Listeria monocytogenes serotype 4b F2365 uid57689

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|46906315|ref|YP_012704.1| Ada regulatory protein [Listeria monocytogenes str. 4b F2365]
    MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKKPLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKL
    SPAVKLLVDAIEKNPEKKWTDKDFDELSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESG
    NGFRDAFSKTMGEVPHKSNDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKKLRMRLNAAITPEKTVIIQ
    QIEAELARYFNGELIDFKTPICYIGSDFQQSVWNELRRIPIGETISYKSLAEKLGRPTASRAVARANGANQLSLIVP
    CHR
    VINTNGALGGYGGGLARKEWLIKHEKMVPR

    >gi|46906816|ref|YP_013205.1| methylated-DNA-protein-cysteine methyltransferase [Listeria monocytogenes str. 4b F2365]
    MIPADFEDRVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATLKHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSE
    GVTFKENGHVKMKDHFWQ

    >gi|46906854|ref|YP_013243.1| rhodanese-like domain-containing protein [Listeria monocytogenes str. 4b F2365]
    MYQSITANDLEQDLKKASHNILDVRDADAFVEGHIPDAINIPINELPEKLASLDKEKPYTIICYAGGRSERASQFLAAEG
    FDVTNVMGGMGAFHGRVTK

    >gi|46907031|ref|YP_013420.1| hypothetical protein LMOf2365_0817 [Listeria monocytogenes str. 4b F2365]
    MYITFTDSAKNRLAALRSNLEGRLHLYYDTEGCSCENSGIFTLRLVEEKTAEDDEIESNIGPVLIKRWTEMFLEEALTID
    YNDTEKTMILKSDGQYYNRNLLLVTNTDEVISCPVTS

    >gi|46907141|ref|YP_013530.1| glutathione reductase [Listeria monocytogenes str. 4b F2365]
    MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNVGCVPKKVMWYGAQIKEAMDLYADAYGYQVDASFNF
    QKLVENREAYIERIRGSYKNGLDNNKVEWIKGYAEFVDEKTLRVNGELVTADHILIATGGEPALPSIPGAEFGITSDGFF
    ALKELPKKVAVVGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLTDTLTEIIEQSDMMLHKHAVPQKVEKNPDGS
    LTLSLEDGRTETVDTLIWAIGRKPVIQGLQIEKAGVKLLESGHIAVDKFQNTNVAGIYAVGDVTGHYELTPVAIAAGRRL
    SERLFNNKKDAHLNYENIPTVVFSHPAIGTVGLTEPEAIEKYGKENIKVYTSSFTSMYTAITDHREPCRMKLICEGKTER
    VIGLHGIGYGVDEMIQGFAVAINMGATKADFDNTVAIHPTGSEEFVTMK

    >gi|46907216|ref|YP_013605.1| glutathione peroxidase [Listeria monocytogenes str. 4b F2365]
    MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILGFPCNQFLRQDPGSDEEILEF
    CQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEWNFAKFLIDENGEVVERFPSKMKPADFEDKVEALVAKVNN

    >gi|46907228|ref|YP_013617.1| methylated-DNA-protein-cysteine methyltransferase [Listeria monocytogenes str. 4b F2365]
    MLKQQKTSPVGDLFITIDEKWIRNISYDEPKNWELLEGTIIEKELFQALTIQLDDYFEGKREHFDLPVLLKGTDFQQKVW
    QALSEIPYGVVVSYKDIAISAGSPKAVQAVGQANRANPIPIIIP
    CHRCVKSNGELGGYNGADVDKKQYLLALEKGLSLS

    >gi|46907281|ref|YP_013670.1| molybdopterin biosynthesis protein MoeB [Listeria monocytogenes str. 4b F2365]
    MERYDRQMRVKNIGKVGQKKLLTKTILIVGVGAIGSYAAEICARMGFGKLILIDRDYVELSNLQRQSLFTEQDALDKQAK
    AYAASKALQLINSDIEIEYIVDDANATSLTPYAGAIDYILDCTDNFMTRDFLNQFCFSHQIPWIFTSCAGNYANLMPIIP
    PDSACLH
    CLLGDIPQTNAASCDIIGVDGALIPIVAGMQVSLLTQMIINPDFKSNTYYQLDNWQFSFRSLEVKKRPDCSGC
    ATGKMISEVPFSEQTVALCGRDTVQFRLPNKSNYHEIKQMLTEQKIFYNENPALLSFQYEKFQFVIFKNGRVLLHGTENI
    TEAKKTYHLFFN

