Listeria monocytogenes 08 5923 uid43727

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284993467|ref|YP_003415235.1| hypothetical protein LM5923_0027 [Listeria monocytogenes 08-5923]
    MAIIFAKEDDLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLV
    DGEIKGAIAGIVSCDELRSRFKSLAK

    >gi|284994037|ref|YP_003415805.1| hypothetical protein LM5923_0598 [Listeria monocytogenes 08-5923]
    MVPADFEERVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATLKHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSE
    GVTFKENGHVKMKDHFWQ

    >gi|284994075|ref|YP_003415843.1| hypothetical protein LM5923_0636 [Listeria monocytogenes 08-5923]
    MYQSITANDLEQDLKKVPHNILDVRDADAFVEGHIPDAINIPINELPEKLATLDKEKAYTIICYAGGRSERASQFLAAEG
    FDVTNVMGGMGAFHGTVTN

    >gi|284994273|ref|YP_003416041.1| hypothetical protein LM5923_0835 [Listeria monocytogenes 08-5923]
    MYITFTDSAKNRLAALRSNLEGRLHLYYDTEGCSCENSGIFTLRLVEEKTAEDDEIQSNIGPVLIKRWTEMFLEEALTID
    YNDTEKTMILKSDGQYYNRNLLLVTNTDEVISCPVTS

    >gi|284994379|ref|YP_003416147.1| glutathione reductase [Listeria monocytogenes 08-5923]
    MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNVGCVPKKVMWYGAQIKEAMDLYADAYGYQVDASFNF
    QKLVENREAYIERIRGSYKNGLDNNNVDWIKGYAEFVDEKTLRVNGELVTADHILIATGGEPALPSIPGAEFGITSDGFF
    ALKELPKKVAVVGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLTDTLTEIIEQSDMTLHKHAIPQKVEKNPDGS
    LTLSLEDGRTETVDTLIWAIGRKPVIKGLQIENAGVELLESGHIAVDKFQNTNVAGIYAVGDVTGHYELTPVAIAAGRRL
    SERLFNNKKDAHLNYENIPTVVFSHPAIGTVGLTEPEAIEKYGKENIKVYTSSFTSMYTAITDHREPCRMKLICEGKTER
    VIGLHGIGYGVDEMIQGFAVAINMGATKADFDNTVAIHPTGSEEFVTMK

    >gi|284994457|ref|YP_003416225.1| hypothetical protein LM5923_1019 [Listeria monocytogenes 08-5923]
    MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGDNFEILGFPCNQFLRQDPGSDEEILEF
    CQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEWNFAKFLIDENGEVVERFPSKMKPEDFEDKVEALVAKVNN

    >gi|284994470|ref|YP_003416238.1| hypothetical protein LM5923_1032 [Listeria monocytogenes 08-5923]
    MLKRQKASPVGELFITIEDGCIMNISYDKPRNWELLDGNIIEKELFQELMIQLASYFEGERENFDLPMLLKGTDFQKKVW
    QALSEIPYGTVVSYKDIAISAGSPKAVQAVGQANRANPIPIIIP
    CHRCVKSNGELGGYNGTDVDKKQYLLALEKGLSLS

    >gi|284994523|ref|YP_003416291.1| hypothetical protein LM5923_1086 [Listeria monocytogenes 08-5923]
    MERYDRQMRVKNIGKDGQEKLLTKTILIVGVGAIGSYAAEICARMGFGKLILIDRDYVELSNLQRQSLFTEQDALDKQAK
    SYAASKALQLINSDITIEYIVDDANVTSLTPYVGTIDYILDCTDNFMTRDFLNQFCFSHQIPWIFTSCAGNYANLMPIIP
    PDSACLH
    CLLGDIPQTNAASCDIIGVDGALIPIVAGMQVSLLTQMIINPDFKANTYYQLDNWHFSFQTIEVKKRPDCSSC
    APGKMVSEVPFSGQTVTLCGRDTVQFRLPNKSNYREIKLLLTEQKIIYNENPALLSFQYEKFQFVIFKNGRVLLHGSENI
    AEAKKIYHLFFN

    >gi|284994529|ref|YP_003416297.1| dihydrolipoamide dehydrogenase [Listeria monocytogenes 08-5923]
    MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGGVCLNVGCIPSKALITIGHRFKEAGHSDNMGITADN
    VNLDFTKAQEWKGGVVNKLTSGVKGLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYG
    KRVLSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSLVKRNLKSKNVEMVTKALA
    KSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEIGLEQAGVKVTERGLVEVDKQGRSNVSNIFAIGDIVPGVP
    LAHKASYEAKIAAEAIAGEKSENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVRL
    VTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAELALGRPIHM

