Leptothrix cholodnii SP 6 uid58971

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|171056739|ref|YP_001789088.1| electron transport protein SCO1/SenC [Leptothrix cholodnii SP-6]
    MRRRALYRPLALGAWLAACGLFGPLRTLAHGSTGAPAHDDADERLPQLGPATPFSLIDQSGQRLALAELRGKVVVLTFIF
    TT
    CTDTCPILTARLAALQAPLGAAFGPRLRFVSISVEPEVDTPEVLHAYARTHGADLRGWSFLTGRAGAVQAAVRGYGSY
    ARRRGTGEIDHLTLTSLIDRRGRLRVQYLGTRFRDDEMLRDLHALLAE

    >gi|171056752|ref|YP_001789101.1| thioredoxin-related protein-like protein [Leptothrix cholodnii SP-6]
    MKHLPIRLLCGLLCLAATLLGAPARAADAKPADAAHAVPLAIDIPPWFTEGFLDFKEELASAGQAGKQLMVYVGQDGCPY
    CRELMQTNFSQKPIADKTRVHFVAIALNLWGDRELSWTDGRTLSEKALARELKVQFTPTLLFLDARGQVRLRLNGYQPPQ
    RFSAVLDYLIGGHDQRETLAQFLARSPAAPARPQLTDEAFFMPAPLDLRRRTGARPLAVLFETRH
    CRACDEMHDQGFKRP
    EVRTQLARFDVARLALSDGAEIVTPADRRQRADAWARELGVSFTPTLVFFDAGGAEVFRLDGYTRPFHLASAFEYVADGG
    YRREPEFQRYLRDKADRLRARGQPVELWK

    >gi|171056779|ref|YP_001789128.1| rhodanese domain-containing protein [Leptothrix cholodnii SP-6]
    MRLSLIATTLCAAALHLAPLPALAEDKAVIDAMEGYLDFVDYGGATIFPEQIPKDDWKSFFVIDARDKEQFAKEHIPGAV
    NIEWRRALAERGRIPKDKPVLLY
    CNTGTLSAQAGFALRVAGYENVRILQGGYAEWKAKGGFDAAARATGAVKH

    >gi|171056869|ref|YP_001789218.1| nitrite reductase (NAD(P)H), large subunit [Leptothrix cholodnii SP-6]
    MKILVIGHGMVGHKFLESLDASGLRDARVTVLCEEPRPAYDRVHLSEFFSGKAAEDLSLVAPGFFERDNVLLRLNTRAVA
    IDRAGKTVTTAAGEVLAYDKLVIATGSYPFVPPLPGKDRTDCFVYRTIEDLEGMLE
    CGSRSKSGVVIGGGLLGLECAKAL
    RDMKLQTHVVEFSPHLMALQVDEAGGRTLRAKIEKLGVGVHTQKNTVEIVDGETARHRMVFADGSQLETDMIVFSAGIRP
    RDEIARQCGLEVGPRGGIVIDNRCRTSDADIYAIGECALWNGQIFGLVAPGYEMARVAARQLAGEAAAEFGGADMSTKLK
    LMGVDVASIGDAMGKTPGSRAYQFNDERKQVYKKLVVSECGKHLLGAVLVGDAAEYGTLLQMALNRIELPEAPEFLILPS
    SDGQARPALGVDALPDSAQICSCNNVSKGQLCAAVAGGASTIGELKACTQAGTACGGCVPLVTQVMKAEMKKQGLAVNNH
    LCEHFAYSRQELFHIIKVEGIRSFDELLRRHGKGLGCDVCKPVAASILASVWNDFILKKELAGLQDSNDYFLGNIQKDGT
    YSVVPRMAGGEVTPDGLIAVGQVAKKYGLYTKITGGQRVDLFGARVDQLPSIWEELIAAGFESGHAYGKSLRTVKSCVGS
    TWCRYGVADSVGLAIELENRYKGLRAPHKIKFGVSGCTRECAEAQGKDVGVIATEKGWNLYVCGNGGMKPRHAELLASDL
    SKQELIRYIDRFLMFYIRTADRLQRTSVWRDNLEGGLDYLKQVVLHDKLGLAAELEADMQNVVDTYVCEWKNAVTHPETR
    KRFRQFVNSDRTDPNVIFIQERGQIRPATPDEREARAADAELTA

    >gi|171056949|ref|YP_001789298.1| peroxiredoxin [Leptothrix cholodnii SP-6]
    MSLINTTVQPFKAQAFLNGKFIEVTEASLKGKWSTLIFMPAAFTFNCPTEVEDAAANYAEFQKLETEVYIITTDTHFAHK
    VWHETSPAVGKAQFPLVGDPTHQLTRAFGVHIEEEGLALRGTFIINPEGQIKTAEVHSNEIARDVSETLRKLKAAQYTAK
    NPGQVCPAKWNDGAATITPSLDLVGKI

