Leptotrichia buccalis C 1013 b uid59211

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|257124865|ref|YP_003162979.1| Redoxin domain protein [Leptotrichia buccalis DSM 1135]
    MSEIKNKVTFKGNPVTLVGNEVKAGDVAPDFTVLSAELKEVKLSDYKGKVVVIAVFPSVDTGVCALQLSRFNQEAANFGD
    DVQLLSISVDLPFALGRYCADKGIKNALTTSDHKELDFGTKYGFVIKELRLLSRGTVIVDKDGIIRYVEYVPEIGEHPDY
    EKALEVIKELV

    >gi|257125075|ref|YP_003163189.1| peroxiredoxin [Leptotrichia buccalis DSM 1135]
    MSLIGKKIENFTAQAYQNEEFREVNFEKDFLGKWNVVVFYPADFTFVCPTELEDLENHREELEKLGFNVYSVSTDTHFTH
    KAWHDHSEAIGKVKYTMIGDPTKAISREFEVLNEESGLAYRGTFVINPEGKIVAYEVNDEGIGRDASELVRRAKAAKFVA
    DNPGLVCPAKWKEGEATLKPGLDLVGKI

    >gi|257125076|ref|YP_003163190.1| alkyl hydroperoxide reductase subunit, FAD/NAD(P)-binding, detoxification of hydroperoxides [Leptotrichia buccalis DSM 1135]
    MALLDSNIVEQLKMYFDKINGNIELVSFLDESEKSKELDSFLQEVDAISGKVNYVKKSFENDKADLEKAKITRPISFTIL
    KDGENTGINFSGIPGGHEFNSFILAILGLAGLGKKLEGEQLAKAESVNKPVNIETFISLS
    CTHCPDVVQALNLISASNKN
    ITATMVDSAVFFEEAKEKDIQAVPVVFIDGEQKSVGAKTIEELLNLVVNA

    >gi|257125114|ref|YP_003163228.1| Redoxin domain protein [Leptotrichia buccalis DSM 1135]
    MKKLIVTIVTLLSFGSISFGNTLQGVQLKDINNKPVSLNKYKGKKIYIKMWASWCPICLSGLSEINSLSADKSKNFTVIT
    IASPGQKGEKPTAKFIQWYKGLNYKNTTVLLDEKGEVLKRAKVLGYPSNIILDGNLNIVKTLPGHLTAAQIKGAVK

    >gi|257125116|ref|YP_003163230.1| methionine-R-sulfoxide reductase [Leptotrichia buccalis DSM 1135]
    MKSRSLLLFLILSLALFSVVLSNKNKNRKNRNENKPKKENIIQTGNENIREIYLAGGCFWGLEAYMERIDGVKDATVGYA
    NGKTEKTSYNIVASTDHAETVHVKYDANKISLSKLLKYYFQVVDPTSINQQGNDRGRQYRTGIYYTNPKDKEIILQEIEE
    EQKKYTDKIQVEVQPLKNYILAEEYHQDYLRKNPNGYCHIDITKADEVIIDPKDYPKPSDEELKKRLTPLQYSVTQKKNT
    EHSFSNEYWDNHEAGIYVDITTGEPLFSSKDKYDSGCGWPSFTKPISKDVVTYANDTSFNMVRTEVLSRSGKAHLGHVFD
    DGPKDKGGLRY
    CINSASIKFIPLKDMEKEHYGYLIKLVQ

