Listeria monocytogenes Clip80459 uid59317

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|226222717|ref|YP_002756824.1| Ada protein (O6-methylguanine-DNA methyltransferase) [Listeria monocytogenes Clip81459]
    MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKKPLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKL
    SPAVKLLVDAIEKNPEKKWTDKDFDELSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESG
    NGFRDAFSKTMGEVPHKSNDIIILYSAWLETKLGSMLAISDDESLLLLEFVDRKGLETEIKKLRMRLNAAITPEKTVIIQ
    QIEAELARYFNGELIDFKTPICYIGSDFQQSVWNELRRIPIGETISYKSLAEKLGRPTASRAVARANGANQLSLIVP
    CHR
    VINTNGALGGYGGGLARKEWLIKHEKMVPR

    >gi|226223200|ref|YP_002757307.1| methyltransferase [Listeria monocytogenes Clip81459]
    MIPADFEDRVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATLKHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSE
    GVTFKENGHVKMKDHFWQ

    >gi|226223238|ref|YP_002757345.1| phage shock protein E [Listeria monocytogenes Clip81459]
    MYQSITANDLEQDLKKASHNILDVRDADAFVEGHIPDAINIPINELPEKLASLDKEKPYTIICYAGGRSERASQFLAAEG
    FDVTNVMGGMGAFHGIVTK

    >gi|226223418|ref|YP_002757525.1| YqkB protein [Listeria monocytogenes Clip81459]
    MYITFTDSAKNRLAALRSNLEGRLHLYYDTEGCSCENSGIFTLRLVEEKTAEDDEIESNIGPVLIKRWTEMFLEEALTID
    YNDTEKTMILKSDGQYYNRNLLLVTNTDEVISCPVTS

    >gi|226223526|ref|YP_002757633.1| glutathione Reductase [Listeria monocytogenes Clip81459]
    MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNVGCVPKKVMWYGAQIKEAMDLYADAYGYQVDASFNF
    QKLVENREAYIERIRGSYKNGLDNNKVEWIKGYAEFVDEKTLRVNGELVTADHILIATGGEPALPSIPGAEFGITSDGFF
    ALKELPKKVAVVGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLTDTLTEIIEQSDMMLHKHAVPQKVEKNPDGS
    LTLSLEDGRTETVDTLIWAIGRKPVIQGLQIEKAGVKLLESGHIAVDKFQNTNVAGIYAVGDVTGHYELTPVAIAAGRRL
    SERLFNNKKDAHLNYENIPTVVFSHPAIGTVGLTEPEAIEKYGKENIKVYTSSFTSMYTAITDHREPCRMKLICEGKTER
    VIGLHGIGYGVDEMIQGFAVAINMGATKADFDNTVAIHPTGSEEFVTMK

    >gi|226223601|ref|YP_002757708.1| glutathione peroxidase [Listeria monocytogenes Clip81459]
    MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGANFEILGFPCNQFLRQDPGSDEEILEF
    CQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEWNFAKFLIDENGEVVERFPSKMKPADFEDKVEALVAKVNN

    >gi|226223614|ref|YP_002757721.1| methylated-DNA-protein-cystein methyltransferase [Listeria monocytogenes Clip81459]
    MLKQQKSSPVGDLFITIDEKWIRNISYDEPKNWELLEGTIIEKELFQALTIQLDDYFEGKREHFDLPVLLKGTDFQQKVW
    QALSEIPYGVVVSYKDIAISAGSPKAVQAVGQANRANPIPIIIP
    CHRCVKSNGELGGYNGADVDKKQYLLALEKGLSLS

    >gi|226223667|ref|YP_002757774.1| molybdopterin biosynthesis protein MoeB [Listeria monocytogenes Clip81459]
    MERYDRQMRVKNIGKVGQKKLLTKTILIVGVGAIGSYAAEICARMGFGKLILIDRDYVELSNLQRQSLFTEQDALDKQAK
    AYAASKALQLINSDIEIEYIVDDANATSLTPYAGAIDYILDCTDNFMTRDFLNQFCFSHQIPWIFTSCAGNYANLMPIIP
    PDSACLH
    CLLGDFPQTNAASCDIIGVDGALIPIVAGMQVSLLTQMIINPDFKSNTYYQLDNWQFSFRSLEVKKRPDCSGC
    ATGKMISEVPFSEQTVALCGRDTVQFRLPNKSNYHEIKQMLTEQKIIYNENPALLSFQYEKFQFVIFKNGRVLLHGTENI
    TEAKKTYHLFFN