    >gi|171056950|ref|YP_001789299.1| alkyl hydroperoxide reductase, F subunit [Leptothrix cholodnii SP-6]
    MLDQALKTQLKSYLERLQRPIELVASLDDSAKSAELRGLLQDIAGLSPQVSLVERDDGQRTPSFTIGAAGADEAARIRFA
    GIPLGHEFTSLVLALLQTGGHPPKVEAGVIEQIRGLDADLSFEVYMSLT
    CHNCPDVVQALNLMAVLNPGVKVTTIDGALF
    QDEIAQRQIMAVPTVFLNGQEFGAGRMTVEDILAKVDTGAAARDAARLAKQAAYDMLIVGGGPAGAAAAVYAARKGIRTG
    VVAERFGGQTLDTMAIENFISVKETDGPKFAVALEQHVKQYDVDIMNAQRAVKLTPATEPGGLAELELANGAVLKARSVI
    LSTGARWRNVNVPGEAEYKNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVKHVTLIEFADALRADAVLVAK
    LKSLPNVAIHTSAQTTEIHGDGQKVNGLSYTDRVSGAGHRIDLEGVFVQIGLVPNTEWLKGTIELSRHGEIIIDARGQTN
    VPGIYAAGDVTTVPFKQIVIAVGEGAKAALGAFDHLMRTPVVAAETA

    >gi|171056952|ref|YP_001789301.1| DSBA oxidoreductase [Leptothrix cholodnii SP-6]
    MKIDVVSDVVCPWCAVGVSSLLRALDTLGDELRPTLHFQPFELNPTLGPGGQDIVEYLGRKYGSTPEQIERTHEQIAQRG
    AAVGFTFNMDLRTRTYNSFDAHRLLHWAGLEGEDFQLLLKLALLRSYFTEGLDPGEPALLVSLAAEAGLDAARALDILAS
    DEYADEVREREAFYQSQGIASVPSFIINDRHLIAGGQPPEFFVQALRQIAEEG

    >gi|171056958|ref|YP_001789307.1| putative thiol:disulfide interchange protein [Leptothrix cholodnii SP-6]
    MLLRLIAIACSLWAGAALADEADIRKTLTERFQGLPKIDEIRPTPIPGVFEVRIGTDLMYSDAKGTYLLQGSLIETATRR
    NLTEERVDKLTAIDFNSLPLKDAVVWKNGKGTRKIAVFADPN
    CGYCKKLERDLLNVKDVTVYTFVIPILGGDSPEKSKSI
    WCAKDSTATWRNWMVDGTLPPKAMGNCDASAIERNSALARKHRVTGTPAIVFEDGSRAPGAIPAAEIERRMAAKS

    >gi|171057055|ref|YP_001789404.1| thioredoxin domain-containing protein [Leptothrix cholodnii SP-6]
    MIDITLQNFESELIHGSQQQPVLLDIWAPWCGPCKQLGPVLEKLEAAYEGRFVLAKLNSDEVPEISSQLSQMFGVRSIPF
    CVMFSQGQPVDGFVGAIPEDKIREFLDKHVPSLESLEAEADLEEAAELAEDNPDAALAKLQEAVAIDPANDAARYDYIKL
    LLQMNRLAEARRAYQPVASKALHDTRLAALGAWLDAGEAAQQARPAAELDAAIAANKRDFAARFERAQVLFAQQDLTAAM
    DELLEILMRDKAWSEGLARKTYVAILELMTKPAPKPAAAEAKGALELTGKTAVAPADPLLDQYRRKLSMVLF

    >gi|171057152|ref|YP_001789501.1| glutathione peroxidase [Leptothrix cholodnii SP-6]
    MDNPFRRRALLGLAAWPLVLASGQASGASTACPALLDRSIPRLQDEQAQALCQYSGKVLLIVNTASACGYTSQYEGLQKL
    HEQYRERGLVVMGFPSNDFAGQESGDNRQIAEFCENQFAVRFPMFVKGAVRGPQAQPLYADLKRLSGQAPGWNFHKYLVG
    RDGRSVRSYASAVGPDDRRLRLDIETFLNAR

    >gi|171057268|ref|YP_001789617.1| glutaredoxin-like protein [Leptothrix cholodnii SP-6]
    MTTAQTRIDELVKSHPVVLFMKGTAQFPMCGFSGRAIQILKACGVSDLTTVNVLEDDGIRQGIKEYANWPTIPQLYVKGE
    FVGGSDIMMEMYQAGELQELLKA

    >gi|171057443|ref|YP_001789792.1| thioredoxin reductase [Leptothrix cholodnii SP-6]
    MSSTHQHAQVLILGSGPAGYTAAIYAARANLQPMLVTGMAQGGQLMTTTEVDNWPADVAGVQGPELMQRFQKHAERFNTK
    MVFDHINEVDLVQRPFRLKGDSGTYSCDALVIATGASAKYLGLPSEEAFMGRGVSG
    CATCDGFFYRGDVVCVVGGGNTAV
    EEALYLSNIASKVHLIHRRDKFRAEAILIDKLNEKVAAGKMELHLFQTLDEVLGDSTGVTGVRLKSTTDDSTTELAVKGC
    FIAIGHQPNTDIFKGQLEMKDGYIVTRTGLNGFATMTSVPGVFAAGDVQDHVYRQAITSAGTGCMAALDAQRFLEQGGAA
    G

    >gi|171057621|ref|YP_001789970.1| glutathione S-transferase domain-containing protein [Leptothrix cholodnii SP-6]
    MMVLYSGTTCPYSHRCRFVLFEKGMDFEIRDVDLYAKPEDIALMNPYNEVPILVERELILYESHIINEYIDERFPHPQLM
    PGDPVARARVRLFLFNFEKELFTHVNLLEGRGGVKGNDKQLEKARSQIRDRLTQLAPIFQKNRYMLGDDFSMLDVAIAPL
    LWRLDYYGIDLSKNAAPLLKYAERIFSRPAYIEALTPSEKVMRK

