Leuconostoc kimchii IMSNU 11154 uid48589

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|295987465|ref|YP_003620410.1| glutathione reductase [Leuconostoc kimchii IMSNU 11154]
    MKTYDYTIIGSGPSVYRFLVGMQGSKKRILVVESDNFGGICPNAGCEPKIFLEGAIKTALTSRDLLNKGIESPAKLNWND
    LILEKKRVFSPVSTNNQHAYEELGADTVRGTASFVDEHTIKVDETLITSDNFIIATGLKPRPMNIPGSHLFLTSDDFFNM
    EDLPATVAIIGSGYVGMEIATILSAAGSNVTMLQRSDRPLRDFDSRHVDMLIKNMKENLGIDFRFNTQVTKAEKTSNGIL
    VTTDNGQNLEFSTVINATGRIPNINALNLENTKVDFDKDGVIVDKYLRTTASNIYAIGDVIKKDIPRLTLTAQFEGAYLS
    AYLLGKKKSEIHYPVIGKVTFTFPQLASTGVDIDQARLDPNLTVKDIDISKGDFLYAGTNDYNAHLSLVYDQNQRIIAAS
    EISQTASDDINIFIPIIALDIDQNLWNEKMVMSFPSLAFKLRNIL

    >gi|295987466|ref|YP_003620411.1| putative ArsR family transcriptional regulator [Leuconostoc kimchii IMSNU 11154]
    MVLDIIQYKNSLYDELAHFSKGLASNKRLEILDLLLQASKSVDSISRDTGNSVANTSRHLQVLKESHLVASSRNGNQIIY
    SLASDNVVSLVRTLMKVGERESSEMKYIQKEADNDQYVKTISLEKVRQEIDNIFLLDVRPKDEYIANHILGAINIPLNEL
    IDNINIIPKNKKIIVYCRGRL
    CANSNFAVKKLNQYGLNAYSLNSSVHDWQEIAHNSDS

    >gi|295987467|ref|YP_003620412.1| thioredoxin [Leuconostoc kimchii IMSNU 11154]
    MVKEIELTSENYEESVSKGVILVDFRADWCAPCRMMDSVLDKIAEDPIYESIKFGKVNVDNNMELNIRHSISGIPTFLLY
    KDGKLITREVGLQTKNTVKSMLNNLL

    >gi|295987481|ref|YP_003620426.1| thioredoxin [Leuconostoc kimchii IMSNU 11154]
    MVENLTYENFDISTSEGVVLTDFWAEWCAPCRMQSPIIDQLDDEIGNQVKFTKVDVDNNQQVATSLGIRSIPTLVVKKNG
    EIVEKLVGFHTKDQLKKVLAYYA

    >gi|295987482|ref|YP_003620427.1| thioredoxin family protein [Leuconostoc kimchii IMSNU 11154]
    MEKVFYNSFNELKHKIKNGKYVLVFTADWCGDCKFIEPVLPEIENTFREYQFINIDTDKNMHIARSLNIFGIPSFVVYDS
    GKEIDRLVNKDRKTKNEIISFIDQAIER

    >gi|295987483|ref|YP_003620428.1| thioredoxin reductase [Leuconostoc kimchii IMSNU 11154]
    MLEYDVIVIGAGPGGMTASLYAARANLKVAMIDRGVYGGQMNNTDDIENYPGFPTIKGPDLGEKMYQNTVNAGVEFIFGD
    VQEVTVDDNQYKHVKTDSEDLVSKVVIIATGSNNRKLGIPGEKEFSGKGVSY
    CAVCDGAFFKNENVTVVGGGDSAISEGT
    YLANITDHVGIVHHRDKLRAQKVLQDRAFSNNKIDFTWNSNVVEIVGDDNRVTGIKMVDNQSGKLTTVDTTGVFIYIGNI
    PNTQMFSNLNITDESGWIITNSEMETNIPGIFAIGDVRLKKLRQITTAVGDGGIAGQNSFEYIEQFNEK

