Listeria monocytogenes

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|16802124|ref|NP_463609.1| hypothetical protein lmo0076 [Listeria monocytogenes EGD-e]
    MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKKPLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKL
    SPAVKLLVDAIEKNPEKKWTDKDFDDLSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQLDSGYESG
    NGFRDAFSKTMGEVPHKSKDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKKLRMRLNAAITPEKTIIIQ
    QIEAELAQYFNGELIDFKTPIRYIGSDFQENVWEELRRIPIGETISYKGLAEKLGRSTASRAVARANGANQLSLIVP
    CHR
    VINTNGALGGYGGGLARKEWLIKHEKMVPK

    >gi|16802614|ref|NP_464099.1| hypothetical protein lmo0571 [Listeria monocytogenes EGD-e]
    MVPADFEERVYTVVRQIPRGKVTTYGQIAYMIGFPKNARLVGATLKHSKRDQITPCHRVVNAAGRLVPGWEEQRELLLSE
    GVKFKENGHVKMKDHFWQ

    >gi|16802651|ref|NP_464136.1| hypothetical protein lmo0609 [Listeria monocytogenes EGD-e]
    MYQSITANDLEQDLKKVPHNILDVRDADAFVEGHIPDAINIPINELPEKLATLDKEKAYTIICYAGGRSERASQFLAAEG
    FDVTNVMGGMGAFHGTVTN

    >gi|16802842|ref|NP_464327.1| hypothetical protein lmo0800 [Listeria monocytogenes EGD-e]
    MYITFTDSAKNRLAALRSNLEGRLHLYYDTEGCSCENSGIFTLRLVEEKTAEDDEIQSNIGPVLIKRWTEMFLEEALTID
    YNETEKTMILKSDGQYYNRNLLLVTDKDEVISCPIS

    >gi|16802947|ref|NP_464432.1| glutathione reductase [Listeria monocytogenes EGD-e]
    MEKHYDYIAIGGGSGGIASINRAAMHGAKCALIEPKFLGGTCVNVGCVPKKVMWYGAQIKEAMDLYADAYGYQVDASFNF
    QKLVENREAYIERIRGSYKNGLDNNNVDWIKGYAEFVDEKTLRVNGELVTADHILIATGGEPALPSIPGAEFGITSDGFF
    ALKELPKKVAVVGAGYIAVELAGVLQQLGSETHLFVRKHAPLRNFDPLLTDTLTEIIEQSDMTLHKHAIPQKVEKNPDGS
    LTLSLEDGRTETVDTLIWAIGRKPVIKGLQIEKSGVELLESGHIAVDKFQNTNVAGIYAVGDVTGHYELTPVAIAAGRRL
    SERLFNNKKDAHLNYENIPTVVFSHPAIGTVGLTEPEAIEKYGKENIKVYTSSFTSMYTAITDHREPCRMKLICEGKTER
    VIGLHGIGYGVDEMIQGFAVAINMGATKADFDNTVAIHPTGSEEFVTMK

    >gi|16803023|ref|NP_464508.1| hypothetical protein lmo0983 [Listeria monocytogenes EGD-e]
    MNVHDFSEKAMNGKEIALSDYKGKVLLIVNTASKCGLTPQLEGLEAMYKKLGGDNFEILGFPCNQFLRQDPGSDEEILEF
    CQMNYGVTFQMFSKIKVKGKDASPLYKYLTEQTGGKKVEWNFAKFLIDENGEVIERFPSKMKPEDFEDKVEALVAKVNN

    >gi|16803036|ref|NP_464521.1| hypothetical protein lmo0996 [Listeria monocytogenes EGD-e]
    MLKRQKASPVGELFITIEDGCIMNISYDKPRNWELLDGNIIEKELFQELMIQLASYFEGERENFDLPMLLKGTDFQKKVW
    QALSEIPYGAVVSYKDIAISAGSPKAVQAVGQANRANPIPIIIP
    CHRCVKSNGELGGYNGTDVDKKQYLLALEKGLSLS