    >gi|171057668|ref|YP_001790017.1| rhodanese domain-containing protein [Leptothrix cholodnii SP-6]
    MKPPILNLSSYKFVTLADAATLRAQIQGQANACRLKGTVLLAEEGINLFVAGPEAGARAFIDYLRFDPRLADLAPKESWS
    EAVPFKRMNVKLKREIIRMNEPAIRPEAGRAPSVAPQVLARWLAQGHDDAGRPVVTLDTRNAFEVDHGTFEGAIDWRIGK
    FSEFPAAVQAHRAQLEGKTVVSF
    CTGGIRCEKAGIYLQAQGLDNVYQLEGGILKYFELTDGAPGWRGSCFVFDEREALGA
    QLVPTRT

    >gi|171057730|ref|YP_001790079.1| iron-sulfur cluster assembly protein IscA [Leptothrix cholodnii SP-6]
    MTTMAVTLTEAAAKHVSRYIARRGKGVGVRLGVKTTGCSGLAYKLEYADEITPDDHVFEGHGVKVLVDPKSLPYIDGTEL
    DFVREGLNEGFKFHNPREKDRCGCGESFRV

    >gi|171057793|ref|YP_001790142.1| methylated-DNA--protein-cysteine methyltransferase [Leptothrix cholodnii SP-6]
    MKQPPIRWAAYASPLGAMTLAATPAGLCGVWFDGQQHFDGPAADWQHDAADATLIETATQLDDWFAGRRQAFDLPLDPHG
    TEFQRAVWSALVQIGFGQSLAYGDVAAALGRPTATRAVGAATGRNPISIVVP
    CHRLIGRSGALTGYAGGLARKVALLAFE
    AGEPGLWRDAP

    >gi|171057938|ref|YP_001790287.1| rhodanese domain-containing protein [Leptothrix cholodnii SP-6]
    MRTDSPIVEPSSLRRVSRRRLAWLVLATAALGVAGCGEAGASADAVSLDFARAEHESGRAVLIDIREPDEHATGVAAGAR
    LLPMRQLGRRLAEIPADPAQPVLLI
    CNTQNRSSATLRALRERGYGHVRYVQGGMSEWARRGWPMVRPAGRSGD

    >gi|171058008|ref|YP_001790357.1| redox-active disulfide protein 2 [Leptothrix cholodnii SP-6]
    MLTVKILGSGCANCRKLEAVAREAASAAGVAAEFVKVTDMKAIMAYDLLSTPGLVIDDKLVSSGRIPTQAEVRQWLTA

    >gi|171058046|ref|YP_001790395.1| iron-sulfur cluster assembly accessory protein [Leptothrix cholodnii SP-6]
    MSACQSQPNAASSCSTGGLPPSAPFVLPEGATPLRISDAVISKVGAMIAEEGDPNLKLRIFVTGGGCSGFQYGFAFDEEA
    KADDTCVAAGGINVLVDASSMQYVMGAEIDYEDSLEGSRFVIRNPNAASTCGCGSSFSV

    >gi|171058047|ref|YP_001790396.1| iron-sulfur cluster assembly accessory protein [Leptothrix cholodnii SP-6]
    MTVTVTPKAARQIRKALDQRGSGYGLRVAVKTSGCSGYAYALEFADAPAPEDLSFESEGVFVLVDAKSLPMVDGTQLDWV
    RDGLNEGFQFNNPNASATCGCGESFTV

    >gi|171058090|ref|YP_001790439.1| iron-sulfur cluster assembly accessory protein [Leptothrix cholodnii SP-6]
    MILPTLTVTAAAQKFISRMVRFSEHPTGGFRLTVSAGGCSGYNAEFTVEPAAQAGDGELLVNGVKVFLPAESRLMLDGVT
    IDFADTPTRSGLTFINPNAAACGCSTSGDAAAPPAQATVSVSSITRMSSASAGH

    >gi|171058108|ref|YP_001790457.1| hypothetical protein Lcho_1424 [Leptothrix cholodnii SP-6]
    MPNRLADPSSAYLRQHARDPVDWYPWGEEALAKARAEDKPILLSIGYAACHWCHVMARESFADPATAALMNEGFVSILVD
    REQRPDLDQIYQQAHSLLRRSGGGWPLNVFLSPQGVPFYSGTYFPAEANEGQQSLRDVLGSVGKVWRERRADLARQDAAL
    LDALAETLPRADPRAVLDARVRDQACEQLGSAFDAENGGFGTVPKFAHPTDLAFLLRRGRDEDDPAALHMALDTLAKMAE
    GGICDQIGGGFFRYSVDARWRVPHFEKMLCDNALLLALYADAFALTGESLFRRMVDETAGWALREMQAADGGFHASLAAD
    DAQGREGRVYVWESEPLRLALSPDEWDVCAAHWGLVDAPDFEGRYWQLHVARPAADLALLLHRPEEMVEELIASARTKLL
    AARDQREHPARNEQQLTAWNALMITGLARAAAVCERADWIAAARRALALIRSERWVDGRLLAMPGQHGFLDDHAFMLEAV
    LALHAADPQADDLPFAVAIAEALLTQFEDPADGGFFFTPHDAPALIHRPKPGLDTATPSGNGTAALALQALGRQVNDPRY
    FAAASRCVRVFAAQVQNEPASHTRLLQAAALND