    >gi|226223673|ref|YP_002757780.1| dihydrolipoamide dehydrogenase, E3 subunit of pyruvate dehydrogenase complex [Listeria monocytogenes Clip81459]
    MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGGVCLNVGCIPSKALITIGHRFKEAGHSDNMGITADN
    VNLDFTKAQEWKGGVVNKLTSGVKGLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYG
    KRVLSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSLVKRNLKSKNVEMVTKALA
    KSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEIGLEQAGVKVTERGLVEVDKQGRSNVPNIFAIGDIVPGVP
    LAHKASYEAKIAAEAIAGEKAENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVRL
    VTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAELALGRPIHM

    >gi|226223833|ref|YP_002757940.1| thioredoxin [Listeria monocytogenes Clip81459]
    MVKEITDATFEQETSEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKKDG
    EVVETIIGYRPKEELDEVINKYV

    >gi|226223952|ref|YP_002758059.1| hypothetical protein Lm4b_01359 [Listeria monocytogenes Clip81459]
    MISWIIAIIILVILLGYEIYQFVMRRKAVKVLTEEEFKKGYRKAQLIDVREPNEFDAGHILGARNIPVTQMKNRTTEIRQ
    DLPVYLY
    CQTAQRSNRAAIMLYKRGYKQVYQLKGGYRKWTGKTKSK

    >gi|226223972|ref|YP_002758079.1| branched-chain alpha-keto acid dehydrogenase E3 subunit [Listeria monocytogenes Clip81459]
    MATEYDVVILGGGTGGYVAAIQAAKNGQKVAVVEKGKVGGTCLHRGCIPTKALLRSAEVLQTVKKASEFGISVEGTAGIN
    FLQAQERKQAIVDQLEKGIHQLFKQGKIDLFVGTGTILGPSIFSPTAGTVSVEFEDGSENEMLIPKNLIIATGSKPRTLN
    GLSIDEENVLSSDGALNLETLPKSIIIVGGGVIGMEWASMMHDFGVEVTVLEYADRILPTEDKEVAKELARLYKKKKLIM
    HTSAEVQAASYKKTDTGVEIKAIIKGEEQTFAADKILVSVGRSANTENIGLQNTDIATENGFIQVNDFYQTKESHIYAIG
    DCIPTIQLAHVAMEEGTIAANHIAGKVAEKLDYDLVPRCIYTSTEIASVGITEEQAKERGYEVKKGKFFFRGIGKALVYG
    ESDGFIKIIADKKTDDILGVSMIGPHVTDMISEAALAQVLNATPWEVGNTIHPHPTLSESFREAALAVDGNAIHG

    >gi|226223985|ref|YP_002758092.1| hypothetical protein Lm4b_01393 [Listeria monocytogenes Clip81459]
    MSDYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARFADMVFKIDAAD
    AHAFKKMHVRPRAEIVSLSLEEDVNPLEVTGTYLEPSEFREALLDEDTVILDARNDYEFDIGHFRGAVRPDIQNFRELPG
    WIEDNREQLADKKIVTY
    CTGGIRCEKFSGWLKTAGFDDVSQLHGGIATYGKNEETKGELWDGQMYVFDERIAVPINQVNP
    TIVGKDYFDGTPCERYINCANPYCNKQILASIENEKKYLRSCSHDCRVHPANLYTKNLSKEEFTERLQAIDETLPEMVQ

    >gi|226224034|ref|YP_002758141.1| glutathione reductase [Listeria monocytogenes Clip81459]
    MAKFTYDVVIIGSGASGTTVAFEAQAAGLKVAIVEERSWGGTCVLRGCDPKKVLVGAREARNLSTRLRGKGIKQAATISW
    TDLMAFKETFVENVPESRLENFQEAGIETFFGAASFQDSHSLQVGDDLIQANKIVIATGATPSTLKVEGQEYIQTSDDFL
    SLEKLPDSVVFIGGGYISFEFASIALAAGREVHIIHHNSEPLKKFDSDFVAALVTHMKEEGIHFHFDTDITKVENKGEKL
    HIHGKDGFSLQTDLIIGATGRKPNIAHLSLENANIDYTKKGIIVNEKLQTTNNPHIYACGDVAATKGAPLTPVVSMEAAF
    VAKNVIGGDEKMIYPAIPSVVFTSPKLASIGISAEEAKAHPEKYQIKNHDTTNWYTYKRTNEQIALAKIIEDRESGQIKG
    AHFLSEEADYMINYVAILMKANLTLADLQSVIFAYPSPASDLTALN