    >gi|295987484|ref|YP_003620429.1| protein-disulfide isomerase [Leuconostoc kimchii IMSNU 11154]
    MEIKYWSDIACPFCYIGSNRMKRAMKELGIYNTTELEFKSFELDPTTSKETTEGYINHFTQGNKSMEDQAKQQMAYIEKM
    AHDDGLSMDINSVIPTNTVDAHRLIKLANSKHDPVLTENLIRRFYQVYFNDGRSIADHNVLVNAATEVGLYKDEVEVILN
    SDKYFQEVKADEIEAMQSGIHAAPFFVINNKYGINGAQPYEVFINALKQVQDEEDKAKG

    >gi|296100152|ref|YP_003620436.1| putative transcriptional regulator [Leuconostoc kimchii IMSNU 11154]
    MFEQAVNYKNGLYEELSKIGKGLSSDRRLEILDLLTQAPKSVETIANGVGISVANASRHLQILKDSHLVKTKRKGNHIIY
    SLSSPKISDLVHLLTDIGNSELSDMKTIQDKSDAQDNVKTISLKQAQEEYKNCFVLDVRPSDEYAAGHIQSAINVPLETL
    KESMPKLPKDQKIIVY
    CRGRLCANSNIATQILNRNGFDAVSLNSSHYDWNKITE

    >gi|296100153|ref|YP_003620437.1| thioredoxin [Leuconostoc kimchii IMSNU 11154]
    MVKNLTDKDFVKETSTGVTLTDFWATWCPPCRMQGPIIEQLDKEIGDKVKITKMDVDANQETPIAFGIMSIPTLIIKKDG
    QVVDKLVGLQSKDQLKTVLAQYTN

    >gi|296100154|ref|YP_003620438.1| thioredoxin [Leuconostoc kimchii IMSNU 11154]
    MEQLSVMNKKEFDKKLKNGKYILVFIASWCPDCSFIKPHLPEIEQEFKDYTFISVDRDENTELAQELNIFGIPSFVIFRD
    GQEIGRLVNKDRKTKEEVENFITNTIN

    >gi|296100155|ref|YP_003620439.1| thioredoxin reductase [Leuconostoc kimchii IMSNU 11154]
    MIGAGPGGMTAALYAARANLNVAMLDRGIYGGQMNNTDDIENYPGFTTIKGPELGEKMYQGTVKAGVNFVYGDVQNVTVD
    DQQMKHIQTDSDELVASAVIIATGSNNRKLGVPGEEKFSGKGVSY
    CAVCDGSFFKGKNVTVVGGGDSAISEGLYLANVTD
    GVNVIHRRDRLRAQKVLQNRAFDNDKIDFTWNTSVTEILGDENHVTGVKIHNNQVGDDTTLDTDGVFVYVGNFPNSQIFN
    NLNITDQAGWIITNDQMETTIPGIYAIGDVRQKQLRQITTAVGDGGIAGQNAFEYFEAIKHRQTVKD

    >gi|296100156|ref|YP_003620440.1| protein-disulfide isomerase [Leuconostoc kimchii IMSNU 11154]
    MEIKYWSDIACPFCYIGSNRMKRAMKEIGIYDTTELEFKSFELNPATPKETDEGYINHFTQGNKAMEPQAKKQMAYIEQM
    AHNDGLPMDLDSVVPTNTMDAHRIIKFAEAKNDPDLTERVIRRFYQVYFSDGQSISDHDVLLNAAMEAGLAKDEVEKVLN
    SNQYHQAVVNDEAEAQQSGIHAAPFFVINNKYAISGAQPYEVFVKALKRVQEEEN