    >gi|171058234|ref|YP_001790583.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Leptothrix cholodnii SP-6]
    MKSLKFLVPLALFLVLAGFLLVGLNRDPREVPSPLIGKPAPEFALPRLDDGAQTIQRADLLGQVWMLNVWASWCVACRQE
    HPLLVEYAKQKRLPIYGLNYKDERADGQQWLAQFGNPYTASLYDRAGRVGIDFGVYGVPETFIIDREGVVRMKHIGPLTP
    EVIRERIEPLLRQLNA

    >gi|171058331|ref|YP_001790680.1| dihydrolipoamide dehydrogenase [Leptothrix cholodnii SP-6]
    MALIEVQVPDIGDFKDVAIIELLVKPGDTVKAEQSLITVESDKASMEIPSSHAGVIKELRVKLGDKINQGDVLLTLEAAG
    AAAPAAAPAPAPAAAAPVAAPAPVAVAAGPAGSYSGAADVECDLLVLGAGPGGYSAAFRAADLGLKVVIVERYATLGGV
    C
    LNVGCIPSKALLHVAAVMDEVSHLGDLGVDFGAPSVNVDKLRGHKEKVIGKLTGGLAAMAKMRKVTTVRGVGTFLDPYHV
    QVEETAGTGTERAGASKVVKFKHAIIAAGSQSVKLPFFPADDRIVDSTGALALQGVPKKMLIVGGGIIGLEMGTVYSTLG
    ARLDVVEMLDGLMQGADRDLVKIWQKMNAHRFDNIMLKTKTVGAVATPEGIKVQFEGLDGTKTEGLYDLVLQAVGRSPNG
    KKIGADKAGVAVTDRGFINVDIQMRTNVPHIFAIGDIVGQPMLAHKAVHEAHVAAEVIAGTLQGNQELASAAFNARVIPS
    VAYTDPEVAWVGLTEDQAKAQGIKVKKGLFPWTASGRAIANGRDEGVTKLLFDDSPEAHGHGKILGGGMVGTHAGDMIGE
    IALAIEMGADAVDIGKTIHPHPTLGESIGMAAEVAHGSCTDLPPTRK

    >gi|171058333|ref|YP_001790682.1| hypothetical protein Lcho_1650 [Leptothrix cholodnii SP-6]
    MAANPVRPTAPKRRFGGLVGLLLIGGAGAAVAQYKVVAPDGSVTYTDRVPAAASSRTQPLRAGAGGADGAAELPFVLRQV
    MARYPVTLYTAPA
    CAPCDTARQLLRQRGVPLVERSVPTPDDVGELRRIEQTTDLPILRLGSQRLVGYSADEWTAMLDAAG
    YPRQSMLPGSYRQPAARPLIAPRTAQPAAIEAPRPANAPEPTAAGAGGIRF

    >gi|171058392|ref|YP_001790741.1| SNARE associated Golgi protein [Leptothrix cholodnii SP-6]
    MAAAPRRAVWIGLAAFALLTVVLYRQFDVGQWLTLDALKASRDALIARYEARPIATLAAYFVIYVVATALSLPGAVILTL
    AGGALFGLGIGLVVVSFASSLGALLAFLAARYLLRDRLQARFGAQLAPINEGIRRDGTFYLLTLRLVPVFPFVVINLLAG
    LAPISAARFYVVSQIGMLVGTAVYVNAGTQLAGIQTPADVLSPALLGSFVLLGVFPLIAKFVADALRRRKVYAKWPRPRS
    FDRNLVVIGAGAGGLVTAYIAAAVKAKVTLVEGHKMGGD
    CLNYGCVPSKALIRSAKAMHQIRRAEALGVRGAAGEVDFAA
    VMARIRRVVRDIEPHDSVERYTALGVDVVQGQARITSPWSVEISTPTGVQTLTTRSIVIATGARPFVPTIPGLAEVGFLT
    SDTLWGLTELPRRLLVLGGGPIGCELAQSFARLGSAVTQVEMAPQVMGREDAEVSALVAQALRADGVELLTGHQAIRCEQ
    DGGVKRLIVRHGDAERAIEFDTLLCAVGRSPRVEGFGLEELGIALTARKTVETDAYLQTLYPNIYAVGDVAGPYQFTHTA
    SHQAWYAAVNALFGRFKRFKADYSVIPWATFTDPEVARVGLSEAEARERGIAVEVTRYGIDDLDRAIADGSAHGFVKVLT
    VPGKDRILGATIVGEHAADLLAEFVLAMKHGLGLNKILGTIHTYPTLAEANKYAAGNWKRAHAPQRLLAWVERFHAWERT