    >gi|16803089|ref|NP_464574.1| hypothetical protein lmo1049 [Listeria monocytogenes EGD-e]
    MERYDRQMRVKNIGKDGQEKLLTKTILIVGVGAIGSYAAEICARMGFGKLILIDRDYVELSNLQRQSLFTEQDALDKQAK
    SYAASKALQLINSDITIEYIVDDANVTSLTPYVGTIDYILDCTDNFMTRDFLNQFCFSHQIPWIFTSCAGNYANLMPIIP
    PDSACLH
    CLLGDIPQTNAASCDIIGVDGALIPIVAGMQVSLLTQMIINPDFKANTYYQLDNWHFSFQTIEVKKRPDCSSC
    APGKMVSEVPFSGQTVTLCGRDTVQFRLPNKSNYREIKLLLTEQKIIYNENPALLSFQYEKFQFVIFKNGRVLLHGSENI
    AEAKKIYHLFFN

    >gi|16803095|ref|NP_464580.1| dihydrolipoamide dehydrogenase [Listeria monocytogenes EGD-e]
    MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGGVCLNVGCIPSKALITIGHRFKEAGHSDNMGITADN
    VNLDFTKAQEWKGGVVNKLTSGVKGLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYG
    KRVLSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSLVKRNLKSKNVEMVTKALA
    KSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEIGLEQAGVKVTERGLVEVDKQGRSNVSNIFAIGDIVPGVP
    LAHKASYEAKIAAEAIAGEKSENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVRL
    VTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAELALGRPIHM

    >gi|16803140|ref|NP_464625.1| cadmium resistance protein [Listeria monocytogenes EGD-e]
    MSKASKQTTYRVDGMSCTNCAGKFEKNVKNLEGVTDAKVNFGAGKISVYGETSISQIEKAGAFENLRVTDEKDYSSKPAK
    KESFLKKNWHLVVSIIFIILAFISQNISGEDSTTTIILYVIAIVVGGFNLFKEGFANLIKLDFTMESLMTIAIIGASIIG
    EWAEGSIVVILFAFSEVLERYSMDKARQSIRSLMDIAPKEALIRRDDVEQMIAVSDIQIGDIMIIKPGQKIAMDGVVIKG
    YSAINQSAITGESIPVEKKVDDEVFAGTLNEEGLLEVKVTKHVEDTTISKIIHLVEEAQGERAPAQAFVDKFAKYYTPTI
    MLIALLVVVVPPLFFGGDWDTWVYQGLSLLVVGCPCSLVISTPVSIVSAIGNSAKNGVLVKGGIYLEEIGGLQAIAFDKT
    GTLTKGKPVVTDFIPYSEHMDEQNSLSIITALETMSQHPLASAIISKAMIDNVDYKSIEIDNFSSITGKGVKGEVNGITY
    YIGSSKLFESSLEKSQSISQTYQSLQKQGKTAMLFGTESNILAIIAVADEVRESSKEVIAQLHKLGIAHTIMLTGDNNDT
    AQFIGKEIGVSDIKAELMPEDKLTYIKELKQTYGKVAMIGDGVNDAPALAASTVGIAMGGAGTDTALETADVALMGDDLK
    KLPFIVNLSRKTLKIIKQNITFSLGIKLLALLLVLPGWLTLWIAIVADMGATLLVTLNGLRLMKVKK

    >gi|16803273|ref|NP_464758.1| thioredoxin [Listeria monocytogenes EGD-e]
    MVKEITDATFEQETSEGLVLTDFWATWCGPCRMVAPVLEEIQEERGEALKIVKMDVDENPETPGSFGVMSIPTLLIKKDG
    EVVETIIGYRPKEELDEVINKYV

    >gi|16803391|ref|NP_464876.1| hypothetical protein lmo1351 [Listeria monocytogenes EGD-e]
    MISWIIAIIILVILLGYEIYQFVMRRKAVKVLTEEEFKKGYRKAQLIDVREPNEFDAGHILGARNIPVTQMKNRTTEIRQ
    DLPVYLY
    CQTAQRSNRAAIMLYKRGYKQVYQLKGGYRKWTGKTKSK