    >gi|296100158|ref|YP_003620442.1| hypothetical protein LKI_10471 [Leuconostoc kimchii IMSNU 11154]
    MKFDYVVIGSGPSVYRFLLGMQNSGKKIAVVEKNRFGGICPNEGCEPKIFLEGAARATLTSMRLQGKGITQPAKLDWKEL
    IQQKNKAMASFLNNMQSMYEGLGATTIKGEASFVDQHTIEVNNKKITADNFVIATGKKPHPLNIPGHEYLLTSTNLFELE
    DTPKNVAIIGSGYVGMEFATLLSAAGVKVTVIVRSGQPLEGFYSQHVHQLVDEMKNSLGINFIFNTNVTAVTEAQTGYEV
    QSANGNLGTFDKVINASGRVPEINALKLDNAGVEYSNRGIKVDKYLTTSANNIYAMGDIVDKTVPALTSTAQFEADYLSA
    LLTNKTTEPLRYPVIGTVTFTFPQLAQAGISIDKAKEDSNYSIKDIDITQGDFFYAGTDDHARLSLVFDKQNHLVGAAEI
    SQTAVDDINALIPVMAIDVDPKVWKEKMIMAFPGLAYKIRTLI

    >gi|296100304|ref|YP_003620473.1| probable pyridine nucleotide-disulfide oxidoreductase [Leuconostoc kimchii IMSNU 11154]
    MKHFSNIIIGFGKAGKTLAGTLAKHGEEVLVIEKDPNMYGGTCINIACLPTKNMIINAHRGIRYEAALKKKNDLTAKLRN
    KNYHKVADLSGVTVLTATAEFLDDHTLQVSDNSGQETLQADRIFINTGATPVWPNIDGLLNSKKVYSSTDLLAKDKQLKE
    LVILGSGPIGLEFASMYTQFGSHVTIVDKAPKILGKFEPEVAQQAKHDLEEDGISFLLESHITNVNDTLNGVTLTISTPE
    GMKEIQADGLLVATGRRANVTDLHLERTSIKTGSHGEILVNDVLETNAKDVYALGDVTGGPQFTYISLDDWRIIANNLYG
    NKTRSRLNRPVFANTIFLNPAISSIGRTEEQLREAGIDYTVLKISAASVPKAQVIGNPRSIYKALIDPQSHQILGTTIYA
    EESFETINIISLAMQNHLPAEALRDQIYTHPTMTEALNDLFDQI

    >gi|296100311|ref|YP_003620480.1| hypothetical protein LKI_10661 [Leuconostoc kimchii IMSNU 11154]
    MTKATLKLETLTCPSCLQKIERGLKQTAGVKKDSVKVLFNASKVKVDFDENQVNLNTIEKAIEDLGYPVISSKVKEGA

    >gi|296110188|ref|YP_003620569.1| glutathione reductase [Leuconostoc kimchii IMSNU 11154]
    MAEQYDVVVIGGGPAGNAMASGLKAQGKTVLIVEADLWGGTCPNRGCDPKKILLSAVEARQAAQHLQGQGLIGAPKIDWP
    ALMAHKRGYTDGINDGTLNGLKGQDIATLHGQAHFQSDNQLAVGDRVVSATDYVIATGQRPAILPITGHEYFKTSTDFLD
    LDQMPKRVTFVGGGYVGFELATIANAAGADVHVIHHNDRPLKAFDADLVKDLMAAMTADGITFDLNTDVQAITKTATGLQ
    LTADNFELTTDLVISSAGRIPNADQLGLANVGVTFDRHGIQVNDHLQTANPHIYAIGDVSDTPVPKLTPVAGFEARYLVG
    ELTHPGAAIKYPVVPTQVFAAPKLAQVGISAAAATEHPDEYRVNTLDMTKWFTYYRFGAQQAQAKVVVAKASGQVVGATL
    LSDVADEMINYFTLLIEKHVTLPDLQRLVLAYPTPASDLQYLY