    >gi|171058410|ref|YP_001790759.1| selenide, water dikinase [Leptothrix cholodnii SP-6]
    MNAPDQPVEPRLTSLSHGGGCGCKIAPGVLSEILKGTAAMPIPPQLLVGIETADDAAVYQLNDEQAIIATTDFFMPIVDD
    PFDFGRIAATNAISDVYAMGGKPILALALVGMPINVLSTQTIGRVLEGGASVCRAAGIPIAGGHTIDSVEAIYGLVALGL
    VHPKHVKRNADARPGDVLVLGKPIGVGVMSAALKKEQLGAEGYAQMIAVTTKLNTPGPDLAALPGVHALTDVTGFGLAGH
    ALELARGAGCQVQIDWSAVPLLDGVRALAEQGFITGASGRNWAGYGADIALPADFADVDRALFTDPQTSGGLLVSCDPAS
    LDEVLAVFRAHGFEAAACIGRIVDSAAGEARLVVR

    >gi|171058501|ref|YP_001790850.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Leptothrix cholodnii SP-6]
    MKHVILGAGPAGVIAAETIRKHAPNDEIIVIGDEPEAPYSRMAIPYLLIGKVGEEGTHLRHGENHYEKLGITLKRGRASK
    VDTQARQVLLEDGSAESFDKLLIATGSSPATPPIPGIQGPGVHP
    CWTLEDARAIAALAQPGARVLQLGAGFIGCIIMEAL
    AMRGVQLSVVEMGDRMVPRMMGPTAGGMIKDWCVAKGVSVHTGARVEAIDRPDASAAAGCAPMSVRLSTGERLDADLVIS
    ATGVRPNIGFLENSGIICLVGVLTDEHLQTNVPGIYAAGDCAEAFDKVSGTTIVSAIQPNAAEQARVAALNMVGKTIELK
    GVTQINVLDTLGMISASFGKWDGVPGGQHVELTDREAGRHLSLQFSGDQLVGCNSIGWTNHVGVMRGLVEGQVRLGEWKD
    KLLEDPTLLMAAYLASAQAQHEHAHV

    >gi|171058518|ref|YP_001790867.1| heavy metal translocating P-type ATPase [Leptothrix cholodnii SP-6]
    MNANIATRAVDPQAIELQVLGMTCASCVSRVEKTLRAVAGVRQASVNLATETATVSGDPGLDTQALAAAVRKAGYDVGTR
    SFKLQIEGMT
    CASCSGRVEKALRKVPGVTSAVVNLATEQASVEGLSGLSAAVLKAAVERAGYAVRDASALAEPAAASRLP
    AWWPVAAGAALTLPLVAPMLLALLGIDAMLPGWLQLLLATPVQFWLGARFYKAGAKALLARSGNMDLLVALGTSAAYGLS
    VYLLLRHADHGMPHLYFEASAAVITLVLLGKWLETRAKRQTTDAIRSLQALRPVTARVLRAGVEIETPIDQVVVGDAVRV
    RPGERVPVDAEVIDGSSQLDESLITGESLPVAKGIGERVTGGSINGEGALTVRTLAVGAETTLARIIRLVESAQAGKAPI
    QRLVDQVSAVFVPVVLGIALLTWVGWVLATGDWEGALVNAVAVLVIACPCALGLATPTAIMVGTGAAARHGILIKDAQAL
    ELAHAVQVVAFDKTGTLTEGRPTLVDALPAGDLGRAGLLRLAAGMQRASEHPLARAVTQAAEAERVEPADVSDVKALPGR
    GLQARLGEDTLLLGSSRLLAEQGLQPGALADAAIHLEAQGRTLSWLIRSVAGQPELLGLLAFGDVVKPAAQAAVSRLRQL
    GVTCVMLTGDNLGSAQAVGQQLGIDEVRAQVLPADKAKAVEALKVGGRRVAMVGDGINDAPALAAADVGIAMATGTDVAM
    ETAGITLMRGDPRLVSDAIDISRRTWRKIRQNLFWAFAYNVVGIPLAAMGLLNPVIAGAAMALSSVSVVGNALLLRRWRP
    ARRA

    >gi|171058524|ref|YP_001790873.1| methionine-R-sulfoxide reductase [Leptothrix cholodnii SP-6]
    MKAHDTPQAGAYAVEKSDAEWRARLEPDQYAVTRHAATERAFTGKYWNHWADGSYRCVCCDALLFDAGTKFDAGCGWPSF
    SEAVEAGRVERITDRSHGMVRVEVRCQQCGAHLGHVFDDGPAPTGERF
    CINSAAIDFTPRG

    >gi|171058525|ref|YP_001790874.1| hypothetical protein Lcho_1842 [Leptothrix cholodnii SP-6]
    MSALPLPPPTGFDPAQLRWINRYAELGPAFGRRQGGLALPDARWVAVSEGAAAELGWAGDWWLHPQALAAHSAGPSWPGS
    TPMATVYSGHQFGSWAGQLGDGRALLLGEIDTPSGPREIQLKGSGLTPYSRMGDGRAVLRSSIREFLCSEAMAGLGIPTT
    RALAITASPLQVRREGPETTSVVTRTAPSFIRFGHFEHFCHHGQPAALRQLFDFVLEHHYPECRDAPHPAAALLESVSRR
    TAELMAQWQAVGFCHGVMNTDNMSILGLTIDYGPFGFLDGFDPGHICNHSDHQGRYAYARQPQVAYWNLHALAQALVPLV
    EGSDEEISEILGAALEPYRELFPHQMDALMGAKLGLQSRRDEDRALLDDLLGLMSATQVDYTLCWRQLADFSSADDGGTG
    PVRDLFLNRPAFDAWAARYRSRLQAEGSVDAERRARMNHVNPRYVLRNHLAELAIRRSQAGDDSEVQRLARVLERPFDEQ
    PEHAAYAALPPDWAQTLEIS
    CSS