    >gi|257125332|ref|YP_003163446.1| dihydrolipoamide dehydrogenase [Leptotrichia buccalis DSM 1135]
    MTEGQIIKWNKKEGEKVEEGEILLEIMTDKTSMELEAEESGYLIKIVKGDGETVPVTEIIGYIGAEGEVAPEAGSASPAL
    ENTASQSVPEKVAAASEPKKEKAEDEFDIVVIGGGPAGYVAAIRAAQLGAKVAVVEKSEFGGT
    CLNKGCIPTKTFLKNAE
    IIEGIEMAGKRGIILESEKYTIDMPKVVQLKNDIVKTLTNGVRGLLKSNEIKMYNGIGKINKDKDVVVNGETVLRADKII
    LAGGSKVGKINIPGIESKKVLTSDDILDLQQIPKSLTVIGGGVVGIELGQVFLSFGSEVTVVEMMDRIVPGVDRESSVVL
    RKELEKKGMKILTSTQIKEIFDDGHNLTIKVDGHDDIVSEKALLSIGRVPDLEAVGELELEMEKGKIKVDKYMETSISGI
    YAPGDINGIKMLAHAAFRMGEVAAENAVQGNHREIRLETTPSAIYTVPEVAMVGLTEEEAKEKYDIKVGKFQFAANGRAL
    ASGETAGFVKVITDKKYGEILGVHIVGPSAAEIINEASGLMAMEITVDEVIKTIYAHPTYSEALFEACADALDEAIHLPK
    KRK

    >gi|257125379|ref|YP_003163493.1| heavy metal translocating P-type ATPase [Leptotrichia buccalis DSM 1135]
    MTEKNYTVTGMSCAACANAVEKALNKNNDINASVNIATEKLNIEYDEKKYDFDKIREIVKSAGYGLVEDMTEDKKLELYQ
    EKITSLKNRLILAIIFVVPLLYISMGHMLGATLPEFLNPKVNPLNFALAQFVLTLPIIYAGRDFFSHGFKNLVRKSPTMD
    SLIAIGATAAVLYGIYATFRIVTVDPEAHMDLYYESAGTIITLILFGKLLEAKTKGQTSSAIKKLIGLQPKKAKIIENGA
    EKEVLIEKLKVGDIVIVKPGEKIAVDGRIVEGATSVDESMLTGESLPVSKKIGDKVVGGSINKNGSIRFEATEIGKNTVL
    SQIIKLVEEAQGSKAPISRMADIVAAYFVPIVIGIAIITGIAWFLSGSGLVTALSFFIAVLVIACPCALGLATPTSIMVG
    TGKGAENGILIKSGEALETAHKIKTIVFDKTGTITKGKPVLTDLIAYGNYNENELLKITASVENDSEHPLAEAIVNEAKE
    KNIEIKPYEKFRAMPGYGIRATFEGKEVQIGNRKLMENRKINVEISQKDYDILSNEGKTPMYISIDNELAGLVAVADVIK
    ETSKEAIEKLKKMGIKTIMLTGDNEKTAKFIAKQVGIDDVISEVLPYQKSQKVKELQEKDEFVAMVGDGINDSPALAQAN
    VGIAIGNGTDVAIESADIVLIRNDLRDVAGAIALSKVTITNIKENLFWAFFYNVLGIPFAAGIFYAFFNGPKLDPMIAAF
    AMSFSSVSVLGNALRLKFFKVK

    >gi|257125472|ref|YP_003163586.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Leptotrichia buccalis DSM 1135]
    MKKIILIMSLLLLFVVSCGASKVFSVDVEGKGEIPNFELKDLNGKKTESKKIFQNGKKTLFIIAAEWCPHCKQEMPEVQK
    FYDANKDKVNVVVVYSNAQSNLGKVQRYVKDNGYTFPIYYDEEGYITSGFGLDAFPFNLKINNNKIEEKLELPIDLESLT
    AAFAK

