Anaplasma phagocytophilum HZ uid57951

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|88606942|ref|YP_504698.1| dihydrolipoamide dehydrogenase [Anaplasma phagocytophilum HZ]
    MDKYEVVIIGSGPGGYIAAIRAAQLGYNVAIVEREDNLGGVCLNWGCIPTKALLKSAQLYKKILSASSFGIKITGDVEVD
    IQSIVAHSRDAVAKLSCGVSMLMKKNGVKVYKGCARIAGKGEIHVDNDGVKSALSAKHIILATGGRPRIATNLDTKLLWS
    SKDAMLPETLPKSLLIIGSGAIGIEFASFYSTIGSKVTIVEMQDRILPLEDRDISLSMHEILKNQGVDIFTACSVMDLVQ
    SASSITAQIVNSGTKDTVTSSFERVICAIGILPNSGNLGLEDTKVQLDKGGFIITDGMCQTSEPGIYAIGDVAGPPCLAH
    KASHEAVICVEGIAKKDGRISTAPSTLHKNNIPSCIYSIPQIASVGLTEDAAKAQGLEIKVGISRASCNGKAIASGESEG
    FVKVILCSKTGELLGAHMLGSEVTEMINGYIVGRQLEATDLDIAHTIFPHPTLSEMMHSAILSAWNEPLDS

    >gi|88607814|ref|YP_504711.1| thioredoxin [Anaplasma phagocytophilum HZ]
    MAHVTEIGDSDFADKVERKSGIVVVDFWAPWCGPCVAFAPQLDKIAERYSGKIDVYKLNVQDHQETPIKFGVSAVPTLIV
    FKNGVESARIVGVNLQQLLSAIDGAIGSQN

    >gi|88607835|ref|YP_504726.1| hypothetical protein APH_0098 [Anaplasma phagocytophilum HZ]
    MGFLRLCLGIFAVLVVFVCSVSSTMLEAKGGDLLSGGEAVELTAQQLLMRLPEDRYLGNEDAPVVMVEYASFSCAHCADF
    ITKVFPRIKKEYIDTGRLLYIYRDFPLDRLSLSAAMLGSCYKDNTAFFSYVRAVFGSYDTLIATYKDLGLLVNIAKISNI
    SDEDFKRCTTDEELMDRVVQQKFLAVNTLDVNATPSFFINGERYSGGHDFDSIAAEIDRVTALQLHR

    >gi|88607760|ref|YP_504749.1| thiol:disulfide oxidoreductase [Anaplasma phagocytophilum HZ]
    MGRVFCLLSLVVLVASFPLISRWVSGVKNQNQQEIEAMIEEYIYKNPHKVVSALSKGQVALNKAEMRKRVLENKDLLEDT
    SYPLFGNKKGEVFLVEFFDYS
    CGYCRTMLPQIKEILADGRVGVMLRDLPLLGEASMLAARAALAVHFINPEKYIDFYYAA
    LVHNKMFSETEIADIAESIGISWEELERSLVQNDERISKMLADTKTLAANLNVSGTPTIVVGDSVFVGASDLQSLRDMIQ
    SAIDAKNK

    >gi|88607392|ref|YP_504764.1| glutaredoxin-related protein [Anaplasma phagocytophilum HZ]
    MDNNLVNRIKHDIENNDVVLYMKGTATAPQCGFSSVVASVLVHLGIAFKDVDVLRDPELREGIKEFSNWPTIPQLYVKGE
    FIGGCDIVREMYQSGELQELLKKKGVITG

    >gi|88607544|ref|YP_504766.1| putative thiol:disulfide oxidoreductase [Anaplasma phagocytophilum HZ]
    MRIVVISVLCLFCAFSAIVFFTYYRRNSATFSYDIVLPTIFGNSTEFNTSEIKKKRRAFVVNVFASWCTVCMQEHQTWKE
    ISKRTPIDLYGIDYIDIEDNALAWLQEPDNPYIAIAADYSGKAAKAFGVTGVPETFIFNKKGELVLHIKGSITWELWQER
    VAKLIS

    >gi|88607350|ref|YP_504998.1| dihydrolipoamide dehydrogenase [Anaplasma phagocytophilum HZ]
    MGSSNYDVAVIGAGPGGYKCAIKAAKLGLSVVCIDKNSQWGGTCLRVGCIPSKAMLEYSYKFHSAKDLFPKLGVMAKDVA
    FDLKKMFEVRDNEIAVLSSGIDGLFSAAGVHKLRAEAKIAGKKGDFFEVVLSNQDGSLGQVLARNVVLATGSTPTSLPGI
    DVDGDSVIFSDGALSMDVPKRLLVIGGGAIGLEMSSIWSRLGSEVTVVEYADKIASGFDADISKALQGFLEKQGIKFNLA
    QKVVSVAKGNTGLLVNCESVVNGAMASMEVDKVLVAVGRSPSITGVVAMDGLLLDNRGFVCVNNRYETSIKGIYAIGDVI
    GGAMLAHKAEIEGHAVAELIAGNVTQVDYGVIPAVIYTHPAAASVGRGEESLKSVNYKYKVGKSSFAANGRARVACDSDG
    FVKVIACKETDVILGVHIVGAHADTMINEAAVALGYRATAKDICHICHSHPDVNEVFRDACEVVSHKR

