Listeria monocytogenes HCC23 uid59203

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|217963420|ref|YP_002349098.1| thioredoxin-disulfide reductase [Listeria monocytogenes HCC23]
    MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEY
    AYGDIKEVVDGKEFKTVTAGSKTYKARAIIIATGAEHRKLGAAGEEELSGRGVSY
    CAVCDGAFFKNRELIVVGGGDSAVE
    EGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKIVSTVDGSESIMPVDGVFIYV
    GLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVRAKSLRQIVTATGDGGLAGQNAQKYVEELKESLEAEAAK

    >gi|217963474|ref|YP_002349152.1| ArsC family protein [Listeria monocytogenes HCC23]
    MINFYWYPKCSTCKKAKAWLESEHVDFNEVDIKTETPTVEEIQKWHEVSGLPIRRFFNTSGIKYRELGLKDKLDTLSPEE
    AYKLLASDGMLIKRPLTTNGKEVTLGFKEEEFEATWK

    >gi|217963476|ref|YP_002349154.1| thioredoxin, putative [Listeria monocytogenes HCC23]
    MKMAQKNGADFVVFFFTPMCGSCQIASRLVDVVLEADSLHAEVRKVDLNYVPEIAQSLEITSVPALVKFKSGQPVDLSYQ
    LHDATAIFEFLYSE

    >gi|217963558|ref|YP_002349236.1| glutaredoxin family protein [Listeria monocytogenes HCC23]
    MANVVVWSKVGCHYCKDVKDYLTEQKIVFQDIDVTDHDYLREVLQAKYGIRHVPVVEIGDIEKGIYQAVTEIGIEHLEKA
    LFEKEEVK

    >gi|217963596|ref|YP_002349274.1| methylated-DNA--protein-cysteine methyltransferase (O-6-methylguanine-DNA alkyltransferase) [Listeria monocytogenes HCC23]
    MVDLYYDTLHFSDTVLYFAATENGLVYIGTQAEKIQSAKQNVEKMHIYKEELLAYLNGELTDFTVPLHLTATPLQMEVFQ
    ALTTIPYGETRTYTEIAAQINRPKAVRAVGTAIGRNPLLFVIP
    CHRVIGKNGKLTGYSGGIRMKESLLKLEKLNLNQLSF


    >gi|217963639|ref|YP_002349317.1| OsmC/Ohr family protein [Listeria monocytogenes HCC23]
    MKKLYETTVINTGGRSGEVHSPDNVFYFDISAPTELGGDGGGGTNPEQLFAAGYGACFNSALELVLGKAGIEAKSTVTAT
    VSLYSDPEDNGFKIGVVLEGTIEGQDKEKTEALLKKAHEV
    CPYSKATRGNIDVEIKVG

    >gi|217963647|ref|YP_002349325.1| regulatory protein spx [Listeria monocytogenes HCC23]
    MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLF
    ELIQKNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRRVRTYQLREAQKMVN

    >gi|217963687|ref|YP_002349365.1| thioredoxin [Listeria monocytogenes HCC23]
    MTSIEIKTPEEFQAHLNGEELVYVDYWKDNCPNCKMLDLSFAEFKNSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLV
    LYKGGEEIHRLNGFIPPNKIEEAISLNA

    >gi|217963930|ref|YP_002349608.1| hypothetical protein LMHCC_0638 [Listeria monocytogenes HCC23]
    MDYDVIVIGGGPSGLMAAISAAEKNKRVLLIEKGPKLGRKLIMSGGGRCNVTNRRPAEEIIKHIPGNGRFLYSAFHAFDN
    EDIIRFFEKLGVALKEEDHGRMFPVSNSARSVAEAMIQRMEKLGVKIYMQTAVKQVDYEDGHVKGVTLKDGQEISTSAVI
    VAVGGKSVPRTGSTGDGYAWAKKAGHTITELYPTEVPITSSEPFIKQKVLQGTSLRDVSLSVLNAKGKPIITHQMDMIFT
    HFGVSGPAALRCSMFVLRELKKTGASTVKMRLDLFPNVSAAELSKDVYKLLEENPKKALKNSLSSLLQEKMLLFLLEKAD
    LDETAEYKQVSPKKIEQFIQLLKDFTFEVNGTLDFEKAFVTGGGVSVKEIKPKEMQSKLMEGLFFCGEILDINGYTGGYN
    ITCALVTGHTAGAYAAEVSNA