    >gi|16803411|ref|NP_464896.1| dihydrolipoamide dehydrogenase [Listeria monocytogenes EGD-e]
    MAKEYDVVILGGGTGGYVAAIQAAKNGQKVAVVEKGKVGGTCLHRGCIPTKALLRSAEVLQTVKKASEFGISVEGTAGIN
    FLQAQERKQAIVDQLEKGIHQLFKQGKIDLFVGTGTILGPSIFSPTAGTISVEFEDGSENEMLIPKNLIIATGSKPRTLS
    GLTIDEEHVLSSDGALNLETLPKSIIIVGGGVIGMEWASMMHDFGVEVTVLEYADRILPTEDKEVAKELARLYKKKKLNM
    HTSAEVQAASYKKTDTGVEIKAIIKGEEQTFTADKILVSVGRSANTENIGLQNTDIATENGFIQVNDFYQTKESHIYAIG
    DCIPTIQLAHVAMEEGTIAANYIAGKAAEKLDYDLVPRCIYTSTEIASVGITEEQAKERGHEVKKGKFFFRGIGKALVYG
    ESDGFIKIIADKKTDDILGVSMIGPHVTDMISEAALAQVLNATPWEVGNTIHPHPTLSESFREAALAVDGNAIHG

    >gi|16803424|ref|NP_464909.1| hypothetical protein lmo1384 [Listeria monocytogenes EGD-e]
    MSDYQVLLYYKYTTIDDPETFAKEHLAACKEMELKGRILVATEGINGTVSGTVEATNKYMDYMANDARFADMVFKIDAAD
    AHAFKKMHVRPRAEIVSLSLEEDVNPLEVTGTYLEPSEFREALLDEDTVILDARNDYEFDIGHFRGAVRPDIQNFRELPG
    WIEDNREQLADKKIVTY
    CTGGIRCEKFSGWLKTAGFDDVSQLHGGIATYGKNEETKGELWDGQMYVFDERIAVPINQVNP
    TIVGKDYFDGTPCERYINCANPYCNKQILASVENEKKYLRSCSHDCRVHPANLYTKNLSKEEFTERLQAINESSPEMVQ

    >gi|16803473|ref|NP_464958.1| hypothetical protein lmo1433 [Listeria monocytogenes EGD-e]
    MAKFTYDVVIIGSGASGTTVAFEAQAAGLKVAIVEERNWGGTCVLRGCDPKKVLIGAREARNLSTRLRGKGIKQAATISW
    TDLMAFKETFVENVPESRLASFQEAGIETFFGAASFQDSHSLQVGDDLIYAEKIVIATGATPSTLKVEGKEYIQTSDDFL
    SLEKLPDSVVFIGGGYISFEFASIALAAGRDVHIIHHNSEPLKKFDPDFVAALVANIKDEGIHFHFDTDITKIENDGGKL
    HIKGKDSFSLQTDLIIGATGRMPNIAHLSLENASIDYTKKGIVVNEKLQTPNNPHIYACGDVAATKGAPLTPVVSLEAAL
    VAKNVIGVNEKITYPAIPSVVFTSPKLASIGISTEEAKANPEKYQIKNHDTTSWYTYKRTNEQIALAKIIEDRESGQIKG
    AHFLSEEADYMINYIAILMKANLTLADLQSVIFAYPSPASDLTALN

    >gi|16803623|ref|NP_465108.1| hypothetical protein lmo1583 [Listeria monocytogenes EGD-e]
    MTQVTFKHNPVTLVGTERKVGDKAPNFTVVNRDLEEVTLHDYDGKVRLISVVPSIDTSVCSTQTRKFNEEASNLDNTVVL
    TISVDLPFAQKKWCAAEGLPNAITLSDHRDLSFGEAYGVIMKELRLLARSVFVVNAVGEIVYTEVVPEGSDHPNYEAAIE
    AAKKA

    >gi|16803644|ref|NP_465129.1| hypothetical protein lmo1604 [Listeria monocytogenes EGD-e]
    MAERLVGTQAPRFEMEAVMPNQTFGKVSLEKNIEDDKWTILFFYPMDFTFVCPTEIVAISARSDEFDALNARIIGASTDT
    IHSHLAWTNTPIKEGGIGKLNYPLAADTNHQVASDYGVLIEEEGVALRGLFIINPKGEIQYEVVHHNNIGREVDEVLRVL
    QALQTGGLCPINWQPGEKTIV

    >gi|16803649|ref|NP_465134.1| hypothetical protein lmo1609 [Listeria monocytogenes EGD-e]
    MKNLESVEQFNAIKSEGKSVFMFSADWCGDCKFIEPVMPEIEAENEDFSFYHVDRDEFIDLCADLAIFGIPSFLAFEDGE
    EVGRFVSKDRKTKEEINDFLAAI

