVSCDELRSRFKSLAK

    >gi|284800851|ref|YP_003412716.1| hypothetical protein LM5578_0599 [Listeria monocytogenes 08-5578]
    MVPADFEERVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATLKHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSE
    GVTFKENGHVKMKDHFWQ

    >gi|284800889|ref|YP_003412754.1| hypothetical protein LM5578_0637 [Listeria monocytogenes 08-5578]
    MYQSITANDLEQDLKKVPHNILDVRDADAFVEGHIPDAINIPINELPEKLATLDKEKAYTIICYAGGRSERASQFLAAEG
    FDVTNVMGGMGAFHGTVTN

    >gi|284801131|ref|YP_003412996.1| hypothetical protein LM5578_0880 [Listeria monocytogenes 08-5578]
    MYITFTDSAKNRLAALRSNLEGRLHLYYDTEGCSCENSGIFTLRLVEEKTAEDDEIQSNIGPVLIKRWTEMFLEEALTID
    YNDTEKTMILKSDGQYYNRNLLLVTNTDEVISCPVTS

    >gi|284801237|ref|YP_003413102.1| glutathione reductase [Listeria monocytogenes 08-5578]
    MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNVGCVPKKVMWYGAQIKEAMDLYADAYGYQVDASFNF
    QKLVENREAYIERIRGSYKNGLDNNNVDWIKGYAEFVDEKTLRVNGELVTADHILIATGGEPALPSIPGAEFGITSDGFF
    ALKELPKKVAVVGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLTDTLTEIIEQSDMTLHKHAIPQKVEKNPDGS
    LTLSLEDGRTETVDTLIWAIGRKPVIKGLQIENAGVELLESGHIAVDKFQNTNVAGIYAVGDVTGHYELTPVAIAAGRRL
    SERLFNNKKDAHLNYENIPTVVFSHPAIGTVGLTEPEAIEKYGKENIKVYTSSFTSMYTAITDHREPCRMKLICEGKTER
    VIGLHGIGYGVDEMIQGFAVAINMGATKADFDNTVAIHPTGSEEFVTMK

    >gi|284801315|ref|YP_003413180.1| hypothetical protein LM5578_1065 [Listeria monocytogenes 08-5578]
    MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGDNFEILGFPCNQFLRQDPGSDEEILEF
    CQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEWNFAKFLIDENGEVVERFPSKMKPEDFEDKVEALVAKVNN

    >gi|284801328|ref|YP_003413193.1| hypothetical protein LM5578_1078 [Listeria monocytogenes 08-5578]
    MLKRQKASPVGELFITIEDGCIMNISYDKPRNWELLDGNIIEKELFQELMIQLASYFEGERENFDLPMLLKGTDFQKKVW
    QALSEIPYGTVVSYKDIAISAGSPKAVQAVGQANRANPIPIIIP
    CHRCVKSNGELGGYNGTDVDKKQYLLALEKGLSLS

    >gi|284801381|ref|YP_003413246.1| hypothetical protein LM5578_1132 [Listeria monocytogenes 08-5578]
    MERYDRQMRVKNIGKDGQEKLLTKTILIVGVGAIGSYAAEICARMGFGKLILIDRDYVELSNLQRQSLFTEQDALDKQAK
    SYAASKALQLINSDITIEYIVDDANVTSLTPYVGTIDYILDCTDNFMTRDFLNQFCFSHQIPWIFTSCAGNYANLMPIIP
    PDSACLH
    CLLGDIPQTNAASCDIIGVDGALIPIVAGMQVSLLTQMIINPDFKANTYYQLDNWHFSFQTIEVKKRPDCSSC
    APGKMVSEVPFSGQTVTLCGRDTVQFRLPNKSNYREIKLLLTEQKIIYNENPALLSFQYEKFQFVIFKNGRVLLHGSENI
    AEAKKIYHLFFN

