Leuconostoc citreum KM20 uid58481

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|170016269|ref|YP_001722992.1| copper chaperone [Leuconostoc citreum KM20]
    MIYIKYLKKNGLYNLFKGVIDMTKATLKLETLTCPSCLQKIERGLKQTAGVKKDSVKVLFNASKVKVDFDENQVNLNTIE
    KAIEDLGYPVISSKVKEGA

    >gi|170016282|ref|YP_001723004.1| thioredoxin [Leuconostoc citreum KM20]
    MFFYLERNLSMVENLTYENFDISTSEGVVLTDFWAEWCAPCRMQSPIIDQLDDEIGNQVKFTKVDVDNNQQVATSLGIRS
    IPTLVVKKNGEIVEKLVGFHTKDQLKKVLAYYA

    >gi|170016283|ref|YP_001723005.1| thioredoxin-related protein [Leuconostoc citreum KM20]
    MEKVFYNSFNELKHKIKNGKYVLVFTADWCGDCKFIEPVLPEIENTFREYQFINIDTDKNMHIARSLNIFGIPSFVVYDS
    GKEIDRLVNKDRKTKNEIISFIDQAIER

    >gi|170016284|ref|YP_001723006.1| thioredoxin-disulfide reductase [Leuconostoc citreum KM20]
    MLEYDVIVIGAGPGGMTASLYAARANLKVAMIDRGVYGGQMNNTDDIENYPGFPTIKGPDLGEKMYQNTVNAGVEFIFGD
    VQEVTVDDNQYKHVKTDSEDLVSKVVIIATGSNNRKLGIPGEKEFSGKGVSY
    CAVCDGAFFKNENVTVVGGGDSAISEGT
    YLANITDHVGIVHHRDKLRAQKVLQDRAFSNNKIDFTWNSNVVEIVGDDNRVTGIKMVDNQSGKLTTVDTTGVFIYIGNI
    PNTQMFSNLNITDESGWIITNSEMETNIPGIFAIGDVRLKKLRQITTAVGDGGIAGQNSFEYIEQFNEK

    >gi|170016285|ref|YP_001723007.1| protein-disulfide isomerase [Leuconostoc citreum KM20]
    MEIKYWSDIACPFCYIGSNRMKRAMKELGIYNTTELEFKSFELDPTTSKETTEGYINHFTQGNKSMEDQAKQQMAYIEKM
    AHDDGLSMDINSVIPTNTVDAHRLIKLANSKHDPVLTENLIRRFYQVYFNDGRSIADHNVLVNAATEVGLYKDEVEVILN
    SDKYFQEVKADEIEAMQSGIHAAPFFVINNKYGINGAQPYEVFINALKQVQDEEDKAKG

    >gi|170016286|ref|YP_001723008.1| glutathione reductase [Leuconostoc citreum KM20]
    MKTYDYTIIGSGPSVYRFLVGMQGSKKRILVVESDNFGGICPNAGCEPKIFLEGAIKTALTSRDLLNKGIESPAKLNWND
    LILEKKRVFSPVSTNNQHAYEELGADTVRGTASFVDEHTIKVDETLITSDNFIIATGLKPRPMNIPGSHLFLTSDDFFNM
    EDLPATVAIIGSGYVGMEIATILSAAGSNVTMLQRSDRPLRDFDSRHVDMLIKNMKENLGIDFRFNTQVTKAEKTSNGIL
    VTTDNGQNLEFSTVINATGRIPNINALNLENTKVDFDKDGVIVDKYLRTTASNIYAIGDVIKKDIPRLTLTAQFEGAYLS
    AYLLGKKKSEIHYPVIGKVTFTFPQLASTGVDIDQARLDPNLTVKDIDISKGDFLYAGTNDYNAHLSLVYDQNQRIIAAS
    EISQTASDDINIFIPIIALDIDQNLWNEKMVMSFPSLAFKLRNIL