    >gi|217963987|ref|YP_002349665.1| peptide-methionine (S)-S-oxide reductase [Listeria monocytogenes HCC23]
    MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQ
    QTDPTDAAGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEG
    YQVASGRAAFIDANWKG

    >gi|217963988|ref|YP_002349666.1| methionine-R-sulfoxide reductase [Listeria monocytogenes HCC23]
    MDESKKNERLQQLTDIQYNVTQKAGTERPFQNEFYDNVAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEH
    RDLTHGMIRTEVKSADADSHLGHVFPDGPQDKGGLRY
    CINSAALRFIPVDKLEEEGYQAYKKIFE

    >gi|217963994|ref|YP_002349672.1| copper-translocating P-type ATPase [Listeria monocytogenes HCC23]
    MSDKYVRQDLNVFGMTCAACSTRIEKSLNKAEGVEKANVNLVTENAAVYYDPEVTSTEDLIKVVKHAGYDAAEKMSKEEK
    DAVLEKNFKKEVRRFILSAVLSLPLLLTMVTHIPYIHEMAFAETIGNWINPTIQLVLATIVQFYIGWRFYDGAYKALRGK
    SANMDVLVALGTSAAYFYSVVEYIRHMIDPSVMPHYYFETSAVLITLILLGKLLESYATSRTTESIAGLLELQAKEATVI
    REGKEWLVPVDSLEIGDIILVRPGEKVPMDAEIISGETSIDEAMITGEPVPVEKKPGDSVIGATINFDGAFQAKITKRME
    ETVLESIIRLVEEAQGIKAPIQRLADRISGIFVPIVLGIAAVTFIIWYLVTGTVDGSLEAAIAVLVIACPCALGLATPTA
    IMAGTGKGAESGILFKGGEHLERTSKVDTIVFDKTGTLTEGKLEVSDKKAANDHFFPYLFLMEQQSEHPIAKAIIKMLEP
    ENMDVSAVKQGKIRAKAGHGMTGNLDDSKVELGAYRYVSSLTTIPKEDDELIESWMHAGKTVVAMAIDGVYAGALALSDT
    PRPEAKEAIQKLKAQGIKTAICSGDQSVVVENMAKDLGIDMFFAEQLPNDKSALVEKLQQEGHIVAFVGDGINDAPALAA
    SDIGISIGTGTDIAIETGDVTLVSHRLTLIPETIELSKATMRNIRQNFFWALAYNCAGIPIAALGLLAPWVAGLAMAFSS
    VSVVTNALRLKRYKFKS

    >gi|217964238|ref|YP_002349916.1| thioredoxin family protein [Listeria monocytogenes HCC23]
    MKKLESVEQFDDIKSEGKSVFMFSADWCGDCKFIEPVMPEIEAENEDFAFYHVDRDAFIDLCADLAIFGIPSFLAFEDGE
    EVGRFVSKDRKTKEEINDFLAAI

    >gi|217964243|ref|YP_002349921.1| 2-Cys peroxiredoxin BAS1, (Thiol-specific antioxidant protein) [Listeria monocytogenes HCC23]
    MADRLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTILFFYPMDFTFVCPTEIVAISARSDEFDALNARIIGASTDT
    IHSHLAWTNTPIKEGGIGKLNYPLAADTNHQVASDYGVLIEEEGVALRGLFIINPKGEIQYEVVHHNNIGREVDEVLRVL
    QALQTGGLCPINWQPGEKTIV

    >gi|217964263|ref|YP_002349941.1| thiol peroxidase Tpx [Listeria monocytogenes HCC23]
    MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYEGKVRLISVVPSIDTSVCSTQTRKFNEEASNLDNTVVL
    TISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVIMKELRLLARSVFVVNAKGEIVYTEVVPEGSDHPNYEAAIE
    AAKKA

    >gi|217964419|ref|YP_002350097.1| pyridine nucleotide-disulfide oxidoreductase family protein [Listeria monocytogenes HCC23]
    MAKYTYDVVIIGSGASGTTVAFEAQAAGLKVAVVEERSWGGTCVLRGCDPKKVLVGASEARNLSTRLRGKGIKQAATISW
    TDLMAFKETFVENVPESRLESFQEAGIETFFGAASFQDSHSLQVGDDLIYAEKIVIATGATPSTLKVEGQEYIQTSDDFL
    SLEKLPDSVVFIGGGYISFEFASIALAAGREVHMIHHNSEPLKKFDPDFVAALVSNMKEEGIHFHFDTDITKVENKGEKL
    HIHGKDGFSLQTDLIIGATGRKPNIAHLSLENANIDYTKKGIIVNEKLQTTNNPHIYACGDVAATKGAPLTPVVSMEAAF
    VAKNVIGGDEKIIYPAIPSVVFTSPKLASIGISAEEAKAHPEKYQIKNHDTTNWYTYKRTNEQIALAKIIEDRETGQIKG
    AHFLSEEADYIINYIAILMKANLTLADLQSVIFAYPSPASDLTALN