    >gi|88607417|ref|YP_505240.1| thioredoxin-disulfide reductase [Anaplasma phagocytophilum HZ]
    MSEVHKDAVKVLILGSGAAGCTAAIYAGRANLNPVLVTGMQPGGQLTITTDVENYPGFSAIEGPKLMEYMQEQAVKSGAT
    LLTDEISEIDASVYPFKCTSMFGETLQAYSIIVATGAQAKWLGLESEQNFKSKGVSA
    CATCDGAFFKDEVVAVIGGGNTA
    VEEALYLTRSSKKVFLIHRRDKLRAEAVMQQRLFSNSKIEVIWNSVVKEILGDSEGKKVTSLLLQSTVDSTESLLDVGGV
    FVAIGHTPNTQVLKNMLGAKVNLDDEGYVITAPGTTITSCPGIFAAGDVCDKVYRQAVVAAGSGCMAALDAEKYLAEKGI
    E

    >gi|88607183|ref|YP_505241.1| anti-oxidant AhpCTSA family protein [Anaplasma phagocytophilum HZ]
    MRRLMNLVTKPAIDFTARAVMSDGKMCDLTLSKHVAGKYAVLFFYPRDFTFVCPTEILSLHSRIPQFSEQNAEVIAISTD
    SEFAHSHWRNTPLEKGGIGMVSFPLVADDSHSISESYGMLFAGKVSLRGTIIIDENFVVRHQSINDLPIGRNVDEFLRII
    DAIEHHKKHGEVCPAGWSKGKVAMEATQQGVEHYLQSHIDSLS

    >gi|88607054|ref|YP_505258.1| iron-sulfur cluster assembly accessory protein [Anaplasma phagocytophilum HZ]
    MDDKGREVPVVITDAALRRMKELLLAKGDEAENVAIRILIKQKGCYGLKYHIEYAYDVRPLEVKVEKVIDEFSVTILIEP
    KAMMFIRGTVIDYYSDKLSSGFTFKNPNEKGRCGCGESFYV

    >gi|88607053|ref|YP_505314.1| pyridine nucleotide-disulphide oxidoreductase family protein [Anaplasma phagocytophilum HZ]
    MEYSSVFDVAIVGAGPVGLFTVFQAGMLGMNSCVIDALDIVGGQCAVLYPEKPIYDIPGYPMITAQDLVNNLKKQAEPFA
    PVYIMGQFVESISEGPDCFVLQTNKGTSVKCRAIIVAAGSGGFGPNRPPLDGIMEYENKSVFYNVSQMATFKNKKVVIAG
    GGDSAADWAVNLAEVADKLYVIHRRKSFRCAPNTLKKLEELADEGRINVLIPYQLAGLDGENGELRSVVVRNITTKEEIP
    IGADFLLPFFGISANLGEIVNWGLGVEGFQIPVEQSTCRTRRSKIYAVGDIAAYPGKIKLILVGFSEAALACQDIRAVLF
    PDTPLNFQYSTSKGIPTL

    >gi|88607185|ref|YP_505372.1| anti-oxidant AhpCTSA family protein [Anaplasma phagocytophilum HZ]
    MVVREGDKAPGFKEEEGVVFPILASYYGNKNVVLYFYPKDDTPGCTKEAEGFRDANDKFANLNTAVVGVSRDSITSHENF
    KKKYQLPFELIADEEAILAKAYGVWVEKSMFGKCYMGIERSTFLIDKCGILKRIWRNVKVHDHVDTVLKAVNEL

    >gi|88607379|ref|YP_505380.1| iron-sulfur cluster assembly accessory protein [Anaplasma phagocytophilum HZ]
    MYGIESYGLTITGGAVNKIKSVLEREGHPSLLRLSVQGGGCAGFKYEFTTESIRDGLIGRSDGDDDSEFDIDDEEEEEDE
    DGHDEVRGGSDLVLSDDSGAPILLIDRHSKKFLKNSTIDYVEDMNGSRFVVNNPGVKFGCGCGNSFSL

    >gi|88607279|ref|YP_505496.1| DsbB family disulfide bond formation protein [Anaplasma phagocytophilum HZ]
    MKKCGALFFVGSVIALAIAYVAQMFFGLVPCKLCLYERVPYFIALIPSIIMMFKNFKGLFFVVVICYVAGIIISIYHAGL
    EYGWFTDFLH
    CAGDVGFGTSLEDIKANLLSKEEVVSCKVPSFVFMGISLSGWNAVYAISILICAFLLRVRYTRDHHK