    >gi|170016287|ref|YP_001723009.1| thiosulfate sulfurtransferase [Leuconostoc citreum KM20]
    MVLDIIQYKNSLYDELAHFSKGLASNKRLEILDLLLQASKSVDSISRDTGNSVANTSRHLQVLKESHLVASSRNGNQIIY
    SLASDNVVSLVRTLMKVGERESSEMKYIQKEADNDQYVKTISLEKVRQEIDNIFLLDVRPKDEYIANHILGAINIPLNEL
    IDNINIIPKNKKIIVYCRGRL
    CANSNFAVKKLNQYGLNAYSLNSSVHDWQEIAHNSDS

    >gi|170016288|ref|YP_001723010.1| thioredoxin [Leuconostoc citreum KM20]
    MVKEIELTSENYEESVSKGVILVDFRADWCAPCRMMDSVLDKIAEDPIYESIKFGKVNVDNNMELNIRHSISGIPTFLLY
    KDGKLITREVGLQTKNTVKSMLNNLL

    >gi|170016488|ref|YP_001727407.1| glutathione reductase [Leuconostoc citreum KM20]
    MMYDIIFIGSGHAAWHGAQTLARAGKKVALIEENKVAGTCTNFGCNAKILLDGPAEMIHHLHHYHGVGINETPDIIWPEL
    MAYKHQVIDPLSDGLARMLSVDGIDIIAGHAQFVDTQTISVGQTTYTAAQFVIATGQKPAKLPIPGAELTHDSTDFLDLP
    DMPKSMVFIGAGYIAMEFASIAHAAGSQVTLIEYGGSALNGFDKLYAETVVADMRAKGITFAFNQAVSEVKALDDGQYVI
    ETSQGTRFQADYVMDTTGRTANIDQLGLDSIGVAYDRQGVLVNDHLQTTVHNIYASGDVISKSIARLTPTATFESHYIAK
    VLLGEKAPIRYPVVPTIAFTLPRVAQVGVTSQEATMRDDLQVIEIPYGQMMRFQTLNDSQAALKIVVNTEKKLLGAAMIG
    DFAPEIVNALVPVINKQYTRDDIQSQIFAFPAHTGVVLPMIANYLD

    >gi|170016541|ref|YP_001727460.1| peroxiredoxin [Leuconostoc citreum KM20]
    MNVLINGEEAALVGEPLAVGEALPHFKLEDKNGEKVKTVDLLGQVTLISVVPDLNTGTCSLQTRHFNQTVDQFKNVQFIT
    ISTNSVAEQRDWCAAEGVKNMRMLSDEQESFGYATKLYLPANAWDTRAVYIIDAQGIVRYAQIVSEVSQEPDYDNVLAAL
    SELTK

    >gi|170016778|ref|YP_001727697.1| transcriptional regulator Spx [Leuconostoc citreum KM20]
    MVTLYASPSCTSCRKAKQWLENHDIPYVERNLNKTPLSVAEIKAMLRLTEDGTEELISKRSKIFSQLNLDLDNISINTLI
    DLIVTHPSLLKRPIIIDERRMQVGYNDDDIRRFLPREVRQRELIRATFKADFNEKAKDLIVEEG

    >gi|170016785|ref|YP_001727704.1| pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component [Leuconostoc citreum KM20]
    MVVGAQAREIDTVIIGSGPGGYVAAIRAAELGQHVTIIERENIGGVCLNVGCIPSKALINVGHHYRNALAETPFGLHIDG
    ATLDWQKVQDWKQNKVVNTLTSGVSMLLKKHHVEIIKGEATFNDNETLNVVQEDGHELLQFNNAIIATGSRPIEIPTMPF
    GGRIIDSTGALSLENIPKKLIIVGGGVIGSELGGAYANLGTEVTIVEGLDHTLNGFDAEMTKPVLADFEQHGGHIVTSAM
    AKSAQQTDQDVSLTYEVDGEEHTITGDYLLVAVGRRANTDGLGLNNTDIKLSDRGLIEIADTMQTNVSHIYAIGDVTIGP
    QLAHKASFQGKIAAAAIAGEAQAHDLHYSLPAVAYTQFELATTGETPESAKAKQLDVKIAKFPFAANGRAISMDETTGFI
    RLISDTATHGLLGAQIVGPSASDLISELSLAIENGLTTNDISLTIHPHPTLGEAIMDTAELADGLPIHI