    >gi|217964469|ref|YP_002350147.1| hypothetical protein LMHCC_1185 [Listeria monocytogenes HCC23]
    MSDYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARFADMVFKIDAAD
    AHAFKKMHVRPRAEIVSLSLEEDVNPLEVTGTYLEPSEFREALLDEDTVILDARNDYEFDIGHFRGAVRPDIQNFRELPG
    WIEDNREQLADKKIVTY
    CTGGIRCEKFSGWLKTAGFDDVSQLHGGIATYGKNEETKGELWDGQMYVFDERIAVPINQVNP
    TIVGKDYFDGTPCERYINCANPYCNKQILASVENEKKYLRSCSHDCRVHPANLYTKNLSKEEFTERLQAIDETLPEMVQ

    >gi|217964483|ref|YP_002350161.1| dihydrolipoyl dehydrogenase [Listeria monocytogenes HCC23]
    MATEYDVVILGGGTGGYVAAIQAAKNGQKVAVVEKGKVGGTCLHRGCIPTKALLRSAEVLQTVKKASEFGISVEGTAGIN
    FLQAQERKQQIVDQLEKGIHQLFKQGKIDLFVGTGTILGPSIFSPTAGTVSVEFEDGSENEMLIPKNLIIATGSKPRTLN
    GLSIDEENVLSSDGALNLETLPKSIIIVGGGVIGMEWASMMHDFGVEVTVLEYADRILPTEDKEVAKELARLYKKKKLNM
    HTSAEVQAASYKKTDTGVEIKAIIKGEEQTFTADKILVSVGRSANTENIGLQNTDIATENGFIQVNDFYQTKESHIYAIG
    DCIPTIQLAHVAMEEGTIAANHIAGKVAEKLDYDLVPRCIYTSTEIASVGITEEQAKERGYEVKKGKFFFRGIGKALVYG
    ESDGFIKLIADKKTDDILGVSMIGPHVTDMISEAALAQVLNATPWEVGNTIHPHPTLSESFREAALAVDGNAIHG

    >gi|217964503|ref|YP_002350181.1| hypothetical protein LMHCC_1220 [Listeria monocytogenes HCC23]
    MISWIIAIIILVILLGYEIYQFVMRRKAVKVLTEEEFKKGYRKAQLIDVREPNEFDAGHILGARNIPVTQMKNRTTEIRQ
    DLPVYLY
    CQTAQRSNRAAIMLYKRGYKQVYQLKGGYRKWTGKTKSK

    >gi|217964701|ref|YP_002350379.1| thioredoxin [Listeria monocytogenes HCC23]
    MVKEITDATFEKETSEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKKDG
    EVVETIIGYRPKEELDEVINKYV

    >gi|217964852|ref|YP_002350530.1| dihydrolipoyl dehydrogenase [Listeria monocytogenes HCC23]
    MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGGVCLNVGCIPSKALITIGHRFKEAGHSDNMGITADN
    VNLDFTKAQEWKGGVVNKLTSGVKGLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYG
    KRVLSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSLVKRNLKSKNVEMVTKALA
    KSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEIGLEQAGVKVTERGLVEVDKQGRSNVPNIFAIGDIVPGVP
    LAHKASYEAKIAAEAIAGEKAENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVRL
    VTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAELALGRPIHM

    >gi|217964858|ref|YP_002350536.1| molybdopterin biosynthesis protein MoeB [Listeria monocytogenes HCC23]
    MERYDRQMRVKNIGKVGQENYSRNDLIVGVGAIGSYAAEICARMGFGKLILIDRDYVELSNLQRQSLFTEQDALDKQAKA
    YAASKALQLINSDITIEYIVDDANITSLTPYAGTIDYILDCTDNFMTRDFLNQFCFTHQIPWIFTSCAGNYANLMPIIPP
    DSACLH
    CLLGDIPQTNAASCDIIGVDGALIPIIAGMQVSLLTQMIINPDFKANTYYQLDNWQFSFRTIEVKKRHDCLGCT
    TGKALSEVPFSEQTVALCGRDTVQFRLPNRSNYREIKQLLAEQKIPYTENPALLSFHHEKFQFVIFKNGRVLLHGTENIT
    EAKKIYHLFFN