    >gi|257125624|ref|YP_003163738.1| heavy metal translocating P-type ATPase [Leptotrichia buccalis DSM 1135]
    MKTNECTLFIEGLDCPNCAAKIERKLNTLQRIKAATVDFLGKRVIVESEDFSQDELAKFIQTEVDKIEDGVKISTKRLHS
    HGHTHHHSHSNSHVHSHSHTHGEGDTDKIKKKLLIGGIIFVLGIFIPKTLFIPKFAVFLVSYFIIGGDVLVSAVKNILRG
    QVFDENFLMSIATIGAFAIGEYPEGVAVMLFYQLGELFQGIAVNNSRKSIIALMDIRPDYANLKTDSEIKKVNPDEIKVA
    DIIVVKPGEKVPLDGKIITGNSTFDTSALTGESLPREAKTGDIVLSGFINKTGLVEIEVTKVFSESTVSKILDLVENSSS
    KKSKTENFITKFAKYYTPAVVITALIMAIFPPLLISGATFTDWIYRALIFLVVSCPCALIISIPLGFFGGIGGASKHGIL
    VKGANYLEALNDVESIVMDKTGTLTKGVFKVTEINVENNVKINDFENNKTDLTQPLLLKYAAHIEKFSNHPIAQSIVSEY
    ENSIAKTDESIVKDFKEISGFGIKANINNHQILAGNSKLMNSENIRFDKKENLGTVVYIAFNRQYIGNILISDEIKEDSP
    KAIRGMKANGIKEIVMLTGDNNAIGKNIAEKLEIDKVFAELLPNEKVEKLEEIYKTKSEKGKVVFVGDGINDAPVLARAD
    IGIAMGGVGSDAAIEAADVVIMNDEPSKIVTAMKIAKKTKTIVWQNITLAFAVKLIVLILGLFGDATMWEAVFADVGVAL
    LAVLNATRVLKYKVNENY

    >gi|257125881|ref|YP_003163995.1| hypothetical protein Lebu_1107 [Leptotrichia buccalis DSM 1135]
    MRRIVKFEKNDCNPCAMVSDLLDKKGVEYERVNPFDNPEMAVKYRVRSVPTVILFEENKEIKRTIGFKPEEINEIISMI

    >gi|257125895|ref|YP_003164009.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Leptotrichia buccalis DSM 1135]
    MKIVVIGGGAAGMMFSTQYKKANPEDEIILFEKSSYVAWAGCPTPYFIADELKKSDVLHGTPEDFIKRGIDVKIHHEVTE
    INFENKTVTVKGDEINGIIFYDKLVIAVGAKSFVPNIAGYSKDLENVFTLSHAEHAFEIKDFLNENKSKLKNAVVVGAGF
    IGLEMAESFRKNGLNVTLIEKADQIFPNVSENLKKRIYKEIEKNDVVLKLNSGVSEIISENNVAKSVKLDNGETVDFDIA
    LFSIGITPNIDFLPKELKTDSGKITVNDKFETNIKDVYAIGDCIFNKYYKTGRNLYAPFGDVANKHGMFLAKHLSGKDVS
    WKGLIRSFATSFYDVKLAQTGLSLKEALQLGYNADIVSMKAMYKNSGFEDSVPASAEIIYDRDRKIVLGGAMVGKEAVAQ
    FVDQMAIVIALETPIEKFIEIDFAYSPTNASVWNPLLVTYRKVIK

    >gi|257125911|ref|YP_003164025.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Leptotrichia buccalis DSM 1135]
    MKVVVIGCTHAGTAAILNLRKINPNAEITVFERNDNISFLSCGIALYVGGVVKDPQGLFYCSPEKLRELNVDTRMRHEVK
    NVDIEGKKVRVVNLETGIEFNETFDKLIITSGSWPIIPPIEGIDLNNILL
    CKNYNHSNEIIERAKHSQKVVVVGAGYIGV
    ELVEAFRDNGKEVVLVDAEERILSKYFDKEFTDVAEESFKHRGIVIATGEKVVKFEGSNGNVTKVVTDKNEYEADMVIMC
    VGFLPSTSLFKGQLEMLLNGAIKVDEYMRTSNKDVMAAGDCCSVFYNPLQKERYIPLATNAVRMGTLAGINLLENKVKHL
    GTQGTSGIKIYENNMAATGLTEESAKEEGIEVESVIAVDNYRPEFMPTYEKVTLKVVFEKNSRRILGAQLTSKIDLTQSI
    NTLSVCIQNKMTVEELAFVDFFFQPHYNKPWNFLNLAGLNSLK

    >gi|257126150|ref|YP_003164264.1| Redoxin domain protein [Leptotrichia buccalis DSM 1135]
    MKKILLLGIAAVVLAACGNKPKTQNEIGQAGQNAEYTQYLDTLKADNNLKITMGKVPITIVGKELKVGDKIKEVPLVINT
    KLEEKNIFEDKNIKVIYTAPSLDTKV
    CSLQTKQLNEAAKTHTNVKFYSVTVDTPFAQERFCTANEINGLKAVSDFKYHQF
    GIQNGFFIKEKGLLTRALMIVDENNNVKYIEYVSEEGKEADVDKALKFLENKLLRK