    >gi|170016787|ref|YP_001727706.1| thioredoxin reductase [Leuconostoc citreum KM20]
    MTKPHIYDTLIIGGGPAGLSAGIYAGRATMDTLIIEGNQIGGQVTTTSSVANYPAVDTIEGTQLVNNMKQQADAFGVNFV
    SDTITSVDFSQPAVKTVSGKQNTYQARSVIIATGAQPHQVGFTGEKEFRGRGVAY
    CSTCDGELFSGLEVFVIGGGYAAAE
    EAEYLTRFARHVTVVMRSDDFTCPPLTADRARLNDNITVWPNTEVQSVSGKDYLTEAVFINNQTHEKKVYHVAQGDNTFG
    MFIYVGTDPQTDLFTEKLTLDDDKYIIADNKCQTNISGVFAAGDVIAKPLRQIVTAAADGANAATSAEVYVTNLKKALHI
    PIQRTQITKKHQQPDNMRQQSQLGDEPHTATQHQGQWFDQNLIKQLQPIFDQLSKTVILSQITDNSDKSHELSSFLTELA
    ALSQHLTLRITEAKAADMPLLPHFTLLNENNAATGIAFSGIPTGHELNSLVLALYNVAGPGQKLDTQLQSRIKALPATDI
    KIGVSLT
    CHFCPDVVAACQHIAALNPHVSAEMIDLQLFPDIRNSHHIMSVPAMMIDNQPDIIFGSQTMSDIVTAIENVNA


    >gi|170016788|ref|YP_001727707.1| peroxiredoxin [Leuconostoc citreum KM20]
    MTNFIDQEIADFSVNAYHDGDVTQVTKQDTLGKWGVYFFYPADFSFVCPTELGDLADHYADFQKANAEIYSVSEDSEFVH
    KAWAEATDTIAKVKYPMLADPAGKLARFFNVLDEDAGLAFRAVFIVNPEGKIQSYTINNMGIGRNAEEILRTLEAAQFVA
    EHGDRVCPANWHPGEDTIAPSLDLVGKI

    >gi|170016808|ref|YP_001727727.1| putative glutathione reductase [Leuconostoc citreum KM20]
    MMTIKKYDVGIIGSGPAGLAAAQDLKKAGKSVVVIEKYLWGGTCPNYGCDPKKLLLAAVEAKESVTFLADKGVKGHNAID
    WSALMAHKTQFTSKVSESTLASLATNEIDHVFGQAQFVNHNTVKIGATDTTIKATDWVIAVGQRPAKLTIPGADLAIDSE
    AFLSLATMPKAIAIIGGGYIAFEFAAIAAGAGAEVHLIVHNQRPLKQFNEELVKRLVNALEKRGVIIHYNMQVSAISQDN
    HDFVVHSNQNSGIKVGKVISAVGRLSNADTLALNHAGVMYEHSGVRVNQYLRTTNPHIYAVGDVANSGVAKLTPVGAYEG
    RYVAKVIVNAQQSPINYPAIPVVVYGTPKLAQVGVTLEQAENQPNLTSHSLDMTNWFSYYRMGEPVVHAKIILDDAGVIV
    GATVIGTHADELINYLTSAINQKANYQDVTNHIYAYPTIASDLPYFF

    >gi|170016875|ref|YP_001727794.1| thioredoxin [Leuconostoc citreum KM20]
    MVVKAITDAEFKEDTAKGVSITDFWATWCGPCRMQSPVLEALSEETEHVNFVKMDVDQNPETPSAFSIRAIPTLLVQKDG
    EVVERLTGFHTKDQLAKVLAKYTN

    >gi|170017113|ref|YP_001728032.1| glutathione peroxidase [Leuconostoc citreum KM20]
    MADTVYNFDVVKEDGKLYSLATLKGKIIIIVNTATKCGFAPQFEELETLYRTYGDKGLVILGFPSNQFKQEVDSSHEAAE
    ACRLTYGVSFPMHQIIAVNGKNTDPLFKYLKQNTPSPLGSTIKWNFTKFLVGRDGVPVKRYAPKTRPQDMTADIERLL