    >gi|217964904|ref|YP_002350582.1| methylated-dna--protein-cysteine methyltransferase (6-o-methylguanine-dna methyltransferase) (mgmt) (o-6-methylguani
    MLKQQKSSPVGDLFITIDEKWIRNISYDEPKNWELQEGNIIEKELFQALTTQLDDYFEGKREHFDLPVLLKGTDFQQKVW
    QALSEIPYGVVVSYKDIAISAGSPKAVQAVGQANRANPIPIIIP
    CHRCVKSNGELGGYNGADVDKKQYLLALEKGLSLS

    >gi|217964917|ref|YP_002350595.1| peroxiredoxin Hyr1 (hydrogen peroxide resistanceprotein 1) (oxidant receptor peroxidase 1) (glutathione peroxidase 3
    MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILGFPCNQFLRQDPGSDEEILEF
    CQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEWNFAKFLIDENGEVVELFPSKMKPADFEDKVEALVAKVSK

    >gi|217964993|ref|YP_002350671.1| glutathione-disulfide reductase [Listeria monocytogenes HCC23]
    MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNVGCVPKKVMWYGAQIKEAMDLYADAYGYQVDASFNF
    QKLVENREAYIERIRGSYKNGLDNNKVEWIKGYAEFVDEKTLRVNGELVTADHILIATGGEPALPSIPGAEFGITSDGFF
    ALKELPKKVAVVGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLTDTLTEIIEQSDMTLHKHAVPQKVEKNPDGS
    LTLSLEDGRTETVDTLIWAIGRKPVIQGLQIEKAGVELLESGHIAVDKFQNTNVAGIYAVGDVTGHYELTPVAIAAGRRL
    SERLFNNKKDAHLNYENIPTVVFSHPAIGTVGLTEPEAIEKYGKENIKVYTSSFTSMYTAITDHREPCRMKLICEGKTER
    VIGLHGIGYGVDEMIQGFAVAINMGATKADFDNTVAIHPTGSEEFVTMK

    >gi|217965110|ref|YP_002350788.1| hypothetical protein LMHCC_1833 [Listeria monocytogenes HCC23]
    MYITFTDSAKNRLAALRSNLEGRLHLYYDTEGCSCENSGIFTLRLVEEKTAEDDEIESNIGPVLIKRWTEMFLEEALTID
    YNDTEKTMILKSDGQYYNRNLLLVTNTDEVISCPITS

    >gi|217965295|ref|YP_002350973.1| rhodanese domain protein [Listeria monocytogenes HCC23]
    MYQSITANDLEQDLKKAPHNILDVRDADAFVEGHIPDAINIPINELPEKLATLDKEKAYTIICYAGGRSERASQFLAAEG
    FDVTNVMGGMGAFHGTVTN

    >gi|217965336|ref|YP_002351013.1| methylated-DNA-protein-cysteine methyltransferase [Listeria monocytogenes HCC23]
    MIPADFEDRVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATLKHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSE
    GVTFKENGHVKMKDHFWQ

    >gi|217965873|ref|YP_002351551.1| Ada regulatory protein [Listeria monocytogenes HCC23]
    MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKKPLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKL
    SPAVKLLVDAIEKNPEKKWTDKDFDELSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESG
    NGFRDAFSKTMGEVPHKSKDITILYSAWLETKLGSMLAISDDESLLLLEFVDRKGLETEIKKLRMRLNAAITPEKTVIIQ
    QIEAELARYFNGELIDFKTPIRYIGSDFQQSVWNELRRIPIGETISYKGLAEKLGRPTASRAVARANGANQLSLIIP
    CHR
    VINTNGALGGYGGGLARKEWLIKHEKMVPK

    >gi|217965962|ref|YP_002351640.1| thioredoxin [Listeria monocytogenes HCC23]
    MAIIFAKEDDLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLV
    DGEIKGGIAGIVSCDELRSRFKSLAK

    >gi|217963945|ref|YP_002349623.1| bacteriocin transport accessory protein, putative [Listeria monocytogenes HCC23]
    MKKILLLLTLITVILTLGACGDNKKETEEKANQTEKESASFLTTISTKDFKQKMADKTTGFVYVGRPTCEDCQAFQPILK
    KELKKRQPDQKMAYYNTDKASEKSRDDMIALLEKMDIDSVPTMVYLKDGKVAATYAATDEPAKLTNWMNKVSGEVSE