    >gi|46907287|ref|YP_013676.1| dihydrolipoamide dehydrogenase [Listeria monocytogenes str. 4b F2365]
    MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGGVCLNVGCIPSKALITIGHRFKEAGHSDNMGITADN
    VNLDFTKAQEWKGGVVNKLTSGVKGLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYG
    KRVLSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSLVKRNLKSKNVEMVTKALA
    KSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEIGLEQAGVKVTERGLVEVDKQGRSNVPNIFAIGDIVPGVP
    LAHKASYEAKIAAEAIAGEKAENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVRL
    VTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAELALGRPIHM

    >gi|46907452|ref|YP_013841.1| thioredoxin [Listeria monocytogenes str. 4b F2365]
    MVKEITDATFEQETSEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKKDG
    EVVETIIGYRPKEELDEVINKYV

    >gi|46907577|ref|YP_013966.1| rhodanese-like domain-containing protein [Listeria monocytogenes str. 4b F2365]
    MISWIIAIIILVILLGYEIYQFVMRRKAVKVLTEEEFKKGYRKAQLIDVREPNEFDAGHILGARNIPVTQMKNRTTEIRQ
    DLPVYLY
    CQTAQRSNRAAIMLYKRGYKQVYQLKGGYRKWTGKTKSK

    >gi|46907597|ref|YP_013986.1| dihydrolipoamide dehydrogenase [Listeria monocytogenes str. 4b F2365]
    MATEYDVVILGGGTGGYVAAIQAAKNGQKVAVVEKGKVGGTCLHRGCIPTKALLRSAEVLQTVKKASEFGISVEGTAGIN
    FLQAQERKQAIVDQLEKGIHQLFKQGKIDLFVGTGTILGPSIFSPTAGTVSVEFEDGSENEMLIPKNLIIATGSKPRTLN
    GLSIDEENVLSSDGALNLETLPKSIIIVGGGVIGMEWASMMHDFGVEVTVLEYADRILPTEDKEVAKELARLYKKKKLIM
    HTSAEVQAASYKKTDTGVEIKAIIKGEEQTFAADKILVSVGRSANTENIGLQNTDIATENGFIQVNDFYQTKESHIYAIG
    DCIPTIQLAHVAMEEGTIAANHIAGKVAEKLDYDLVPRCIYTSTEIASVGITEEQAKERGYEVKKGKFFFRGIGKALVYG
    ESDGFIKIIADKKTDDILGVSMIGPHVTDMISEAALAQVLNATPWEVGNTIHPHPTLSESFREAALAVDGNAIHG

    >gi|46907612|ref|YP_014001.1| hypothetical protein LMOf2365_1403 [Listeria monocytogenes str. 4b F2365]
    MSDYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARFADMVFKIDAAD
    AHAFKKMHVRPRAEIVSLSLEEDVNPLEVTGTYLEPSEFREALLDEDTVILDARNDYEFDIGHFRGAVRPDIQNFRELPG
    WIEDNREQLADKKIVTY
    CTGGIRCEKFSGWLKTAGFDDVSQLHGGIATYGKNEETKGELWDGQMYVFDERIAVPINQVNP
    TIVGKDYFDGTPCERYINCANPYCNKQILASIENEKKYLRSCSHDCRVHPANLYTKNLSKEEFTERLQAIDETLPEMVQ

    >gi|46907661|ref|YP_014050.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes str. 4b F2365]
    MAKFTYDVVIIGSGASGTTVAFEAQAAGLKVAIVEERSWGGTCVLRGCDPKKVLVGAREARNLSTRLRGKGIKQAATISW
    TDLMAFKETFVENVPESRLENFQEAGIETFFGAASIQDSHSLQVGDDLIQANKIVIATGATPSTLKVEGQEYIQTSDDFL
    SLEKLPDSVVFIGGGYISFEFASIALATGREVHIIHHNSEPLKKFDPDFVAALVSNMKEEGIHFHFDTDITKVENKGEKL
    HIHGKDGFSLQTDLIIGATGRKPNIAHLSLENANIDYTKKGIIVNEKLQTTNNPHIYACGDVAATKGAPLTPVVSMEAAF
    VAKNVIGGDEKMIYPAIPSVVFTSPKLASIGISAEEAKAHPEKYQIKNHDTTNWYTYKRTNEQIALAKIIEDRESGQIKG
    AHFLSEEADYMINYVAILMKANLTLSDLQSVIFAYPSPASDLTALN