    >gi|257126172|ref|YP_003164286.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Leptotrichia buccalis DSM 1135]
    MKKYDAVIIGFGKGGKTLAGFLAGKGQNVALIEKSDKMYGGTCINIGCIPTKKLVDSTKVLKNKGLSGIEEKERFYTESI
    NNKNTLIGALRGKNYEMLATKENIDIYDGFGSFASKNVVNIESNGENVQIEGEKIFINTGSTTIIPGIKGLKESNHVYTS
    TSIMELKELPKKLTILGAGYIGLEFASMYADFGSKVTVIDLAQRLMPREDEEIADRAKAIFEAKGIKFLLESKIEEIIDK
    NGKGYVQISQGASKSEIESDAILVAIGRKPNTEGLNLEAAGVKTDEKGAVVVDETLKTTADNIWAMGDVKGGLQFTYISL
    DDFRIIRDNLYNGGNRTVNDRNVIPYSVFINPPLSRVGMTESEAIAKGYEVKTGRLEAMAIPKAKIEGVTDGLLKAVIDA
    KTDKILGCTLLCNTSHEMINIVAAAMKAEQKYTFLKDMIFTHPTMSEALNDLFGSVK

    >gi|257126270|ref|YP_003164384.1| methylated-DNA/protein-cysteinemethyltransferase [Leptotrichia buccalis DSM 1135]
    MKKNIYFYETNTPIGKIGLATTENDSHITDIIWNYEIEKFKNDDNFQINETELIKRAKKQLFEYFSKKRKQFDLPLLKEG
    TPFQISVWNALETIPYGETRSYKDIAVAIKNEKAVRAVGMANNRNKISIFIP
    CHRVIGVDGKLVGYGGGLHIKQFLLELE
    GIKIK

    >gi|257126289|ref|YP_003164403.1| arsenate reductase and related [Leptotrichia buccalis DSM 1135]
    MNKIYCYPRCTTCKKAVKWLEENGIDYEYKHIVEETPSKEDIKKYYKESGLPLKRFFNTSGNVYKELNLKEKLAEMSEDE
    QFELLASNGMVLKRPLLVGKDFVLVGFKEAEWVEKLK

    >gi|257126408|ref|YP_003164522.1| Rhodanese domain protein [Leptotrichia buccalis DSM 1135]
    MKIRKIVLLIIIGIFSVFGFSCSKTGNEKQDLVMSKEAKNGKKVEYKKITSDEAKKMMETQKAIVVDVRTLEEYNEGHIP
    NAISVPLETIENEAEAKLKNKDDLILVY
    CRSGRRSREAALKLIEKGYTNVIDFGGIQDWNGEIVK

    >gi|257126621|ref|YP_003164735.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Leptotrichia buccalis DSM 1135]
    MRKLLIIVSMFMTFLIGYGKPLQINVEKGAKIPNFELKDFNRVSTKSRKIFNNGKPTLLVFAAEWCPHCRTELPEVQKFY
    EENKDRVNVVVIFTSKKTTLANTKKYVTENNFTFPVYYDMERTIMNAFKVKGVPYNLKIQNSKIEGIHEGIIEYSQLVEL
    FNDYDSSIILN

    >gi|257126653|ref|YP_003164767.1| hypothetical protein Lebu_1911 [Leptotrichia buccalis DSM 1135]
    MKKLENYEQILNKIKEEEYFLLYVSMNNCSVCQVDMPKVEKIVNEQNFPAYHIEASEIPEAVGQLNLFSVPVVILFYEGK
    EIHRQAKIIDFEELNYRIEQISENK

    >gi|257126681|ref|YP_003164795.1| Thioredoxin domain protein [Leptotrichia buccalis DSM 1135]
    MSSVINYSGEDFENETVSQTGLTLVDFYAIWCGPCQMLEKVLVEVSKNSNCKIVRIDVDDYPKFGSKFKIRGLPTLILFK
    EGKIVETLNGFKTFDEIMEKINLHN