    >gi|171058624|ref|YP_001790973.1| protein of unknown function DUF395 YeeE/YedE [Leptothrix cholodnii SP-6]
    MQASEASNLTAQVLWAVFLLALLYGAIAERSHFCTMGAVADVVNFGDWRRLHMWALAAGVVTIGFNLMVAAGWVSADKTL
    YGGSRWQWASALVGGALFGFGMVLASG
    CGSKNLVRLGGGNLKALVVLLVMGLSAWMTLRGLTAMWRVETVDRWAVSLPGS
    QDLPSLIAAGYGGSTPDVALVVGTVVGTALLAWALWARPGRDAGLLLGGIGIGAVVLAVWWVSGRFGHLAEHPETLEEAF
    LGTASRRMEALSFVTPVAQGLEWLIFYSDQGRRLSTGVVAVCGLVAGSWLVNIRQKSFRWEGFGDSADTARHLIGATMMG
    IGGVTAMGCTIGQGLSGLSTLGLTSLVAVAAIIAGAVAGLRFLNWQLERAA

    >gi|171058628|ref|YP_001790977.1| uncharacterized peroxidase-related enzyme [Leptothrix cholodnii SP-6]
    MNTPARPPISRYPVPDLAELPADLRERILAVQEKAGFVPNVFLSLAHRPDECRAFLDYHDALMLRPSGLGKGEKEMIVVA
    TSGANRCLY
    CVVAHGAILRIYEKAPLLADAVAINHHKADLSARQHAMLDFALKVCTDSAAVDEADFAALRAHGFSEEDIW
    DIGAITAFFGLSNRMANLIGMRPNDEFYLMGRVPRR

    >gi|171058693|ref|YP_001791042.1| protein-disulfide reductase [Leptothrix cholodnii SP-6]
    MIVSTYPALRTRCLSRLARVRQDLLVPLLLMLSVLLGGWPAAAAAADEFLEPDQAFKLSARSPDGASIELRYEVAPGYYL
    YRERFAVEAAPTGVKLGEVLYPPGKIKFDETFQKDVESYRDTLLVSVPVLAGPAQFKLAVTSQGCADAGLCYPPRQQVLK
    VQIDGGAVRQVELMAEEAGLAWQPAPSELLTITAQRVATRPAAASPDSATAALQSGSLWTIAGVFLLAGVLLSFTPCVLP
    MVPILSSIIVGQGGPVSRWRGLGLSVSYSLGMALVYTLFGVAAGLAGEGLAAALQNPWVLGAFALLLVGLSLSMFGYYEL
    ALPHALQSRLAQVSSGFQGGQHLGVFAMGGISALIVGPCVAAPLAGALVYISQTRDVLLGAVALFAMACGMSLPLLLVGV
    SAGSLLPHSGAWMESVKRFFGVLLIAVALWMVTPVLPVWLMMAAWGSLMLVSASYLGLLEPLAPTARRSAHLGKGLALVL
    AIGGAAQWLGMLSGGRSLLQPLSHLVSSVSTDARGAVLADGSGRSSPTQAGEVHFQRVKSVAELDALLLTAGKPVMLDFY
    ADW
    CVSCKEFEQFTFRDPQVQAKLAGAVLVQADVTANDADDRALLKRFQLFGPPGIIFFDPQGREQAGARVIGYQNAEQF
    LRSLQTAGL

    >gi|171058694|ref|YP_001791043.1| redoxin domain-containing protein [Leptothrix cholodnii SP-6]
    MFVSCLESTLRLGRAALCAAGLATAVAAHAVDVGQPAPAVKLAGVQGTVDLAALRGQVVYLDFWASWCGPCRVSFPWMNQ
    MQARYGARGLQVVGVSVDAKREDADKFLAQLPANFLIAFDPAGDTPKRYAIKGMPTAVLIGADGQVLHRHSGFRENDQQG
    LEAAIVAALKQAGR

    >gi|171058711|ref|YP_001791060.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Leptothrix cholodnii SP-6]
    MTPALNKSLPDLEANATGGIKFTPQAFLGKTVVLYFYPKDNTPGCTTEAMQFRDHHKEFTNAGAVVFGVSRDNMASHDKF
    KQNLELPFELIADTEEKLCHMFGVVKNKIMYGKKVKGIERSTFLIDTEGVLRAEWRGLKVAGHVEEVLKAVQELKSPA

    >gi|171058763|ref|YP_001791112.1| OsmC family protein [Leptothrix cholodnii SP-6]
    MALPTVLYTAHATSTGGRAGTSVSSDERLRVTLSVPKGLGGDDGPGTNPEQLFAAGYSACFLGALKFVAGQKKIAIPAET
    TITADISIGPIPTGFGIQAALTIHVPGVDRATVEELVQAAHIV
    CPYSNATRGNIDVALTVA