    >gi|284801387|ref|YP_003413252.1| dihydrolipoamide dehydrogenase [Listeria monocytogenes 08-5578]
    MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGGVCLNVGCIPSKALITIGHRFKEAGHSDNMGITADN
    VNLDFTKAQEWKGGVVNKLTSGVKGLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYG
    KRVLSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSLVKRNLKSKNVEMVTKALA
    KSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEIGLEQAGVKVTERGLVEVDKQGRSNVSNIFAIGDIVPGVP
    LAHKASYEAKIAAEAIAGEKSENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVRL
    VTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAELALGRPIHM

    >gi|284801553|ref|YP_003413418.1| thioredoxin [Listeria monocytogenes 08-5578]
    MVKEITDATFEQETSEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKKDG
    EVVETIIGYRPKEELDEVINKYV

    >gi|284801736|ref|YP_003413601.1| hypothetical protein LM5578_1490 [Listeria monocytogenes 08-5578]
    MISWIIAIIILVILLGYEIYQFVMRRKAVKVLTEEEFKKGYRKAQLIDVREPNEFDAGHILGARNIPVTQMKNRTTEIRQ
    DLPVYLY
    CQTAQRSNRAAIMLYKRGYKQVYQLKGGYRKWTGKTKSK

    >gi|284801756|ref|YP_003413621.1| dihydrolipoamide dehydrogenase [Listeria monocytogenes 08-5578]
    MAKEYDVVILGGGTGGYVAAIQAAKNGQKVAVVEKGKVGGTCLHRGCIPTKALLRSAEVLQTVKKASEFGISVEGTAGIN
    FLQAQERKQAIVDQLEKGIHQLFKQGKIDLFVGTGTILGPSIFSPTAGTISVEFEDGSENEMLIPKNLIIATGSKPRTLS
    GLTIDEEHVLSSDGALNLETLPKSIIIVGGGVIGMEWASMMHDFGVEVTVLEYADRILPTEDKEVAKELARLYKKKKLNM
    HTSAEVQAASYKKTDTGVEIKAIIKGEEQTFTADKILVSVGRSATTENIGLQNTDIATENGFIQVNDFYQTKESHIYAIG
    DCIPTIQLAHVAMEEGTIAANHIAGKAAEKLDYDLVPRCIYTSTEIASVGITEEQAKERGHEVKKGKFFFRGIGKALVYG
    ESDGFIKIIADKKTDDILGVSMIGPHVTDMISEAALAQVLNATPWEVGNTIHPHPTLSESFREAALAVDGNAIHG

    >gi|284801770|ref|YP_003413635.1| hypothetical protein LM5578_1525 [Listeria monocytogenes 08-5578]
    MHMKYILKGDKIMSDYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDAR
    FADMVFKIDAADAHAFKKMHVRPRAEIVSLSLEEDVNPLEVTGTYLEPSEFREALLDEDTVILDARNDYEFDIGHFRGAV
    RPDIQNFRELPGWIEDNREQLADKKIVTY
    CTGGIRCEKFSGWLKTAGFDDVSQLHGGIATYGKNEETKGELWDGQMYVFD
    ERIAVPINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASVENEKKYLRSCSHDCRVHPANLYTKNLSKEEFTERLQ
    AINESSPEMVQ

    >gi|284801819|ref|YP_003413684.1| hypothetical protein LM5578_1574 [Listeria monocytogenes 08-5578]
    MAKFTYDVVIIGSGASGTTVAFEAQAAGLKVAIVEERNWGGTCVLRGCDPKKVLIGAREARNLSTRLRGKGIKQAATISW
    TDLMAFKETFVENVPESRLASFQEAGIETFFGAASFQDSHSLQVGDDLIYAEKIVIATGATPSTLKVEGKEYIQTSDDFL
    SLEKLPDSVVFIGGGYISFEFASIALAAGRDVHIIHHNSEPLKKFDPDFVAALVANIKDEGIHFHFDTDITKIENDGGKL
    HIKGKDSFSLQTDLIIGATGRMPNIAHLSLENASIDYTKKGIVVNEKLQTPNNPHIYACGDVAATKGAPLTPVVSLEAAL
    VAKNVIGGNEKITYPAIPSVVFTSPKLASIGISTEEAKANPEKYQIKNHDTTSWYTYKRTNEQIALAKIIEDRESGQIKG
    AHFLSEEADYMINYIAILMKANLTLADLQSVIFAYPSPASDLTALN

