Acidaminococcus fermentans DSM 20731 uid43471

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284047494|ref|YP_003397833.1| electron transport complex, RnfABCDGE type, A subunit [Acidaminococcus fermentans DSM 20731]
    MHSTFGILFSSIFVSNIILSRFLGMCSFLGVSKNFKNSVGMSAAVSFVMLLSTMLSYACYHLLLVPYHLEYLKTLVFILA
    IATLVQLVEMFMKKAMPSLHKAMGIYLPLITTN
    CAILGIALINVESNYSFLDSCVNSIGTSIGYTMAILLFSCIRERLDE
    KALPKCLQNLPIALITASCMSISMMGMSGIH

    >gi|284047495|ref|YP_003397834.1| electron transport complex, RnfABCDGE type, E subunit [Acidaminococcus fermentans DSM 20731]
    MLHELTKGIIKENPLFVQLLGVCPSLATSTSLTNAIGMGCAFTFVLVFTNMIIAAIRKLIPDQIHIPCYIVVIASVVTVL
    EMLMNAFVPALYAALGVFVPLIVVN
    CIVLGRAEAFACDHGVIDSAMDAIGMGIGFTFALSCIAFFRELVGAGKLFDHAVL
    PAAYQPVLIFILPAGAFLTMGFVFAAVNYFKERGAHNA

    >gi|284047548|ref|YP_003397887.1| methylated-DNA/protein-cysteinemethyltransferase [Acidaminococcus fermentans DSM 20731]
    MDETGLYTDRVGTPLGDMIMTSHGEALLGLWFQGERYEPGEQELAGARRNPDLPVFQETRRWLELYFQGKDPGFTPPLEL
    SGSVFRQQVGRIMLTIPYGKTMTYGAIAREMAGKTGKKQMSAQAVGGAVGHNPISLIIP
    CHRVVGSSGSLTGYGGGMPRK
    VWLLEHEGIDLKASGFTIPKKGTAL

    >gi|284047576|ref|YP_003397915.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Acidaminococcus fermentans DSM 20731]
    MLYDIAIVGGGPAGCSAAVTAANRSLGTLLLDTGDFGLALRKSHLVKNYLGLPDRSGVELMDAFTAHMKAAGTTVVPHKV
    LSIMPREKSFFLATPGDVYEARSVILCPGAAHGKPLEGETALLGKGVSY
    CATCDGFLYRGKTIGVVTNLPSAWEEVEFLA
    GLAAEVKLWADFSLSEEKPANVTVMAGKPRKILGEGKAEALETTAGTEPLDGLFLLRETDPLDRLLPGLRLDGPFIRVDG
    NLATSVPGVFAAGDAAGYPWQINKAAGEGQKALLSAAFWLRENPV

    >gi|284047771|ref|YP_003398110.1| redox-active disulfide protein 2 [Acidaminococcus fermentans DSM 20731]
    MVIQVMGGGCSKCETLLENVKEAVAHTGKTAEIQYVTDFAIIAGKGIMSTPALVIDGKVVSSGRVLKTKEIESLLG

    >gi|284048015|ref|YP_003398354.1| Peroxiredoxin [Acidaminococcus fermentans DSM 20731]
    MLEIGTAAPDFTLPDQNGEMHSLSDYRGRKVVLYFYPRDNTPGCTKQACAFGDLYPQFQEKGAVVLGVSKDSVASHKKFE
    EKYGLPFPLLSDPEKTVLQAYDVWKEKKLYGKVSMGVVRSTYLIDEQGIIVKALGKVKPAENPAQMLEELG

    >gi|284048180|ref|YP_003398519.1| thioredoxin [Acidaminococcus fermentans DSM 20731]
    MEMMHIGSADAFDKLVQSGDKPVLVDFWATWCGPCRMLAPVIEELAGEHPEVQFAKLDVDQVPDVAMRFGVSAIPTVVLF
    KAGKEVQRFVGVEPKGAYEQALAAL

    >gi|284048238|ref|YP_003398577.1| Heavy metal transport/detoxification protein [Acidaminococcus fermentans DSM 20731]
    MKKSYKVEVDCANCAAKMEEAVKATPGVQDAVLNFMLLKLKVTFAEGADPAEVMGRCQAAVAKLDDDFKIYC