    >gi|284994695|ref|YP_003416463.1| thioredoxin [Listeria monocytogenes 08-5923]
    MVKEITDATFEQETSEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKKDG
    EVVETIIGYRPKEELDEVINKYV

    >gi|284994878|ref|YP_003416646.1| hypothetical protein LM5923_1443 [Listeria monocytogenes 08-5923]
    MISWIIAIIILVILLGYEIYQFVMRRKAVKVLTEEEFKKGYRKAQLIDVREPNEFDAGHILGARNIPVTQMKNRTTEIRQ
    DLPVYLY
    CQTAQRSNRAAIMLYKRGYKQVYQLKGGYRKWTGKTKSK

    >gi|284994898|ref|YP_003416666.1| dihydrolipoamide dehydrogenase [Listeria monocytogenes 08-5923]
    MAKEYDVVILGGGTGGYVAAIQAAKNGQKVAVVEKGKVGGTCLHRGCIPTKALLRSAEVLQTVKKASEFGISVEGTAGIN
    FLQAQERKQAIVDQLEKGIHQLFKQGKIDLFVGTGTILGPSIFSPTAGTISVEFEDGSENEMLIPKNLIIATGSKPRTLS
    GLTIDEEHVLSSDGALNLETLPKSIIIVGGGVIGMEWASMMHDFGVEVTVLEYADRILPTEDKEVAKELARLYKKKKLNM
    HTSAEVQAASYKKTDTGVEIKAIIKGEEQTFTADKILVSVGRSATTENIGLQNTDIATENGFIQVNDFYQTKESHIYAIG
    DCIPTIQLAHVAMEEGTIAANHIAGKAAEKLDYDLVPRCIYTSTEIASVGITEEQAKERGHEVKKGKFFFRGIGKALVYG
    ESDGFIKIIADKKTDDILGVSMIGPHVTDMISEAALAQVLNATPWEVGNTIHPHPTLSESFREAALAVDGNAIHG

    >gi|284994912|ref|YP_003416680.1| hypothetical protein LM5923_1477 [Listeria monocytogenes 08-5923]
    MHMKYILKGDKIMSDYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDAR
    FADMVFKIDAADAHAFKKMHVRPRAEIVSLSLEEDVNPLEVTGTYLEPSEFREALLDEDTVILDARNDYEFDIGHFRGAV
    RPDIQNFRELPGWIEDNREQLADKKIVTY
    CTGGIRCEKFSGWLKTAGFDDVSQLHGGIATYGKNEETKGELWDGQMYVFD
    ERIAVPINQVNPTIVGKDYFDGTPCERYINCANPYCNKQILASVENEKKYLRSCSHDCRVHPANLYTKNLSKEEFTERLQ
    AINESSPEMVQ

    >gi|284994961|ref|YP_003416729.1| hypothetical protein LM5923_1526 [Listeria monocytogenes 08-5923]
    MAKFTYDVVIIGSGASGTTVAFEAQAAGLKVAIVEERNWGGTCVLRGCDPKKVLIGAREARNLSTRLRGKGIKQAATISW
    TDLMAFKETFVENVPESRLASFQEAGIETFFGAASFQDSHSLQVGDDLIYAEKIVIATGATPSTLKVEGKEYIQTSDDFL
    SLEKLPDSVVFIGGGYISFEFASIALAAGRDVHIIHHNSEPLKKFDPDFVAALVANIKDEGIHFHFDTDITKIENDGGKL
    HIKGKDSFSLQTDLIIGATGRMPNIAHLSLENASIDYTKKGIVVNEKLQTPNNPHIYACGDVAATKGAPLTPVVSLEAAL
    VAKNVIGGNEKITYPAIPSVVFTSPKLASIGISTEEAKANPEKYQIKNHDTTSWYTYKRTNEQIALAKIIEDRESGQIKG
    AHFLSEEADYMINYIAILMKANLTLADLQSVIFAYPSPASDLTALN

    >gi|284995117|ref|YP_003416885.1| hypothetical protein LM5923_1682 [Listeria monocytogenes 08-5923]
    MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTSVCSTQTRKFNEEASNLDNTVVL
    TISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVIMKELRLLARSVFVVNAAGEIVYTEVVPEGSDHPNYEAAIE
    AAKKA