    >gi|46907814|ref|YP_014203.1| thiol peroxidase [Listeria monocytogenes str. 4b F2365]
    MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTSVCSTQTRKFNEEASNLDNTVVL
    TISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVVMKELRLLARSVFVVNAAGEIVYTEVVPEGSDHPNYEAAIE
    AAKKA

    >gi|46907834|ref|YP_014223.1| peroxiredoxin, putative [Listeria monocytogenes str. 4b F2365]
    MAERLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTILFFYPMDFTFVCPTEIVAISARSDEFDALNARIIGASTDT
    IHSHLAWTNTPIKEGGIGRLNYPLAADTNHQVASDYGVLIEEEGVALRGLFIINPKGEIQYEVVHHNNIGREVDEVLRVL
    QALQTGGLCPINWQPGEKTIV

    >gi|46907840|ref|YP_014229.1| thioredoxin family protein [Listeria monocytogenes str. 4b F2365]
    MKKLESVEQFDAIKSEGKSVFMFSADWCGDCKFIEPVMPEIEAENEDFVFYHVDRDEFIDLCADLAIFGIPSFLAFEDGE
    EVGRFVSKDRKTKEEINDFLAAI

    >gi|46908085|ref|YP_014474.1| copper-translocating P-type ATPase [Listeria monocytogenes str. 4b F2365]
    MSDKYVRQDLNIFGMTCAACSTRIEKSLNKADGVEKANVNLVTENAAVYYDPEVTSTEDLIKVVKHAGYDAAEKMSKEEK
    DAVLEKNFKKEVRRFILSAVLSLPLLLTMVTHIPYIHEMVFAETIGNWINPTIQLVLATIVQFYIGWRFYDGAYKALRGK
    SANMDVLVALGTSAAYFYSVVEYIRHMIDPSVMPHYYFETSAVLITLILLGKLLESYATSRTTESIAGLLELQAKEATVI
    REGKEWLVPVDSLKIGDIILVRPGEKVPMDAEIISGETSIDEAMITGEPVPVEKKPGDSVIGATINFDGAFQAKITKRME
    ETVLESIIRLVEEAQGIKAPIQRLADRISGIFVPIVLGIAAVTFIIWYLVTGTVDGSLEAAIAVLVIACPCALGLATPTA
    IMAGTGKGAESGILFKGGEHLERTSKVDTIVFDKTGTLTEGKLEVSDKKAANDHFFPYLFLMEQQSEHPIAKAIIKMLEP
    ENIDASAVKQGKIRAKAGHGMTGNLDDSKVELGAYRYVSSLTTIPKEDDELIESWMHAGKTVVAMAIDGVYAGALALSDT
    PRPEAKEAIQKLKAQGIKTAICSGDQSVVVENMAKDLGIDMFFAEQLPNDKSALVEKLQQDGHIVAFVGDGINDAPALAA
    SDIGISIGTGTDIAIETGDVTLVSHRLTLIPETIELSKATMRNIRQNFFWALAYNCAGIPIAALGLLAPWVAGLAMAFSS
    VSVVTNALRLKRYKFKS

    >gi|46908091|ref|YP_014480.1| methionine sulfoxide reductase B [Listeria monocytogenes str. 4b F2365]
    MDESKKNERLQQLTDIQYNVTQKAGTERPFQNEFYDNEAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEH
    RDLTHGMIRTEVKSADADSHLGHVFPDGPQDKGGLRY
    CINSAALRFIPVDKLEEEGYQAYKKIFE

    >gi|46908092|ref|YP_014481.1| methionine sulfoxide reductase A [Listeria monocytogenes str. 4b F2365]
    MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVISGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQ
    QTDPTDAAGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEG
    YQVASGRAAFIDANWKG