    >gi|284048315|ref|YP_003398654.1| DSBA oxidoreductase [Acidaminococcus fermentans DSM 20731]
    MKIELWSDYACPFCYIGEKRLEKALAEIDGGDKVEIEFKSFELDPYASREVVSSTVDRFAAKYHLSKEEAAERIEAISRM
    GRSEGIDFRYVSTRYTNTFDSLRLTKYAQEKGKTGIITKLFDAYFTRNLKLSDHDVLTQIAGECGLDKDEVTAVLSGDRY
    ADEVRADEQEAMEHGIHGVPYFLINGKYTASGAQPTAMLKKAIEKILAEETSAATSLDGMVCGADGCHIVQ

    >gi|284048355|ref|YP_003398694.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Acidaminococcus fermentans DSM 20731]
    MKAKMILTALFASAVLLAAGCGGSSGGAQTNAPASSQASAQKAAAPGFTLKEAAGPERTVQPGDGKVYVINFWATWCPPC
    RSEMPELNTFAQKHKEKVQFYGVNLQEEGDKVQGFLKDNGYTMPVLLDQEGKAATLYKVRVIPTTVILDEKGNILQRHEG
    VITAQQLETLLKGKL

    >gi|284048502|ref|YP_003398841.1| thioredoxin [Acidaminococcus fermentans DSM 20731]
    MKVYYIFDSYCGWCYGFETILKPFIEAHPELEVTVLSGGLFMDGHSLSAFPYMSDTNKRIADMFGVEFGKPYLNLLETGS
    MVPDSNDAAIGFGVLRSFLPKGEHVNLASKMHEAFYLDGKSLSDVETIGSIAKSYDLPADKIAEEFIRISEEGKYHPDFY
    EARKIGVTSFPTLFLEINGKHYDLKGSAITLNDLEENLNIIKEKGGILNDGYNTPVA

    >gi|284048540|ref|YP_003398879.1| anaerobic ribonucleoside-triphosphate reductase [Acidaminococcus fermentans DSM 20731]
    MYSVVKRDGQIVDFDVTKISSAITKAFEALHKNYHPSIINMLALQVTADFDPKIKDDRISVESIQDSVEKVLSDSGYADV
    AKAYILYRKQREQIRNVNSSLLNYKDLVDNYLHVNDWRVKENSTVTYSVGGLILSNSGAITANYWLNEIYDKEVADAHKS
    AAMHIHDLSMLTGYCAGWSLKQLIQEGLGGIPGKITSSPASHLSTLCNQMVNFLGIMQNEWAGAQAFSSFDTYLAPFVKK
    DNLSYKEVKQCVQSFIYGVNTPSRWGTQAPFSNITLDWTCPDDLKDVPAIVGGKEQDFTYGDCKKEMDMVNKAFIENMIE
    GDANGRGFQYPIPTYSITRDFDWSETENNRLLFEMTAKYGTPYFSNYINSDMKPSDVRSMCCRLRLDLRELRKKSGGFFG
    SGESTGSVGVVTINMPRIAYLARDKKDFYDRLDHMMDIAARSLKTKRTVITKLLDAGLYPYTKRYLGTFKNHFSTIGLIG
    MNEVGLNANWLRKDLTHPETLAFTKEVLTHMRERLKDYQEQYGDLYNLEATPAESTTYRLAKHDKEQYPDIITANEHGTP
    YYTNSSHLPVGYTEDLFTALDMEDDLQTLYTSGTVFHAFLGEKLPDWNSAAGLVRKIASNYKLPYFTLSPTYSICREHGY
    LSGEQYTCPYCGKKTEVYSRITGYYRPVQNWNDGKIQEFKDRKVYDLGQSHLKKEEAPAERPVFRKPSVKTAPTEARQVA
    STGGDKGWILFGTHT
    CPNCKMAVRELEKHGAAFTEIFAEEHPELAEKYQVQSAPTLLVNQGDTLNKIVGFGPIRAFIRQQ
    GM

    >gi|284048673|ref|YP_003399012.1| PP-loop domain protein [Acidaminococcus fermentans DSM 20731]
    MTMNLSQWDDKTEITVEELAGLSPDQRFLADIRDPAAFDRGTVPGAMNLNPLALQEGSVDLPEDRLIVLVCMWGKISLGL
    AANLRDQGYTAVSLAGGYSLWLQKRLERENALAAEDSQRLKRIESSLRRKYKRRISSKFVQAICDYAMIQPGDKIAVCIS
    GGKDSMLMAKLFQDLKRHNKIPFDLVFLCMDPGYNAMNRKIIEENAKLLQVPLTFFSTEIFEAVFHVEDSPCYLCAKMRR
    GYLYRKARELGCNKIALGHHFDDVIETNLMSMLYSGAIRTMLPRLKSTSCPGMELIRPLYYVREEDIKSWRDENGLYFIQ
    CACKFTETCSTCHTDGTTDSKRLEVKKLIAALAEKNPQVPANIFHSLENINLDTVLKYKQNGKEHSFLEEM