    >gi|170017127|ref|YP_001728046.1| peptide methionine sulfoxide reductase msrB [Leuconostoc citreum KM20]
    MNDKELAARKTALEPLVYDVTQNRATEKPFSGQYDAFYEDGIYVDIVSGEALFNSRDKYDAGCGWPSFTQPIDKHITEIA
    DHSHGMKRIEVRSTEADSHLGHVFPDGPSESGGMRY
    CINSAALKFIPKKDMAKAGYAEYLSTL

    >gi|170017156|ref|YP_001728075.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase:pyridine nucleotide-disulphide oxidoreductase dimerisation region [Leuconostoc citreum KM20]
    MSKTKVIVVGASHGGHQAILELTRQYPELDIKLFEAGDFVSFMSCGMELYLEDSVTNVNDVRNFSPENISHLGAEIYNNS
    EVIAINTQQKTVTVRDTTANQTQEYDYDKLILSSGVTPKRLPVAGSTLENVYLMRGKDWATKIKAKLEDPSVQNITVVGA
    GYIGIEAVEASVKAGKNVTLIDVIDRPLGNYLNTPLTTIIEKELKDNGVTVITGANIQSFEGQDKVTAVKTNNNNYPTDL
    VIQAVGVQPNTSWLDGVVALDNRGWIKTDEYLRTNVSDVYAVGDAVLSYSIPAQTKLPIALASVVRRQVRYVITHLFENQ
    PALPFNGVVGSSALSVFNYKFATAGLNTTTAEKANVTLRSAYYQDQLRPNYVPKSKGNCDVYVTLDYEPQTHRLLGGAVL
    STYDITAQGNVIALAIQHHLRLEDLAEADFFFQPEFDRQWSLLNLAAQHALGEPAF

    >gi|170017162|ref|YP_001728081.1| glutathione reductase [Leuconostoc citreum KM20]
    MATYDYDVLYIGSGHGTFDGAIPLGAKGKKVAVVEQDLVGGTCPNRGCNAKIILDSPVALQRHMENVHGVVTGETTINWP
    ANQAHKHAVIDGLPAFIQGLLDNNNIDIIFGRGILADEHTVKINGQAKTANKIVISTGLRSNRLDIPGTNFAHDSEEFLN
    LEQIPQHVTVIGAGYIAMEFATMANAAGAKVTVLLRGDKALRAYHQPFVEEIINDLTQRGVTFMRGVTVDEITENGQQYT
    VNTGSATIETDWVLDATGRIPNVENIGLEEVGVKYNAKGIVVDDYLRTSVPNIYASGDVIDKSQPKLTPTAIFESLYLMH
    TFAGETTEPIVYPVIPSVVFTSPRLAQVGVTVAEAKAHPESYTLEINHIPDDWYRQVDQEQMGDNVLIFDKNHKLVGATE
    VSHKADDVINALLPAIEFKFGPSEIERMVHLFPTIASSAWGQL

    >gi|170017292|ref|YP_001728211.1| NADH oxidase [Leuconostoc citreum KM20]
    MKVIIIGSTHAGTATIKSILKHNSGVEIDVYEKNDNVSFLSCGIALTVQGEVKEINDLFYSSPAILEEAGANIHMNHEVT
    AVDTINKTVSVTNLVTGVSSVESYDKLVATTGSWPIIPPIPGIEDQRIVLSKNYTHAKALINYANDDRIKRVVIIGGGYI
    GTELVEAFNVKGREVTLIDNQPTVLNRYFDHEFTENVAELFQSHGVAVATGKMVESFESQDDAVIVKTNDGNFSADLVVM
    SVGFKPNTGLFAGQLGMTGNGALLVNDYMQTSNPDVFAAGDSVAVHYNPTGENAYIPLATNAVRQGTLIGYNLMSPKVKY
    MGTQSTSGLKLYDLNMASSGLTAAHAQELGIDADSITMTDNFRPEFMSSTEPVLMSITWERQTHRILGVQLQSKYDIAQS
    ANAASIAIQNRMTLTDLAFVDMLFQPWFDRPFNYLNLLAQAALDKVESE