    >gi|284801975|ref|YP_003413840.1| hypothetical protein LM5578_1730 [Listeria monocytogenes 08-5578]
    MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTSVCSTQTRKFNEEASNLDNTVVL
    TISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVIMKELRLLARSVFVVNAAGEIVYTEVVPEGSDHPNYEAAIE
    AAKKA

    >gi|284801996|ref|YP_003413861.1| hypothetical protein LM5578_1751 [Listeria monocytogenes 08-5578]
    MAERLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTILFFYPMDFTFVCPTEIVAISARSDEFDALNARIIGASTDT
    IHSHLAWTNTPIKEGGIGKLNYPLAADTNHQVASDYGVLIEEEGIALRGLFIINPKGEIQYEVVHHNNIGREVDEVLRVL
    QALQTGGLCPINWQPGEKTIV

    >gi|284802001|ref|YP_003413866.1| hypothetical protein LM5578_1756 [Listeria monocytogenes 08-5578]
    MKNLESVEQFNAIKSEGKSVFMFSADWCGDCKFIEPVMPEIEAENEDFSFYHVDRDEFIDLCADLAIFGIPSFLAFEDGE
    EVGRFVSKDRKTKEEINDFLAAI

    >gi|284802299|ref|YP_003414164.1| hypothetical protein LM5578_2055 [Listeria monocytogenes 08-5578]
    MSDKYVRQDLNVFGMTCAACSTRIEKSLNKADGVEKANVNLVTENAAVYYDPEVTSTEDLIKVVKHAGYDAAEKMSKEEK
    DAVLEKNFKKEVRRFILSAVLSLPLLLTMVTHIPYIHEMAFAETIGNWINPTIQLVLATIVQFYIGWRFYDGAYKALRGK
    SANMDVLVALGTSAAYFYSVVEYVRHIIDPSVMPHYYFETSAVLITLILLGKLLESYATSRTTESIAGLLELQAKEATVI
    REGKEWLVPVDSLKIGDVILVRPGEKVPMDAEIISGETSIDEAMITGEPVPVEKKPGDSVIGATINFDGAFQAKITKRME
    ETVLESIIRLVEEAQGIKAPIQRLADRISGIFVPIVLGIAAVTFIIWYLVTGTVDGSLEAAIAVLVIACPCALGLATPTA
    IMAGTGKGAESGILFKGGEHLERTSKVDTIVFDKTGTLTEGKLEVSDKKAANDQFFPYLFLMEQQSEHPIAKAIIKMLEP
    ENMDVSAIKQGKIRAKAGHGMTGNLDDSKVELGAYRYVSSLTTIPKEDDELIESWMHAGKTVVAMAIDGVYAGALALSDT
    PRPEAKEAIQKLKAQGIKTAICSGDQSVVVENMAKDLGIDMFFAEQLPNDKSALVEKLQQDGHIVAFVGDGINDAPALAA
    SDIGISIGTGTDIAIETGDVTLVSHRLTLIPETIELSKATMRNIRQNFFWALAYNCAGIPIAALGLLAPWVAGLAMAFSS
    VSVVTNALRLKRYKFKS

    >gi|284802305|ref|YP_003414170.1| methionine sulfoxide reductase B [Listeria monocytogenes 08-5578]
    MDESKKNERLQQLTDIQYNVTQKAGTERPFQNEFYDNEAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEN
    RDLNHGMIRTEVKSADADSHLGHVFPDGPQDKGGLRY
    CINSAALRFIPVDKLEEEGYQAYKKIFE

    >gi|284802306|ref|YP_003414171.1| methionine sulfoxide reductase A [Listeria monocytogenes 08-5578]
    MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQ
    QTDPTDAAGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEG
    YQVASGRAAFIDANWKG