    >gi|284048765|ref|YP_003399104.1| Redoxin domain protein [Acidaminococcus fermentans DSM 20731]
    MEKRTVNFAGNPVALVGPEVKVGQQAPDFKLLDNKLGEKTLKDYAGKIKVISVVPSLDTGVCDAQTRWFNQDVTGLSPDV
    VVLTVSMDLPFAQARWCGAAGVENVVTLSDHRDADFGKNYGFLMDGLRLEARGVVVVDKNDKVTYVEYVPEVTHAINFDG
    VLAAVKGLL

    >gi|284048824|ref|YP_003399163.1| thioredoxin reductase [Acidaminococcus fermentans DSM 20731]
    MSKVYDILIIGGGPAGYTAALYGARSGFATAVLEKLSPGGQMATTSDVENYPGFPGVVDGFELGERMQEGAEKAGAETFF
    AEVSKVDLLADPKVVETSEGTFLGRTVILATGAHPRKLGIPQEEALVNRGVAY
    CATCDGNFYKDKVVVVNGGGNTAVGDA
    LYLAKLASKVYLVHRRDTLRATPIYLQRLKDAGVEIIWNSVVSGLQADKKLTGVELTDVKTGEKRVLPADGLFVAIGQLP
    ESSLAAGQVATDKAGYIMAGEDTKTSVPGVFAVGDVRTKAVRQIITAAADGAVAIHYAEEYLNEK

    >gi|284048825|ref|YP_003399164.1| Thioredoxin domain protein [Acidaminococcus fermentans DSM 20731]
    MEFLHITKDNFDKEVLQSSKPMVVGFSAPWCGYCKRLKPALGQLAMEIADKVSFGGVNIDEERELAEQFKVETIPSLMLV
    KDGQCSELLVNPPSKAAVKTWLQEKGAL

    >gi|284048828|ref|YP_003399167.1| Heavy metal transport/detoxification protein [Acidaminococcus fermentans DSM 20731]
    MEKELKVNGMMCVNCQKHVHDALAAMAGVSAVDVNLEKGTAKVTADREISQDEFKKVIEDAGYELA

    >gi|284048933|ref|YP_003399272.1| heavy metal translocating P-type ATPase [Acidaminococcus fermentans DSM 20731]
    MKQYIVTGMTCASCQAHVEKAVAGVPGVTGVSVSLLTNSMGVEGTASDQAIIKAVEDAGYGASVKGAAQARQGLAEKLAA
    DEEALKDHETPRLRRRLLSSLGFLFVLMYLTMGHNMLDWPVPALLDGNHLGLMLTQLLLALIVMAINRDFYTSGFKTLFH
    GAPNMDTLVALGSSVSFLWSLAVFYEITYLTVHGTPFAELHQLYMHDLYFETAAMIPSLITLGKMLEAMSKGRTTDALKG
    LMKLAPKTAVLIRDGKEVTVSIDDVQKGDIFAVRPGENIPVDGVVVKGNSAVNESALTGESLPVDKKPGDKVSTATINQS
    GYLECEATRVGEDTTLSQIIKLVSDAAATKAPIARIADKVSAVFVPAIITIAVVTTLGWLLAGAPLGSAIARGIAVLVIA
    CPCALGLATPVAIMVGSGVGAKNGILFKTSSSLENAGKVAVVALDKTGTITKGQPKVTDVVPAEGYTRESLLQLAYDLEQ
    KSEHPLARAVVEEAAAKGLQAEPVDDFQALPGNGLQVARNGEKLIGGSLNFLKSLGAVDSALEAKAGELAGQGKTPLVFA
    KDGKLAGMIAVADVIKEDSAKAIKELQNMGIEVVMVTGDNQRTAEAIGRQAGVDKVVAGVLPEGKETVIRELQKAGGLVA
    MVGDGINDAPALTRADIGIAIGAGADVAIDSADIVLMNSRLTDVSAAVRLSRGTVTNIHENLFWAFFYNVICIPLAAGLF
    SYKMNPMVGAAAMSISSFTVCMNALRLNLFKLHDAGQDKKRKNPAAAVVEKADLAPQPAGCPVPEAAGTQVTYQVKGMM
    C
    AHCEGRVKKALEGLDGVVSAKADHTAGTVVATVLKPLDYAQVQQAVAKAGYEVTGATQPAAQAAEGTTVTLKVKGMM
    CAH
    CEGRVKKALEGLEGITSAQPDHTTGTVKVTETRQVPENDIKSAILKAGYEYEGMEA