    >gi|16803893|ref|NP_465378.1| hypothetical protein lmo1853 [Listeria monocytogenes EGD-e]
    MSDKYVRQDLNVFGMTCAACSTRIEKSLNKADGVEKANVNLVTENAAVYYDPEVTSTEDLIKVVKHAGYDAAEKMSKEEK
    DAVLEKNFKKEVRRFILSALLSLPLLLTMVTHIPYIHEMAFAETIGNWINPTIQLVLATIVQFYIGWRFYDGAYKALRGK
    SANMDVLVALGTSAAYFYSVVEYVRHIIDPSVMPHYYFETSAVLITLILLGKLLESYATSRTTESIAGLLELQAKEATVI
    REGKEWLVPVDSLKIGDVILVRPGEKVPMDAEIISGETSIDEAMITGEPVPVEKKPGDSVIGATINFDGAFQAKITKRME
    ETVLESIIRLVEEAQGIKAPIQRLADRISGIFVPIVLGIAAVTFIIWYLVTGTVDGSLEAAIAVLVIACPCALGLATPTA
    IMAGTGKGAESGILFKGGEHLERTSKVDTIVFDKTGTLTEGKLEVSDKKAANDQFFPYLFLMEQQSEHPIAKAIIKMLEP
    ENMDVSAIKQGKIRAKAGHGMTGNLDDSKVELGAYRYVSSLTTIPKEDDELIESWMHAGKTVVAMAIDGVYAGALALSDT
    PRPEAKEAIQKLKAQGIKTAICSGDQSVVVENMAKDLGIDMFFAEQLPNDKSALVEKLQQDGHIVAFVGDGINDAPALAA
    SDIGISIGTGTDIAIETGDVTLVSHRLTLIPETIELSKATMRNIRQNFFWALAYNCAGIPIAALGLLAPWVAGLAMAFSS
    VSVVTNALRLKRYKFKS

    >gi|16803899|ref|NP_465384.1| methionine sulfoxide reductase B [Listeria monocytogenes EGD-e]
    MDESKKNERLQQLTDIQYNVTQKAGTERPFQNEFYDNEVKGIYVDIVSGKPLFSSNDQYDAGCGWPSFTKPIDEAEVIEH
    RDLTHGMIRTEVKSADADSHLGHVFPDGPQDKGGLRY
    CINSAALRFIPVDKLEEEGYQAYKKIFE

    >gi|16803900|ref|NP_465385.1| methionine sulfoxide reductase A [Listeria monocytogenes EGD-e]
    MTKESLEKATFAGGCFWCMVKPFDTQPGIEKVVSGYTGGHTVNPTYKEVCSGTTGHTEAIQITFDPAVFPYEKLVEVYWQ
    QTDPTDAAGQFVDRGDSYRPVIFYHNEEQKEIAEKSKAALDASGRFKKPIVTEIAKAETFYPAEEYHQDFYKKEKAHYEG
    YQVASGRAAFIDANWKG

    >gi|16803957|ref|NP_465442.1| hypothetical protein lmo1918 [Listeria monocytogenes EGD-e]
    MDYDVIVIGGGPSGLMAAISAAEKNKRVLLIEKGPKLGRKLIMSGGGRCNVTNRRPAEEIIKHIPGNGRFLYSAFHAFDN
    EDIIRFFERLGVALKEEDHGRMFPVSNSARSVAEAMIQRMEKLGVKIYMQTAVKQVDYEDGHVKGVTLKDGQEISASAVI
    VAVGGKSVPRTGSTGDGYAWAKKAGHTITELYPTEVPITSSEPFIKQKVLQGTSLRDVSLSVLNAKGKPIITHQMDMIFT
    HFGVSGPAALRCSMFVLRELKKTGAGTVKMRLDLFPNVSAAELSKDVYKLLEENPKKALKNSLSSLLQEKMLLFLLEKAD
    LEETAEYKQVSPKKIEQFIQLLKDFTFEVNGTLDFEKAFVTGGGVSVKEIKPKEMQSKLMEGLFFCGEILDINGYTGGYN
    ITCALVTGHTAGAYAAEVSNA

    >gi|16804191|ref|NP_465676.1| hypothetical protein lmo2152 [Listeria monocytogenes EGD-e]
    MTSIEIKSPEEFQAHINGEELVYVDYWKDNCPNCKMLDLSFAEFKNSEIASKVKVLKVKLEEMGENFFFDRDVQQTPTLV
    LYKGGEEIHRLNGFIPPNKIEEAVSLNA