    >gi|296110318|ref|YP_003620699.1| NADH oxidase [Leuconostoc kimchii IMSNU 11154]
    MKVIIIGATHAGTATIKSITKRHPDAVVDVYEKNDNVSFLSCGIALTVQGEVKNIEDLFYSSPEILEAAGANIHMKHEVT
    KVDTINKTVTILNLTTHETTIEAYDKLVATTGSWPVVPPIPGIEDERVVLSKNYSHAKELIRYANDDKIKRVVIIGGGYI
    GTELVEAFNVKGRDVTLIDNQPTVLNRYFDPEFTKNVANMFVNHGVSVETGKTVQAFESKDDGIVIKTDAGHFSADLVIM
    SVGFRPATQLFKGQLEMTENGALIINDYMQTSDPDVFAAGDSVAVHYNPTGENAYIPLATNAVRQGTLIGYNLTVPTVKY
    MGTQSTSGLKLYDLNMASSGLTGAHAAELGLDYDSLTMTDNFRPEFMSSTEPVLMTITWERGSQRILGVQLQSKYDISQS
    ANTASVAIQNRMTLTDLAFVDMLFQPWFDRPFNYLNLLAQAALDKEA

    >gi|296110616|ref|YP_003620997.1| thioredoxin [Leuconostoc kimchii IMSNU 11154]
    MTVKVIEDATFEKETANGVSITDFWATWCGPCRMQSPVLEALSEEVDNVDFVKMDVDANPDTPAKFSIRAIPTLLVQRDG
    EVVERLTGFHTKEQLANILSKYTK

    >gi|296110632|ref|YP_003621013.1| methionine sulfoxide reductase B [Leuconostoc kimchii IMSNU 11154]
    MAKYTDKELRERLTPESYEVTQHAATERPFTGKYDQWWDEGIFVDVVSGEPLFSSTDKYDAGCGWPSFTQTIDDQHIDRH
    VDHSFGMTRTEVTSRDAKSHLGHLFTDGPADKGGLRY
    CINSASLKFIPKNELAQAGYEQYLELFNS

    >gi|296110718|ref|YP_003621099.1| dihydrolipoamide dehydrogenase [Leuconostoc kimchii IMSNU 11154]
    MVVGAQARDVDTIIIGSGPGGYVAAIRAAELGQKVTIIERDEIGGVCLNIGCIPSKALINVGHHYREAISETPFGLETEN
    VTLDWSKTQSWKQNTVVNTLTSGVKLLLKKHHVDIIKGEATFNDNETVNIVQDDGHELLQFNNAIIATGSRPIEIPSMPF
    GDRIIDSTGALSLEQIPEKLIIVGGGVIGSELGGVYANLGTKVTIIEGLDHTLNGFDHEMTKPVLDDFKKQGGEVVTSAT
    AKSAVQTADHVTLNYEVDGKEQSVTGDYLLVAVGRRANTDAIGLNNTDVKLTERGVIDVAENMQTRVPHIFAIGDITAGP
    QLAHKASFQGKIAAAAISGDKQARDLHYSLPAVAYTQFELATTGEDLETIKSDNLEVKISKFPFAGNGRAISMDDTTGFI
    RLISDKKTNALLGAQIVGPSASDLISELSLAIENGLTTNDISLTIHPHPTLGEAIMDTAELADGLPIHI

    >gi|296110725|ref|YP_003621106.1| negative regulator of proteolysis [Leuconostoc kimchii IMSNU 11154]
    MVIVFSSPSCTSCRKAKQWLESHNIEYVERDVNKTPLRAEEVKALLRLTEDGTEELISKRSKVYANLNFDLDSISINEFI
    DLIVANPSLLKRPIIMDERRMQVGYNDDEIRRFLPKNVRQRELIRATFKADFADVAGDLVVEKD