    >gi|170017532|ref|YP_001728451.1| peptide methionine sulfoxide reductase [Leuconostoc citreum KM20]
    MNMTDNIETAIFAGGCFWCMVQPFDSLPGIEKVRSGYTGGHTENPTYEDVLSHTTGHTEAVKIWFDPAIMSYEELVSIYW
    EQTDPTDAMGQFQDRGDNYRPVIYVADEQQRQIAEKSKAALAASGRFDEPIVTTIESAKPFYEAEEYHQDFYKKDPNREA
    LAMRQRAAFQADKWGK

    >gi|170017567|ref|YP_001728486.1| methylated DNA-protein cysteine methyltransferase [Leuconostoc citreum KM20]
    MIIYDTMKFKNWQLTLFKDNDAIVFISFADDGVGEFSLQYPRMKLQYAKIPELRYFEQYLSGERVDFKSLNVAYLSGTPF
    QISVWHALHEMGKDEKLTYQQLAQRAGQPTAIRAVASAVGKNPLTIINP
    CHRILPKNGGVGQYRYGQALKKLLISLDDSE
    TTQYF

    >gi|170017600|ref|YP_001728519.1| thioredoxin-disulfide reductase [Leuconostoc citreum KM20]
    MADLKRYDVIIVGAGPAGMTAATYASRANLSVLMLDRGIYGGQMNNTADVENYPGFDTILGPDLAEKMYASSTQFGAEYG
    FGSVESVELQGQDRIVHTDMGDYVTKAIIIATGSEHIHLGVDGEEQYQGRGVSY
    CAVCDGAFFRDEDVLVIGGGDSAIEE
    GLYLTNLAKSVTVLHRRDKLRAQQIIQDRAFDNEKMAFRWHTEVLKITGDDEKVTGVDVINNQTQEVSHIDASGIFIYVG
    LMANTQGFENLNITDSEGWILTNEKMETTIPGVFAVGDVRAKTLRQITTAVGDGGIAGQAAYDYISSLPSVNEATTSVKA
    NS

    >gi|170017738|ref|YP_001728657.1| putative glutathione reductase [Leuconostoc citreum KM20]
    MVEYQYEVGVIGAGPAGLAAAFAAKALGKKVVILEQYLWGGTCPNYGCDPKKILLAAVENIKRQKALQTRGLHGYSQINW
    SDLIAHKQRYVDAVQPRKIRGLDQAGIARFYGHASFINEDTVRVGDFKDTIRASDWVIATGQRPQTLNFPGSGYTQNSED
    FLNMPNMPEDVTFIGAGFVGVEFATITNTVGAHTRIVTEGQTALRAFDQILVQQLMTEMQESGIEWYFNATVCRIDKALT
    GRLVVKLTNGTTFETDRVFVTAGRIGNFDQMNLAAAGVACQVADLPVDEHLRTSNSHVYAVGDVGGSPVPKLVPTGNYEG
    RYVAQVIAGKTNAPISYPTTPIVVFGSQHIAQTGLTVAAGRTAGYRVIDMDMSDVITFFRYHDQVRVRVVLDHNDCIVGA
    SVIAAEAEEVINYFVTAINERRTLAETQANLYAYPSLGSEFATFY

    >gi|170017830|ref|YP_001728749.1| Thiol-disulfide isomerase or thioredoxin [Leuconostoc citreum KM20]
    MYQPVKNTNAVVTENIHKPGRNVMFLSADWCGDCRAIKPFIQNIKDTVSQTANWFDADRDDNLDVATAYNLRGIPSFVLF
    ENGKEISRIGHGERLTPKQILDWYQRTLN

    >gi|170017906|ref|YP_001728825.1| glutaredoxin [Leuconostoc citreum KM20]
    MEKVTVYTKYDCVQCKMTKKFLETQGIPFREINIEEEIEYVDELKADGFRQTPVVSIEGMPKFSGFRPDVLKKISA

    >gi|170018013|ref|YP_001728932.1| redox protein, regulator of disulfide bond formation [Leuconostoc citreum KM20]
    MTTQVLYHTEVENAEGIAGRVHTINSNDLNITVSSPLSSEAGTNPEQLLGAAFATCLNATLEAEEKRQGLAHRSVVRVLV
    DMSRDVIGFQFHVEARVYIPDVERQLAQNILDTAAQR
    CPVDKLLSGSKNVVVRLVDSLDES