    >gi|16804230|ref|NP_465715.1| transcriptional regulator Spx [Listeria monocytogenes EGD-e]
    MVTLYTSPSCTSCRKARAWLEEHDIPYKERNIFSEPLSLDEIKEILRMTEDGTDEIISTRSKTFQKLNVDLDSLPLQQLF
    ELIQKNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRRVRTYQLREAQKMVN

    >gi|16804238|ref|NP_465723.1| hypothetical protein lmo2199 [Listeria monocytogenes EGD-e]
    MKKLYETTVINTGGRSGEVHSPDNVFYFDISAPTELGGDGGGGTNPEQLFAAGYGACFNSALELVLGKAGIEAKSTVTAT
    VSLYSDPEDNGFKIGVVLEGTIEGQDKEKTEALLKKAHEV
    CPYSKATRGNIDVEIKVG

    >gi|16804281|ref|NP_465766.1| hypothetical protein lmo2242 [Listeria monocytogenes EGD-e]
    MTDLYYDTLHFSDTELYFAATKMGLVYVGTKAEKLQSAKRSPEKMNIYKEELAAYLHGELTNFTVPIDLSATPLQIEVFH
    ALKTIPYGETRTYTEIAELINRPKAVRAVGTTIGRNPLLFIIP
    CHRVIGKNGNLTGYSGGIGMKESLLKLEKANLNQFSF


    >gi|16804382|ref|NP_465867.1| hypothetical protein lmo2344 [Listeria monocytogenes EGD-e]
    MANVVVWSKEGCHYCKDVKDFLIEQKIVFQDIDVTDHDYLREVLQAKYGICHVPVVEIGNIENGTYQAVTEIGLEHLEKA
    LFEKGEVK

    >gi|16804462|ref|NP_465947.1| hypothetical protein lmo2424 [Listeria monocytogenes EGD-e]
    MRTAQKKGEDFVVFFFTPMCGSCQIASRLVDVVIEADGIQTEVAKVNLNYVPDIAQSLEITSVPALVKFKNGQPADLSYQ
    LHDATAIFEFLYSE

    >gi|16804464|ref|NP_465949.1| hypothetical protein lmo2426 [Listeria monocytogenes EGD-e]
    MINFYWYPKCSTCKKAKAWLENEHVDFNEVDIKTETPTAEELQQWHEASGLPVRRFFNTSGIKYRELGLKDKLDTLSPEE
    AYKLLASDGMLIKRPLTTNGKEVTLGFKEEEFEATWK

    >gi|16804516|ref|NP_466001.1| thioredoxin reductase [Listeria monocytogenes EGD-e]
    MASEEKIYDVIIIGAGPAGMTAALYTSRADLDTLMIERGVPGGQMVNTAEVENYPGFDSILGPDLSDKMLSGAKQFGAEY
    AYGDIKEVVDGKEFKTVTAGSKTYKARAIIIATGAEHRKLGAAGEEELSGRGVSY
    CAVCDGAFFKNRELIVVGGGDSAVE
    EGTYLTRYADKVTIVHRRDKLRAQQILQDRAFKDEKVDFIWNSTVEEIVGDGKKVTGAKLVSTVDGSESIMPVDGVFIYV
    GLVPLTKAFLNLGITDDEGYIVTDEEMRTNLPGIFAAGDVRAKSLRQIVTATGDGGLAGQNAQKYVEELKESLEAEAAK

    >gi|16804867|ref|NP_466352.1| hypothetical protein lmo2830 [Listeria monocytogenes EGD-e]
    MAIIFAKEDDLEEIISSHPKILLNFWAEWCAPCRCFWPTLEQFAEMEEGNVQVVKINVDKQRALAQKFDVKGIPNSLVLV
    DGEIKGAIAGIVSCDELRSRFKSLAK

    >gi|16803942|ref|NP_465427.1| hypothetical protein lmo1903 [Listeria monocytogenes EGD-e]
    MKKIVLLLALITVVLTVGACSDNKKETEEKANKTEEESATFLTTISTKDFKQKMADKTTGFVYVGRPTCEDCQAFQPILK
    KELKKRQPDQKMAYYNTDKASEKSRDNMIALLEKMDIDSVPTMVYLKDGKVASTYAATDEPAKLTNWMNKVSGEVSE