    >gi|88607081|ref|YP_505623.1| dihydrolipoamide dehydrogenase [Anaplasma phagocytophilum HZ]
    MDKYEVVIIGSGPGGYIAAIRAAQLGYNVAIVEREDNLGGVCLNWGCIPTKALLKSAQLYKKILSASSFGIKITGDVEVD
    IQSIVAHSRDAVAKLSCGVSMLMKKNGVKVYKGCARIAGKGEIHVDNDGVKSALSAKHIILATGGRPRIATNLDTKLLWS
    SKDAMLPETLPKSLLIIGSGAIGIEFASFYSTIGSKVTIVEMQDRILPLEDRDISLSMHEILKNQGVDIFTACSVMDLVQ
    SASSITAQIVNSGTKDTVTSSFERVICAIGILPNSGNLGLEDTKVQLDKGGFIITDGMCQTSEPGIYAIGDVAGPPCLAH
    KASHEAVICVEGIAKKDGRISTAPSTLHKNNIPSCIYSIPQIASVGLTEDAAKAQGLEIKVGISRASCNGKAIASGESEG
    FVKVILCSKTGELLGAHMLGSEVTEMINGYIVGRQLEATDLDIAHTIFPHPTLSEMMHSAILSAWNEPLDS

    >gi|88607391|ref|YP_505702.1| glutaredoxin 3 [Anaplasma phagocytophilum HZ]
    MRDVVIYTKVPCPYCTRAKALFNKKSIPFKEIDITNDPAAQLEMVERSGRKTVPQIFIDGESIGGCDDLYELYESGKLEL


    >gi|88607903|ref|YP_505713.1| adenylyltransferase thiF [Anaplasma phagocytophilum HZ]
    MKERYSQQVLVPEVGAQGQKRLLSSSVLVVGCGGLGSTTIPILAASGIGRLVLCDDDTVKISNLNRQTIYREEDIGLSKV
    DVATRFVNKLNRDVEVIGLKAAIGPRNFNTVLNDVDIVVDCVDRLAVKLFLNDACVAKNKVLIHSVAIGFVGELMVINPG
    KSPCYRCFFEQQPVSTDLN
    CARAGVIGATVGVVGSMAAGEVIKHVIGVSQPNTGKLHRIDLLNHNFTTYEFSKNPKCMCC
    GTDSTTDPYDLESYEGKLRQHE

    >gi|88607934|ref|YP_505744.1| thiol:disulfide interchange protein, truncation [Anaplasma phagocytophilum HZ]
    MDTTLLDALVLAFAGGVLLNFMPCVFPILSLKIISVVRQKSAGDNRILQDCVFYTVGVLATMLVLTGVLFIFRTTGNLLG
    WGFQLQSPFLVTLLLYVTFLLGLSFSGYYEITFGISILGRAGSQNLESFLTGVLSTLIGTPCAAPFMVSAVSFSLLQPGL
    HSIFIFQFMGLGMVFPYLAFSCIPGAIMLLPKPGKWMECLKQLLAFPMYLTAAWLLHVLVSQKGVAALFPTICSIIAIAF
    LTWIIKNVVKSGSTLRDAAALCFTIIFVVTSAMYISKLEVAEDTPIHKGFVAFSEDSLQDLLDKGETVFVAVGAEW
    CLTC
    KTNELIINSEAIQRIFHTHGVKQMKADWTNMDSGIAQYLHSMGSSSVPFYVLYVHGKPTTEPIPQIFSEAKLTDFLLRSL
    TD

    >gi|88606924|ref|YP_505797.1| hypothetical protein APH_1280 [Anaplasma phagocytophilum HZ]
    MVPKILYNKYFIAVFCVIALASFALIGSIDNAEYELEKAEIHIKEINSDEALYKLVSDIGSGPTLLVLYTSWCSNCIEKM
    PDIIEALSRYRDVKPMIISLDTSRSKLAAFLRDQKIINFEPYNVSSEYHGKLAYALSGKGVYFSGKIPFIAIIGDNTAPI
    TNVYNKRALFAAIASVSKANNE

    >gi|88607529|ref|YP_505820.1| hypothetical protein APH_1306 [Anaplasma phagocytophilum HZ]
    MAAVSTPTLDEKFVARDFSLRSVDGNFYGLDALKGGAALLVMFLCNHCPYVKAIIKRLVVDVKELMEKHDVRAVAIMPND
    TVAYPEDSYDKMVSFAAEHGFPFHYLIDETQDVARSYGAVCTPDFFCFNRDLQLCYRGRFDDQKAVEGALGASELYEAVK
    FIATTGGVPENQKPSIGCSIKWRCVDDILS

    >gi|88607263|ref|YP_505606.1| major surface protein 5 [Anaplasma phagocytophilum HZ]
    MKTFKTVSNLLLLVATVFLGYSYVNKKGIFSDMGAKLSSTDTVVEQAPILASFTDLINQEGQVVSSTDFAGKHMLLMFGF
    SS
    CKHICPAELGMVSQLLNKLGETADKLQAVFITIDPKNDTVERLNEYHKAFDSRIQMLTGDEEVIRNVVNNYKVYVGES
    DSEGDINHSSFLYLVDADGRYVGHFAPDFDEYESQVGRLFDFVNKYLNS