    >gi|296110857|ref|YP_003621238.1| Peroxidase (Npx) [Leuconostoc kimchii IMSNU 11154]
    MSKTKIIIVGASHGGHQSILELTRQYQNIDIKLFEAGDFISFMSCGMELYLENSVTDVNDVRNFRPEDVEKLGAEIYNNH
    EVTAINSENKTVTVKDVKTGHEKKYNYDKLILSSGVTPNQLPVPGNDLENVYLMRGKDWATKIKAKLEDPTVKNITVVGA
    GYIGVEAVEASVKAGKHVTLIDMIDRPLGNYLDKDMTQLINQELLNKGVTVVTNVQITRYEGDENNQVVAVQTNEGEYPS
    DLVIQAAGIQPNTDWLKGTIDLDEKGWIKTDEYLRTNLPDVYAVGDAVLAYSIPAQTKMPIALASVVRREARYIAAHLFE
    KTPAVPFSGVVGSSALSVFDYHFATAGLNTTTAKKVGVTIKTAFYQDTLRPDYVPNQMGNPNVYASLAYDPQTHRVLGGA
    VLSTHDITAQGNVLSLAIQQKLSLEDLAQADFFFQPGFDRQWSLLNLAAQHALGEPRF

    >gi|296110962|ref|YP_003621343.1| glutathione reductase [Leuconostoc kimchii IMSNU 11154]
    MYDVIFIGSGHAAWHGAQILARAGKKVALIEENKVAGTCTNFGCNAKILLDGPAEMIHHLHHYHGIGINQTPDIIWPELM
    AYKHEVIDPLSDGLAHMLSVDGIDIIAGHAKFMTARSITVAGETYTAEQFVIATGQRPAKLPIVGSELTHDSTDFLDLPD
    MPKSMVFIGAGYIAMEFASIAHASGSHVTLIEHGDRALTGFDADYAKVVVADMTEKGIKFAFNHTVSGVSAVENGQYLVT
    TAQGDSYQVDYVMDTTGRVANTENLGLENIGVLSDRQGILVDHHLQTRVPNIYASGDVISKPIARLTPTATFESHYIASM
    LLGDKKPIAYPAIPTVAFTLPRIAQIGVTTDEAKKRSDLTVIEIPYGQIMRFQTLNDVHAAIKIVMNQDKHLVGAALIGD
    FAPEVINALVPVINKQYTSEDIKSQIFAFPTHTGIVLPMIANYLA

    >gi|296111032|ref|YP_003621413.1| thiol peroxidase [Leuconostoc kimchii IMSNU 11154]
    MNVLLSGEVTELVGEPLKVGETLPHFKLEDERGDKVKTADLVGKLTLISVVPDLNTGTCSLQTRHFNQSVDQFSNVQFLT
    ISTNSVAEQRDWCAAEGVHNLRMLSDEQESFGYATKLYVPAQGFDARAVYIVDEQGVVRYAQIVPEISEEPNYEEALTAL
    KSFLTA

    >gi|296111324|ref|YP_003621706.1| glutathione reductase [Leuconostoc kimchii IMSNU 11154]
    MTKQYDYDVLYLGSGHGTFDGAIPLAQSGVKVGIIEADMIGGTCPNYGCNAKITLDAPVTLTRAAERLSGIVQGNLTIDW
    TQNEAHKEAVINELPDMIGGLLDQSGIDVIHGRGVFEDNHTIIVDGKAVTADKIVISTGLRPHRLDIPGTELAHDSRDFM
    ALKTLPQKIAIIGSGYISMEFATIANAAGAEITVLMHGDRALRQFHAPYVDKVVTDLEQRNVTFVPNADVTAFEKHGDQT
    QVTYSDGQSLLVDWVLDASGRIPNVENIGLETIGVTYNQSGIPVNDYLQTNVDNIYASGDVLDKTQPKLTPTAIFESTYL
    FKQFSGQTKSPIQYPVVPSVVFTSPRIAQAGVLVADAEQGDYEVQQTDLTKDWYRQVDNETIADNTLIFDKQHHLIGVTE
    VSEQAENVVNTLLPAIEFKFGPDEIGRLIHLFPSISMATWGQL

    >gi|296111326|ref|YP_003621708.1| redox protein, regulator of disulfide bond formation (putative) [Leuconostoc kimchii IMSNU 11154]
    MAIRHLYHTEVENTAGLVGRVQTVTGDGLDVMTSGPLSTTPGTNPEQLLAAAFATCLNATIEAEEKRRQIPHKSIVRVGV
    DMAPDHEGFQFFVHAQVKIPQVNEQEALDILAIAEKR
    CPVSKLLAGSSNVDISLVDVFDLQ