    >gi|284995138|ref|YP_003416906.1| hypothetical protein LM5923_1703 [Listeria monocytogenes 08-5923]
    MAERLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTILFFYPMDFTFVCPTEIVAISARSDEFDALNARIIGASTDT
    IHSHLAWTNTPIKEGGIGKLNYPLAADTNHQVASDYGVLIEEEGIALRGLFIINPKGEIQYEVVHHNNIGREVDEVLRVL
    QALQTGGLCPINWQPGEKTIV

    >gi|284995143|ref|YP_003416911.1| hypothetical protein LM5923_1708 [Listeria monocytogenes 08-5923]
    MKNLESVEQFNAIKSEGKSVFMFSADWCGDCKFIEPVMPEIEAENEDFSFYHVDRDEFIDLCADLAIFGIPSFLAFEDGE
    EVGRFVSKDRKTKEEINDFLAAI

    >gi|284995441|ref|YP_003417209.1| hypothetical protein LM5923_2006 [Listeria monocytogenes 08-5923]
    MSDKYVRQDLNVFGMTCAACSTRIEKSLNKADGVEKANVNLVTENAAVYYDPEVTSTEDLIKVVKHAGYDAAEKMSKEEK
    DAVLEKNFKKEVRRFILSAVLSLPLLLTMVTHIPYIHEMAFAETIGNWINPTIQLVLATIVQFYIGWRFYDGAYKALRGK
    SANMDVLVALGTSAAYFYSVVEYVRHIIDPSVMPHYYFETSAVLITLILLGKLLESYATSRTTESIAGLLELQAKEATVI
    REGKEWLVPVDSLKIGDVILVRPGEKVPMDAEIISGETSIDEAMITGEPVPVEKKPGDSVIGATINFDGAFQAKITKRME
    ETVLESIIRLVEEAQGIKAPIQRLADRISGIFVPIVLGIAAVTFIIWYLVTGTVDGSLEAAIAVLVIACPCALGLATPTA
    IMAGTGKGAESGILFKGGEHLERTSKVDTIVFDKTGTLTEGKLEVSDKKAANDQFFPYLFLMEQQSEHPIAKAIIKMLEP
    ENMDVSAIKQGKIRAKAGHGMTGNLDDSKVELGAYRYVSSLTTIPKEDDELIESWMHAGKTVVAMAIDGVYAGALALSDT
    PRPEAKEAIQKLKAQGIKTAICSGDQSVVVENMAKDLGIDMFFAEQLPNDKSALVEKLQQDGHIVAFVGDGINDAPALAA
    SDIGISIGTGTDIAIETGDVTLVSHRLTLIPETIELSKATMRNIRQNFFWALAYNCAGIPIAALGLLAPWVAGLAMAFSS
    VSVVTNALRLKRYKFKS

    >gi|284995447|ref|YP_003417215.1| methionine sulfoxide reductase B [Listeria monocytogenes 08-5923]
    MDESKKNERLQQLTDIQYNVTQKAGTERPFQNEFYDNEAKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEN
    RDLNHGMIRTEVKSADADSHLGHVFPDGPQDKGGLRY
    CINSAALRFIPVDKLEEEGYQAYKKIFE

    >gi|284995448|ref|YP_003417216.1| methionine sulfoxide reductase A [Listeria monocytogenes 08-5923]
    MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQ
    QTDPTDAAGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEG
    YQVASGRAAFIDANWKG

    >gi|284995505|ref|YP_003417273.1| hypothetical protein LM5923_2070 [Listeria monocytogenes 08-5923]
    MDYDVIVIGGGPSGLMAAISAAEKNKRVLLIEKGPKLGRKLIMSGGGRCNVTNRRPAEEIIKHIPGNGRFLYSAFHAFDN
    EDIIRFFERLGVALKEEDHGRMFPVSNSARSVAEAMIQRMEKLGVKIYMQTAVKQVDYEDGHVKGVTLKDGQEISASAVI
    VAVGGKSVPRTGSTGDGYAWAKKAGHTITELYPTEVPITSSEPFIKQKVLQGTSLRDVSLSVLNAKGKPIITHQMDMIFT
    HFGVSGPAALRCSMFVLRELKKTGAGTVKMRLDLFPNVSAAELSKDAYKLLEENPKKALKNSLSSLLQEKMLLFLLEKAD
    LEETAEYKQVSPKKIEQFIQLLKDFTFEVNGTLDFEKAFVTGGGVSVKEIKPKEMQSKLMEGLFFCGEILDINGYTGGYN
    ITCALVTGHTAGAYAAEVSNA