    >gi|284802363|ref|YP_003414228.1| hypothetical protein LM5578_2119 [Listeria monocytogenes 08-5578]
    MDYDVIVIGGGPSGLMAAISAAEKNKRVLLIEKGPKLGRKLIMSGGGRCNVTNRRPAEEIIKHIPGNGRFLYSAFHAFDN
    EDIIRFFERLGVALKEEDHGRMFPVSNSARSVAEAMIQRMEKLGVKIYMQTAVKQVDYEDGHVKGVTLKDGQEISASAVI
    VAVGGKSVPRTGSTGDGYAWAKKAGHTITELYPTEVPITSSEPFIKQKVLQGTSLRDVSLSVLNAKGKPIITHQMDMIFT
    HFGVSGPAALRCSMFVLRELKKTGAGTVKMRLDLFPNVSAAELSKDAYKLLEENPKKALKNSLSSLLQEKMLLFLLEKAD
    LEETAEYKQVSPKKIEQFIQLLKDFTFEVNGTLDFEKAFVTGGGVSVKEIKPKEMQSKLMEGLFFCGEILDINGYTGGYN
    ITCALVTGHTAGAYAAEVSNA

    >gi|284802599|ref|YP_003414464.1| hypothetical protein LM5578_2355 [Listeria monocytogenes 08-5578]
    MTSIEIKSPEEFQAHINGEELVYVDYWKDNCPNCKMLDLSFAEFKNSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLV
    LYKGGEEIHRLNGFIPPNKIEEAVSLNA

    >gi|284802638|ref|YP_003414503.1| transcriptional regulator Spx [Listeria monocytogenes 08-5578]
    MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLF
    ELIQKNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRRVRTYQLREAQKMVN

    >gi|284802646|ref|YP_003414511.1| hypothetical protein LM5578_2402 [Listeria monocytogenes 08-5578]
    MKKLYETTVINTGGRSGEVHSPDNVFYFDISAPTELGGDGGGGTNPEQLFAAGYGACFNSALELVLGKAGIEAKSTVTAT
    VSLYSDPEDNGFKIGVVLEGTIEGQDKEKTEALLKKAHEV
    CPYSKATRGNIDVEIKVG

    >gi|284802689|ref|YP_003414554.1| hypothetical protein LM5578_2445 [Listeria monocytogenes 08-5578]
    MTDLYYDTLHFSDTELYFAATKMGLVYVGTKAEKLQSAKRSPEKMNIYKEELAAYLHGELTNFTVPIDLSATPLQIEVFH
    ALKTIPYGETRTYTEIAELINRPKAVRAVGTAIGRNPLLFIIP
    CHRVIGKNGNLTGYSGGIGMKESLLKLEKANLNQFSF


    >gi|284802785|ref|YP_003414650.1| hypothetical protein LM5578_2542 [Listeria monocytogenes 08-5578]
    MANVVVWSKEGCHYCKDVKDFLIEQKIVFQDIDVTDHDYLREVLQAKYGICHVPVVEIGNIENGTYQAVTEIGLEHLEKA
    LFEKEEVK

    >gi|284802862|ref|YP_003414727.1| hypothetical protein LM5578_2619 [Listeria monocytogenes 08-5578]
    MRTAQKKGEDFVVFFFTPMCGSCQIASRLVDVVIEADGIQTEVAKVNLNYVPDIAQSLEITSVPALVKFKNGQPADLSYQ
    LHDATAIFEFLYSE

    >gi|284802864|ref|YP_003414729.1| hypothetical protein LM5578_2621 [Listeria monocytogenes 08-5578]
    MINFYWYPKCSTCKKAKAWLENEHVDFNEVDIKTETPTAEELQQWHEASGLPVRRFFNTSGIKYRELGLKDKLDTLSPEE
    AYKLLASDGMLIKRPLTTNGKEVTLGFKEEEFEATWK

    >gi|284802916|ref|YP_003414781.1| thioredoxin reductase [Listeria monocytogenes 08-5578]
    MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEY
    AYGDIKEVVDGKEFKTVTAGSKTYKARAIIIATGAEHRKLGAAGEEELSGRGVSY
    CAVCDGAFFKNRELIVVGGGDSAVE
    EGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYV
    GLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVRAKSLRQIVTATGDGGLAGQNAQKYVEELKESLEAEAAK