    >gi|296111544|ref|YP_003621926.1| thioredoxin family protein [Leuconostoc kimchii IMSNU 11154]
    MYQPNHNTDVTIETHIKSKGRHILFLSADWCGDCRAIKPFVQNIKDTITKTSSWIDADRDENIAVATNHNLRGIPSFVLF
    QDGEELSRIGHGERLTPNQVLDWYETTI

    >gi|296111798|ref|YP_003622180.1| thioredoxin reductase (NADPH) [Leuconostoc kimchii IMSNU 11154]
    MADYKRYDVVIIGAGPAGMTAATYASRANLSVLMLDRGIYGGQMNNTAEVENYPGFDSILGPDLSEKMYASSTQFGAEYG
    FGVVENIEIEGHNKIIHTDMDNYIAKAVIIATGSEHTHLGVDGEEDYQGRGVSY
    CAVCDGAFFRNDDVVVIGGGDSAVEE
    GLYLANVVKSVTVLHRRDKLRAQQITQERAFDNDKMSFRWHTEVTEILGDGDKVTGVRVINNQTQEVSEIATGGVFVYVG
    LKPNTQGLENLNITDKAGWIMTDDRMRTAVDGIFAVGDVRAKELRQITTAVGDGSVAGQGVYDYISALPAEVKSV

    >gi|296111837|ref|YP_003622219.1| methylated-DNA--[protein]-cysteine S-methyltransferase [Leuconostoc kimchii IMSNU 11154]
    MITYDTAPFLGRQLTLFKSQDALVFISLADDAYANFYSFYPDEQVTRAEIPELHYFERYAAGQFVDWSQLKTAYLKGTPF
    QRDVWQAMREMKLSETLTYSELAVRAQHPTAIRAVASAVGKNPLTIINP
    CHRILPKSGGIGKFRYGSVIKQAILALDQQM
    ILAK

    >gi|296111866|ref|YP_003622248.1| Peptide methionine sulfoxide reductase [Leuconostoc kimchii IMSNU 11154]
    MTKTIETAIFAGGCFWCMVEPFDSLPGIEKVRSGYTGGHTVNPTYEEVSSHTTGHTEAVKIWFDPEKLTYDELVTIYWEQ
    TDPTDAMGQFQDRGDNYRPVIFVANQAQREIAEQSKASLQASARFEQPIVTTIEDAKPFYDAEEYHQDFYKKEPTREALE
    MEQRLAFKQKNWQKK

    >gi|296112145|ref|YP_003622527.1| glutathione peroxidase [Leuconostoc kimchii IMSNU 11154]
    MSDDVYQFTVTTEDGKTYSLDKFRGRPMIIVNTATKCGFAPQFSDLEKIYQTYQEQGLVILGFPSNQFKQELDSSHEAAQ
    ACQLTYGVTFPMHQLIAVNGKNTDPLFKYLKKNADSPLGTTIKWNFTKFLVNREGQVIKRFAPKTNPADMIPDIKRVVDQ
    TV

    >gi|296112155|ref|YP_003622537.1| protein-methionine-S-oxide reductase [Leuconostoc kimchii IMSNU 11154]
    MHLNDNEIQRDIYNLILNPSTREWERESLLKVKDRRADVNFSTQLDDIKSDLRPLALRHNLTPDVMDFYLKISGEPQPDS
    SDKVRLHDEADPPHQERAIFAGG
    CFWCMVSPFDKRPGITAVISGYTGGEFDNPNYDQVVGQYTGHVEAVEILFDKRLITY
    QELVDIYWQLIDPTDNMGQIDDRGESYRPVIFVNNDEQRQIAEQSRQAVIDSEIYSKPIVVEISDVTRFWPAENFHQDFY
    KKNTSRYRKIERTRRLYLSLQHSKNMMRKLFKKVKG