    >gi|171058783|ref|YP_001791132.1| UBA/THIF-type NAD/FAD binding protein [Leptothrix cholodnii SP-6]
    MNDDQLLRYSRHILLDDIGVEGQQGILDGHALVIGAGGLGSPALLYLASAGVGTITVVDHDTVDRTNLQRQIAHQESRVG
    WSKVNSAALSMAAINPEVKVVALQRRADTQWLGELVAAADVVLDCSDNFATRQAVNAACVQHARPLVSGAAIGLDGQISV
    WDARGSAHPCYACVFPPETTVEEVR
    CATMGVFAPLVGIIGTMQAAEALKLLARTGVSMAGRLQMLDARNMEWTEIRVGRD
    PNCPVCATRHS

    >gi|171058790|ref|YP_001791139.1| arsenate reductase and related [Leptothrix cholodnii SP-6]
    MITLHGIPNCTTVKKARAWLEEHGRPYAFHDFKKQGVPEAALDQWIATLGWEPLVNRSGTTWRGLDDAAKAAVTDAASAR
    ALMLAHPSVIKRPIVQWGQAARQRLTVGYSDTLFSSQFD

    >gi|171058841|ref|YP_001791190.1| DsbA oxidoreductase [Leptothrix cholodnii SP-6]
    MNQTRLAVAALLIAAFAFIVGTLYYKSETLQQSTTAVQDNRQALVRPHAPVFGNAQAKVTIVEFFDPACETCRAFYPIVK
    DIIRSGFGEVNLVLRYAPLHQGSDIAIQILEAARQQDLYWPVLEKVLETQPIWADHAQPNPQRIWELLDGTGLDMARARA
    AMNDVAIRQALEQDVADMVTLKVTKTPSFFVNGTPLSRFGVEELRTLVSEELRRAKAQSPK

    >gi|171059119|ref|YP_001791468.1| rhodanese domain-containing protein [Leptothrix cholodnii SP-6]
    MQQVAVRDIAALLDTWRGQGLRPALLDVREAWEVATASLSLPGVETRCIPMQQVPARHAGELDAAQPLLVLCHHGMRSLQ
    VAMYLDGQRYPHVYNIAGGIDAWSRVVDPTVPTY

    >gi|171059268|ref|YP_001791617.1| glutaredoxin [Leptothrix cholodnii SP-6]
    MIKKLLASARRHSLISLVLVVGFTAVSVKAAQKVVDYQRASALRAVAQPGDIRMLSRTDCGYCTLAHAWMSKHAIPFEEC
    MIDTDAACRAEHERLGTRLTPTVLVRGEVQRGFDAQRVTATLAGKPAH

    >gi|171059462|ref|YP_001791811.1| heavy metal translocating P-type ATPase [Leptothrix cholodnii SP-6]
    MPAPNPPSYKMAAPAAVAALSATQVAAVDAPSSLEVCTQWIETESGERRGRSRLLLSGLHCAACGGLIEDALQRVEGVAS
    VEVNGAAQRAVVVWDPARTRISTLVEAVRRAGYGAFPDTGAEAVALAARESRRAIWRLFVAAFCMMQVMMYATPAYVAEP
    GDMTDDMVRLLRWASWVLSVPVVLFAASPFFKGAWRALRERRIGMDVPVVLGIVVTFVASSIATFEQAALAGSDVYFDSL
    TMFVSFLLGARLLESQARARAAQSLDAVMRRLPDAVERLGDDGQATLVTAAELAIGDHIRVHVGQAFAADGVVLEGRTQV
    DEAMLTGESRPVERGPGDEVAAGCLNLGAPVSVRVTRLGAQTRFQRIVELVERALTGRPSYLISADRIAGPFLWVVLLLA
    GGAYVAWSFIDPHKAIWVAVSVLIVTCPCALSLGAPVAWLAAAGQLARRGILVQRLDALEALTRVRHLVFDKTGTLTEDR
    LTLAAVRRPSAALDGPSTEALQALAASLAAQSRHPLAQALARSVEPAPAVAGSVPAWRDVIEQPGAGLQAVAVTQGLDAT
    TWRLGHALWCGVSTTEAVSPDQPGLIERPSVWLARQSVDGWQPMLHVEFDEQLRADAERGVAALDAEGLQLHLLSGDQPG
    SVERLARQLGLAHFQARCSPQDKLEAVERLQRSGERVAMVGDGINDAPVLARADVSIAMGSAAALAQARADVIMLSDRIG
    DLSVLHRTAHRTMRIVRQNLRWAFAYNLACVPLALVGWLPPWLAGIGMAASSLVVVLNALRLARNTSDMQSQSAVTGPRA
    VGAPA

    >gi|171059472|ref|YP_001791821.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Leptothrix cholodnii SP-6]
    MQPTRQTPSATAAISGGGGASAGAIETDALVIGAGPVGLFQVFQLGLQDLRCHVVDVLSQPGGQCAELYPAKPIYDIPAL
    PVCSGTELVERLLQQVAPFDPVLHLGQEVESLAPRADGRFDIGTSAGTQFIARAVFIAAGVGAFSPRRLKLPGLDTLAAS
    CVSHQAPDVSACQGQTVLVHGGDDRALDWACRLAEHGVAVSLLYRRDVYPAAPEQVRRLELLASQGRVTRRVGQPTQARA
    DAAGQLTGVDHLDPSGQTHHEPATRLFVSLGLSPRLGPLSSWGLQMERKLLDVEPSRFETSLPGVYAVGDINSYPGKLKL
    IVCGFHEATLAAWAAAHRLRPDAPHHLEYTTSSARLQRLLGVLPRGAE