    >gi|226224184|ref|YP_002758291.1| thiol peroxidase [Listeria monocytogenes Clip81459]
    MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTSVCSTQTRKFNEEASNLDNTVVL
    TISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVVMKELRLLARSVFVVNAAGEIVYTEVVPEGSDHPNYEAAIE
    AAKKA

    >gi|226224205|ref|YP_002758312.1| 2-cys peroxiredoxin [Listeria monocytogenes Clip81459]
    MAERLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTILFFYPMDFTFVCPTEIVAISARSDEFDALNARIIGASTDT
    IHSHLAWTNTPIKEGGIGRLNYPLAADTNHQVASDYGVLIEEEGVALRGLFIINPKGEIQYEVVHHNNIGREVDEVLRVL
    QALQTGGLCPINWQPGEKTIV

    >gi|226224210|ref|YP_002758317.1| thioredoxin [Listeria monocytogenes Clip81459]
    MKKLESVEQFDAIKSEGKSVFMFSADWCGDCKFIEPVMPEIEAENEDFVFYHVDRDEFIDLCADLAIFGIPSFLAFEDGE
    EVGRFVSKDRKTKEEINDFLAAI

    >gi|226224456|ref|YP_002758563.1| heavy metal-transporting ATPase [Listeria monocytogenes Clip81459]
    MSDKYVRQDLNIFGMTCAACSTRIEKSLNKADGVEKANVNLVTENAAVYYDPEVTSTEDLIKVVKHAGYDAAEKMSKEEK
    DAVLEKNFKKEVRRFILSAVLSLPLLLTMVTHIPYIHEMVFAETIGNWINPTIQLVLATIVQFYIGWRFYDGAYKALRGK
    SANMDVLVALGTSAAYFYSVVEYIRHMIDPSVMPHYYFETSAVLITLILLGKLLESYATSRTTESIAGLLELQAKEATVI
    REGKEWLVPVDSLKIGDIILVRPGEKVPMDAEIISGETSIDEAMITGEPVPVEKKPGDSVIGATINFDGAFQAKITKRME
    ETVLESIIRLVEEAQGIKAPIQRLADRISGIFVPIVLGIAAVTFIIWYLVTGTVDGSLEAAIAVLVIACPCALGLATPTA
    IMAGTGKGAESGILFKGGEHLERTSKVDTIVFDKTGTLTEGKLEVSDKKAANDHFFPYLFLMEQQSEHPIAKAIIKMLEP
    ENIDASAVKQGKIRAKAGHGMTGNLDDSKVELGAYRYVSSLTTIPKEDDELIESWMHAGKTVVAMAIDGVYAGALALSDT
    PRPEAKEAIQKLKAQGIKTAICSGDQSVVVENMAKDLGIDMFFAEQLPNDKSALVEKLQQDGHIVAFVGDGINDAPALAA
    SDIGISIGTGTDIAIETGDVTLVSHRLTLIPETIELSKATMRNIRQNFFWALAYNCAGIPIAALGLLAPWVAGLAMAFSS
    VSVVTNALRLKRYKFKS

    >gi|226224462|ref|YP_002758569.1| transcription regulator (PilB family) [Listeria monocytogenes Clip81459]
    MDESKKNERLQQLTDIQYNVTQKAGTERPFQNEFYDNEAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEH
    RDLTHGMIRTEVKSADADSHLGHVFPDGPQDKGGLRY
    CINSAALRFIPVDKLEEEGYQAYKKIFE

    >gi|226224463|ref|YP_002758570.1| peptidyl methionine sulfoxide reductase [Listeria monocytogenes Clip81459]
    MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVISGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQ
    QTDPTDAAGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEG
    YQVASGRAAFIDANWKG