    >gi|46908151|ref|YP_014540.1| hypothetical protein LMOf2365_1947 [Listeria monocytogenes str. 4b F2365]
    MDYDVIVIGGGPSGLMAAISAAEKNKRVLLIEKGPKLGRKLIMSGGGRCNVTNRRPAEEIIKHIPGNGRFLYSAFHAFDN
    EDIIRFFERLGVALKEEDHGRMFPVSNSARSVAEAMIQRMEKLGVKIYMQTAVKQVDYEDGHVKGVTLKDGQEISASAVI
    VAVGGKSVPRTGSTGDGYAWAKKAGHTITELYPTEVPITSSEPFIKQKVLQGTSLRDVSLSVLNAKGKPIITHQMDMIFT
    HFGVSGPAALRCSMFVLRELKKTGASTVKMRLDLFPNVSAAELSKDVYKLLEENPKKALKNSLSSLLQEKMLLFLLEKAD
    LDETADYKQVSPKKIEQFIQLLKDFTFEVNGTLDFEKAFVTGGGVSVKEIKPKEMQSKLMEGLFFCGEILDINGYTGGYN
    ITCALVTGHTAGAYAAEVSNA

    >gi|46908385|ref|YP_014774.1| thioredoxin, putative [Listeria monocytogenes str. 4b F2365]
    MTSIEIKSPEEFQAHINGEELVYVDYWKDNCPNCKMLDLSFAEFKNSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLV
    LYKGGEEIHRLNGFIPPNKIEEAVSLNA

    >gi|46908425|ref|YP_014814.1| transcriptional regulator Spx [Listeria monocytogenes str. 4b F2365]
    MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLF
    ELIQKNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRRVRTYQLREAQKMVN

    >gi|46908433|ref|YP_014822.1| OsmC/Ohr family protein [Listeria monocytogenes str. 4b F2365]
    MKKLYETTVINTGGRSGEVHSPDNVFYFDISAPTELGGDGGGGTNPEQLFAAGYGACFNSALELVLGKAGIEAKSTVTAT
    VSLYSDPEDNGFKIGVVLEGTIEGQDKEKTEALLKKAHEV
    CPYSKATRGNIDVEIKVG

    >gi|46908514|ref|YP_014903.1| glutaredoxin family protein [Listeria monocytogenes str. 4b F2365]
    MANVVVWSKVGCHYCKDVKDYLTEQKIVFQDIDVTDHDYLREVLQAKYGIRYVPVVEIGDIEKGTYQAVTEIGLEHLEKA
    LFEKEEVK

    >gi|46908595|ref|YP_014984.1| thioredoxin, putative [Listeria monocytogenes str. 4b F2365]
    MRTAQKNGEDFVVFFFTPMCGSCQIASRLVDVVLEADEVHTEVVKVDLNYVPDIAQNLEITSVPALVKFRNGQPADLSYQ
    LHDATAIFEFLYSE

    >gi|46908597|ref|YP_014986.1| ArsC family protein [Listeria monocytogenes str. 4b F2365]
    MINFYWYPKCSTCKKAKAWLENEHVDFNEVDIKTETPTAEEIQKWHEVSGLPIRRFFNTSGIKYRELGLKDKLDTLSPEE
    AYKLLASDGMLIKRPLTTNGKEVTLGFKEEEFEATWK

    >gi|46908650|ref|YP_015039.1| thioredoxin-disulfide reductase [Listeria monocytogenes str. 4b F2365]
    MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEY
    AYGDIKEVVDGKEFKTVTAGSKTYKARAIIIATGAEHRKLGAAGEEELSGRGVSY
    CAVCDGAFFKNRELIVVGGGDSAVE
    EGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYV
    GLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVRAKSLRQIVTATGDGGLAGQNAQKYVEELKESLEAEAAK

    >gi|46909019|ref|YP_015408.1| thioredoxin [Listeria monocytogenes str. 4b F2365]
    MAIIFAKEDDLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLV
    DGEIKGGIAGIVSCDELRSRFKSLAK

    >gi|46907137|ref|YP_013526.1| OsmC/Ohr family protein [Listeria monocytogenes str. 4b F2365]
    MDLVKNGKVLELVHPNGNWTLIKEEGFSPVQITVAAVAACSGYVYQTLLEKKRIEINDLSIHTDYEQDQESAVHVLTKIN
    VTFTVDLVDKSNEAKAEKAVHLVKDA
    CPVAKSLDPSIEINEMVVFK

    >gi|46908136|ref|YP_014525.1| bacteriocin transport accessory protein, putative [Listeria monocytogenes str. 4b F2365]
    MKKILLLLTSITVILTLGACGDNKKETEEKANQTEKESASFLTTISTKDFKQKMADKTTGFVYVGRPTCEDCQAFQPILK
    KELKKRQPDQKMAYYNTDKASEKSRDDMIALLEKMDIDSVPTMVYLKDGKVASTYAATDEPAKLTNWMNKVSGEVSE