    >gi|257126692|ref|YP_003164806.1| transcriptional regulator, ArsR family [Leptotrichia buccalis DSM 1135]
    MDKICQNYKNSLYSGLSKIGKCLSSEKRIEILDLLVQGAKTVESISNETGMSIANTSRHLQILKDGNLVISEKKGNYVVY
    EIANTQIIDLVYLLIGVGEQQLADIQRIHNEFNDSCMKIRPITLEQAYEMVKNKETLIIDLRPEDEFNSSHIENAINIPM
    KNLEENLKKLPKNKEIIVY
    CRGRNCAYANLASKFLNDNGFHAYSLNQSYYDWQKYGNI

    >gi|257126693|ref|YP_003164807.1| thioredoxin [Leptotrichia buccalis DSM 1135]
    MALNLNKDNFEQSISNGVALVDFWAEWCGPCKMQLPIIEEFSSEMDGKATVGKVNVDEQLELAQSFGIQSIPTLILFKDG
    KPVKKLVGLHSKESLYEEVNQVL

    >gi|257126694|ref|YP_003164808.1| thioredoxin reductase [Leptotrichia buccalis DSM 1135]
    MYDSVIIGSGPAGLTAAIYLSRAGLKNIIINGMEPGGQLTTTTEVENFPGFPQGISGPQLIEDIKAQSKNFGTEFLQAVV
    KDIESIENNGKKIFKLHLDNGNIIEAKTIILSTGASAKYLGIENEKENIGRGVSA
    CATCDGFFYRGKDVVVIGGGDTAME
    EAVFLTKFANKVTVIHRRDTLRASAIMQKRAKDNSKIEWKLDYTPKKVLADEKVTGIELINNKTGETETLTADGIFVAIG
    RTPNTKFLEGKVEIDERGYIVTKGKSSKTSTSGIFAAGDVQDGRYQQAIIAAGSGAIAGLDVEEYLRENNL

    >gi|257126806|ref|YP_003164920.1| Heavy metal transport/detoxification protein [Leptotrichia buccalis DSM 1135]
    MLKKLIEIEGMNCNNCIKKVEDALYGLPEVENVEVNLADKNAKVTLNEEVDDLLIADVVNAAGHYKVKDVTEIS

    >gi|257126858|ref|YP_003164972.1| peptide methionine sulfoxide reductase [Leptotrichia buccalis DSM 1135]
    MENIKEIYLAGGCFWGVEKFFKMAPGVIETTVGYANGQTLDTNYQILKMTDHAETVHIKYDSSVISLDKLLTYYFSIIDP
    TSVDRQGLDVGRQYRTGIYYVDESDLNIIKLKVENEQTKYSKDIQVEIKPLKHYILAEDYHQDYLGKNPTGYCHIDLDSA
    KKIFYTK

    >gi|257126935|ref|YP_003165049.1| hypothetical protein Lebu_2206 [Leptotrichia buccalis DSM 1135]
    MFWRNGFKAGAVTNKIFGLVIIILGVFFVSQINYSAGNNQAKKVKIEYFGRKDCKNCVNLEKFLKELSTKRDDFEYVEHK
    IDESKENKAFFDETTSKLKLVKGTPIIYIDGHIIQGFNTAETTGKEIENLINSGKTKDKVLSLKEYLKSGQAENGNVSSN
    GAVCTGDSVCEIPGLTKGAENQVLVNIPIINKTIDLTNYSLLTMSIILGTIDGFNPCAMWVLVLFLTALIAVGNKVKMFR
    VAGLFIFAEAIMYFLILNAWIYTWDFVGLDKWVTPIVGIVGIIGGIFFIKNYLKKGDTLECEVTNLEQRAKISRKIKDIA
    NKPFTLLTALGIIGLALSVNVIEFACSVGIPQTYTKILQINDVSFWARQFYTIIYIIGYMIDDIIVFGLALLSVNQLQLT
    TKYSKWVNLFGGILMIILGLILLLKPSLLIM