    >gi|284995741|ref|YP_003417509.1| hypothetical protein LM5923_2306 [Listeria monocytogenes 08-5923]
    MTSIEIKSPEEFQAHINGEELVYVDYWKDNCPNCKMLDLSFAEFKNSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLV
    LYKGGEEIHRLNGFIPPNKIEEAVSLNA

    >gi|284995780|ref|YP_003417548.1| transcriptional regulator Spx [Listeria monocytogenes 08-5923]
    MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLF
    ELIQKNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRRVRTYQLREAQKMVN

    >gi|284995788|ref|YP_003417556.1| hypothetical protein LM5923_2353 [Listeria monocytogenes 08-5923]
    MKKLYETTVINTGGRSGEVHSPDNVFYFDISAPTELGGDGGGGTNPEQLFAAGYGACFNSALELVLGKAGIEAKSTVTAT
    VSLYSDPEDNGFKIGVVLEGTIEGQDKEKTEALLKKAHEV
    CPYSKATRGNIDVEIKVG

    >gi|284995831|ref|YP_003417599.1| hypothetical protein LM5923_2396 [Listeria monocytogenes 08-5923]
    MTDLYYDTLHFSDTELYFAATKMGLVYVGTKAEKLQSAKRSPEKMNIYKEELAAYLHGELTNFTVPIDLSATPLQIEVFH
    ALKTIPYGETRTYTEIAELINRPKAVRAVGTAIGRNPLLFIIP
    CHRVIGKNGNLTGYSGGIGMKESLLKLEKANLNQFSF


    >gi|284995927|ref|YP_003417695.1| hypothetical protein LM5923_2492 [Listeria monocytogenes 08-5923]
    MANVVVWSKEGCHYCKDVKDFLIEQKIVFQDIDVTDHDYLREVLQAKYGICHVPVVEIGNIENGTYQAVTEIGLEHLEKA
    LFEKEEVK

    >gi|284996003|ref|YP_003417771.1| hypothetical protein LM5923_2568 [Listeria monocytogenes 08-5923]
    MRTAQKKGEDFVVFFFTPMCGSCQIASRLVDVVIEADGIQTEVAKVNLNYVPDIAQSLEITSVPALVKFKNGQPADLSYQ
    LHDATAIFEFLYSE

    >gi|284996005|ref|YP_003417773.1| hypothetical protein LM5923_2570 [Listeria monocytogenes 08-5923]
    MINFYWYPKCSTCKKAKAWLENEHVDFNEVDIKTETPTAEELQQWHEASGLPVRRFFNTSGIKYRELGLKDKLDTLSPEE
    AYKLLASDGMLIKRPLTTNGKEVTLGFKEEEFEATWK

    >gi|284996057|ref|YP_003417825.1| thioredoxin reductase [Listeria monocytogenes 08-5923]
    MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEY
    AYGDIKEVVDGKEFKTVTAGSKTYKARAIIIATGAEHRKLGAAGEEELSGRGVSY
    CAVCDGAFFKNRELIVVGGGDSAVE
    EGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYV
    GLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVRAKSLRQIVTATGDGGLAGQNAQKYVEELKESLEAEAAK

    >gi|284996322|ref|YP_003418090.1| hypothetical protein LM5923_2887 [Listeria monocytogenes 08-5923]
    MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKKPLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKL
    SPAVKLLVDAIEKNPEKKWTDKDFDDLSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQIESGYESG
    NGFRDAFSKTMGSVPHKSKDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKKLRMRLNAAITPEKKVIIQ
    QIEAELARYFNGELIDFKTPIRYIGSDFQQSVWNELRRIPVGETISYKSLAEKLGRPTASRAVARANGANQLSLIVP
    CHR
    VINTNGALGGYGGGLARKEWLIKHEKMVPK

    >gi|284995490|ref|YP_003417258.1| hypothetical protein LM5923_2055 [Listeria monocytogenes 08-5923]
    MKKIVLLLALITVVLTVGACSDNKKETEEKANKTEEESATFLTTISTKDFKQKMADKTTGFVYVGRPTCEDCQAFQPILK
    KELKKRQPDQKMAYYNTDKASEKSRDNMIALLEKMDIDSVPTMVYLKDGKVASTYAATDEPAKLTNWMNKVSGEVSE