    >gi|226224522|ref|YP_002758629.1| hypothetical protein Lm4b_01935 [Listeria monocytogenes Clip81459]
    MDYDVIVIGGGPSGLMAAISAAEKNKRVLLIEKGPKLGRKLIMSGGGRCNVTNRRPAEEIIKHIPGNGRFLYSAFHAFDN
    EDIIRFFERLGVALKEEDHGRMFPVSNSARSVAEAMIQRMEKLGVKIYMQTAVKQVDYEDGHVKGVTLKDGQEISASAVI
    VAVGGKSVPRTGSTGDGYAWAKKAGHTITELYPTEVPITSSEPFIKQKVLQGTSLRDVSLSVLNAKGKPIITHQMDMIFT
    HFGVSGPAALRCSMFVLRELKKTGASTVKMRLDLFPNVSAAELSKDVYKLLEENPKKALKNSLSSLLQEKMLLFLLEKAD
    LDETADYKQVSPKKIEQFIQLLKDFTFEVNGTLDFEKAFVTGGGVSVKEIKPKEMQSKLMEGLFFCGEILDINGYTGGYN
    ITCALVTGHTAGAYAAEVSNA

    >gi|226224759|ref|YP_002758866.1| thioredoxin [Listeria monocytogenes Clip81459]
    MTSIEIKSPEEFQAHINGEELVYVDYWKDNCPNCKMLDLSFAEFKNSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLV
    LYKGGEEIHRLNGFIPPNKIEEAVSLNA

    >gi|226224799|ref|YP_002758906.1| hypothetical protein Lm4b_02218 [Listeria monocytogenes Clip81459]
    MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLF
    ELIQKNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRRVRTYQLREAQKMVN

    >gi|226224807|ref|YP_002758914.1| organic hydroperoxide resistance protein (OhrA) [Listeria monocytogenes Clip81459]
    MKKLYETTVINTGGRSGEVHSPDNVFYFDISAPTELGGDGGGGTNPEQLFAAGYGACFNSALELVLGKAGIEAKSTVTAT
    VSLYSDPEDNGFKIGVVLEGTIEGQDKEKTEALLKKAHEV
    CPYSKATRGNIDVEIKVG

    >gi|226224850|ref|YP_002758957.1| O6-methylguanine-DNA methyltransferase [Listeria monocytogenes Clip81459]
    MTDLYYDTLHFSDTELYFAATKTGLFYVGTKAEKIQSAKRSPEKMNMYKEELVAYLNGELTYFTVPMDLSATPLQLEVFH
    ALEAIPYGETRTYTEIAAQINRPKAVRAVGTAIGRNPLLFIIP
    CHRVIGKNGKLTGYSGGIGMKESLLKLEKAKINQFSF


    >gi|226224889|ref|YP_002758996.1| hypothetical protein Lm4b_02308b [Listeria monocytogenes Clip81459]
    MANVVVWSKVGCHYCKDVKDYLTEQKIVFQDIDVTDHDYLREVLQAKYGIRYVPVVEIGDIEKGTYQAVTEIGLEHLEKA
    LFEKEEVK

    >gi|226224971|ref|YP_002759078.1| thioredoxin [Listeria monocytogenes Clip81459]
    MEIWEKERLRTAQKNGEDFVVFFFTPMCGSCQIASRLVDVVLESDEVHTEVVKVDLNYVPDIAQNLEITSVPALVKFKNG
    QPADLSYQLHDATAIFEFLYSE

    >gi|226224973|ref|YP_002759080.1| hypothetical protein Lm4b_02394 [Listeria monocytogenes Clip81459]
    MINFYWYPKCSTCKKAKAWLENEHVDFNEVDIKTETPTAEEIQKWHEVSGLPIRRFFNTSGIKYRELGLKDKLDTLSPEE
    AYKLLASDGMLIKRPLTTNGKEVTLGFKEEEFEATWK

    >gi|226225026|ref|YP_002759133.1| thioredoxin reductase [Listeria monocytogenes Clip81459]
    MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEY
    AYGDIKEVVDGKEFKTVTAGSKTYKARAIIIATGAEHRKLGAAGEEELSGRGVSY
    CAVCDGAFFKNRELIVVGGGDSAVE
    EGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYV
    GLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVRAKSLRQIVTATGDGGLAGQNAQKYVEELKESLEAEAAK

    >gi|226225380|ref|YP_002759487.1| thioredoxin [Listeria monocytogenes Clip81459]
    MAIIFAKEENLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLV
    DGEIKGGIAGIVSCDELRSRFKSLAK

    >gi|226224507|ref|YP_002758614.1| thioredoxin [Listeria monocytogenes Clip81459]
    MKKILLLLTSITVILTLGACGDNKKETEEKANQTEKESASFLTTISTKDFKQKMADKTTGFVYVGRPTCEDCQAFQPILK
    KELKKRQPDQKMAYYNTDKASEKSRDDMIALLEKMDIDSVPTMVYLKDGKVASTYAATDEPAKLTNWMNKVSGEVSE