    >gi|284803181|ref|YP_003415046.1| hypothetical protein LM5578_2938 [Listeria monocytogenes 08-5578]
    MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKKPLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKL
    SPAVKLLVDAIEKNPEKKWTDKDFDDLSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESG
    NGFRDAFSKTMGSVPHKSKDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKKLRMRLNAAITPEKKVIIQ
    QIEAELARYFNGELIDFKTPIRYIGSDFQQSVWNELRRIPVGETISYKSLAEKLGRPTASRAVARANGANQLSLIVP
    CHR
    VINTNGALGGYGGGLARKEWLIKHEKMVPK

    >gi|284803272|ref|YP_003415136.1| cadmium-transporting ATPase [Listeria monocytogenes 08-5578]
    MAEKTVYRVDGLSCTNCAAKFERNVKEIEGVTEAIVNFGASKITVTGEASIQQVEQAGAFEHLKIIPEKESFTDPEHFTD
    HQSFIRKNWRLLLSGLFIAVGYASQIMNGEDFYLTNALFIFAIFIGGYSLFKEGFKNLLKFEFTMETLMTIAIIGAAFIG
    EWAEGSIVVILFAVSEALERYSMDKARQSIRSLMDIAPKEALVRRSGTDRMVHVDDIQIGDIMIIKPGQKIAMDGHVVKG
    YSAVNQAAITGESIPVEKNIDDSVFAGTLNEEGLLEVAVTKRVEDTTISKIIHLVEEAQGERAPAQAFVDTFAKYYTPAI
    IVIAALIATVPPLLFGGNWETWVYQGLSVLVVGCPCALVVSTPVAIVTAIGNAAKNGVLVKGGVYLEEIGGLKAIAFDKT
    GTLTKGVPVVTDYIELTEATNIQHNKNYIIMAALEQLSQHPLASAIIKYGETREMDLTSINVNDFTSITGKGIRGTVDGN
    TYYVGSPVLFKELLASQFTDSIHRQVSDLQLKGKTAMLFGTNQKLISIVAVADEVRSSSQHVIKRLHELGIEKTIMLTGD
    NQATAQAIGQQVGVSEIEGELMPQDKLDYIKQLKINFGKVAMVGDGINDAPALAAATVGIAMGGAGTDTAIETADVALMG
    DDLQKLPFTVKLSRKTLQIIKQNITFSLVIKLIALLLVIPGWLTLWIAIMADMGATLLVTLNGLRLMKVKD

    >gi|284803336|ref|YP_003415200.1| NADH oxidase [Listeria monocytogenes 08-5578]
    MKYVIVGTSHAGFEAVQTLLKKDSDAEIVVFEAGSTASFLSCGIQSYLEDISKSLDELHYANEASYKEQGVDIRMNTSVI
    AINPETKEITTRTTDGVEATESYDKLLLSPGGVPGTIPNVDDQHENIFYLRGRNWADKVKNRMSSAKKAVVVGAGYIGIE
    AAIAYAQAGIDVTVVDFVDSILPTYLDSEFTSLLTKHMEEKGMKIKTGEGVKEFKVNENNEVTAVVTDKGTYEADTVIIS
    VGVRPNTQWLKDTLTLDGRGFVEVNEHMETSVKDVYAAGDATAIPFAPTNDKAYIALATNARRQGVIMARHASGDADAKI
    GRVNGTSGLAVFDYKFATTGIKDANANSYQGNVKSVYKEDLIRPSFMHDEEKVLMKLHYDADNGRILGAQLMSTYDILQA
    INAVSVAIEAEWTVDQLAQADFFFQPEFSRPWNFLNVLAQEAQGQPYGADTMLF

    >gi|284802348|ref|YP_003414213.1| hypothetical protein LM5578_2104 [Listeria monocytogenes 08-5578]
    MKKIVLLLALITVVLTVGACSDNKKETEEKANKTEEESATFLTTISTKDFKQKMADKTTGFVYVGRPTCEDCQAFQPILK
    KELKKRQPDQKMAYYNTDKASEKSRDNMIALLEKMDIDSVPTMVYLKDGKVASTYAATDEPAKLTNWMNKVSGEVSE