    >gi|171059486|ref|YP_001791835.1| thioredoxin [Leptothrix cholodnii SP-6]
    MSSDLIKHVSDATFDGDVVQSDKPVLVDYWAEWCGPCKMIAPILDEVAKDYSGRLQIAKMNVDENREVPAKFGIRGIPTL
    MLFKGGQLAATKVGALSKAQLTSFLDAHL

    >gi|171059562|ref|YP_001791911.1| dihydrolipoamide dehydrogenase [Leptothrix cholodnii SP-6]
    MSKQFDVVVIGGGPGGYIAAIRAAQLGFNVACIDEWKNDKGGPAPGGTCTNVGCIPSKALLQSSEHYEQAAHHFGDHGIT
    LDNLKMDVAKMVGRKDTVVKQNNDGILYLFKKNKISFFHGRGSFAKAVEGGYEINVAGAAAETLVGKQIIIATGSNARAL
    PGAAFDEDKVLSNDGALRIGAVPAKLGVIGSGVIGLEMGSVWRRLGAEVTILEALPNFLGAADEGVAKEALKAFKKQGLK
    FEFGVKISAVDTSGAGVTVAYTDDKGAEQTLAVDKLIVSIGRVANTIGLNPEAVGLALDERGAIVVDGDCKTNLPGVWAV
    GDVVRGPMLAHKAEEEGVAVAERIAGQHGHVNFATIPWVIYTSPEIAWVGRTEQQLKADGVAYKAGQFPFVANGRARALG
    DTTGFVKFLADATTDEILGVHIVGPFASELISEAVVAMEFKASAEDIARICHAHPSLSEATKEAALAVDKRTLNF

    >gi|171059604|ref|YP_001791953.1| peptide methionine sulfoxide reductase [Leptothrix cholodnii SP-6]
    MSASPSDPTTPAAAKPAETITLGGGCFWCLEAVFLQVEGVESVQSGYTNGRVVNPGYEAVCGGDTGHAEVVQLRFSPDVI
    DLAELLRIFFVIHDPTTLNRQGHDVGTQYRSGIYWHDPKQVEVAKAVMQEAGQAWSAPIVTELLALDNYWPAEAYHQRYF
    ENHPGQGYCAYVIAPKVNKFRQAFARHQRKG

    >gi|171060041|ref|YP_001792390.1| rhodanese domain-containing protein [Leptothrix cholodnii SP-6]
    MSRRLHAFATGSFCNPDVQPQTMSSAHTPSLPAPLISAAELASRLSGVLLFDARFELSQPLAGAAAYAEGHLPGAAYLDL
    DRHLSTKDSAAALCGGRHPLPTAPAFAHTLGQLGVTPAQAVVIYDTQGGMFAARAWWMLRWLGHREVAVLDGGLKAWQQA
    GGALESGVVPAPAPVADYPLPADLAMPTIDAATLQATLGRPVLIDARGAERYRGDVEPLDPVAGHIPGALNRPFTQNLGA
    DGRFLPADALRAGFAPLLSGRPAAEVVHQ
    CGSGVTACHNLLAMDVAGLAGSQLYPGSWSEWCSDPARPVARG

    >gi|171060089|ref|YP_001792438.1| OsmC family protein [Leptothrix cholodnii SP-6]
    MECTINWLPSSGMAFSAETGSGHLLTMDGAPEGGGRNLAPRPMETLLAGAGACAAYDVVLILKRGRHQVQGCQVKVQADR
    ADTDPKVFTRIVMHFIVSGIKLPEVAVQRAVQMSHDKYCSATAMLAKTAEIELKIEVVEA

    >gi|171060122|ref|YP_001792471.1| iron-sulfur cluster assembly accessory protein [Leptothrix cholodnii SP-6]
    MSAVAENIQTEMPSPIIFTDSAASKVADLVAEEGNPDLKLRVFVQGGGCSGFQYGFTFDEIVNDDDTQMSKNGVTLLIDA
    MSLQYLAGAEIDYKEDLQGAQFVIKNPNATTTCGCGSSFSA

    >gi|171060185|ref|YP_001792534.1| rhodanese domain-containing protein [Leptothrix cholodnii SP-6]
    MADTRVTFLLDNWYWIAAALVSGGALMWPMLKGGDADAIGVTQAVQLINREKAVVIDVCTKDEYAAGHVANSRNVPLADL
    ESSKNLPTNKALPLVVV
    CATGTRASRAIGTLTKLGHQRVHVLSGGLAAWREANLPVEKSA

    >gi|171060186|ref|YP_001792535.1| glutaredoxin 3 [Leptothrix cholodnii SP-6]
    MYTTQVCPYCQRAKALLKQRGVEHVEEIRIDLDPVQRNHMMEITGRRTVPQIFIGDTHVGGCDDLMALDHAGGLHTLLQA


    >gi|171060220|ref|YP_001792569.1| redoxin domain-containing protein [Leptothrix cholodnii SP-6]
    MLSISLGPLALPLAPVLLLLSGWGASWLASRLAGGERAAEAGNAVISALWLGLLAARLAHVALAADLYAATPLAVLDVRD
    GGWHAPTGALAGAAWLFWRGLRRPALRRSLGLGASAGALAWLAATHVLGVQQAPTLAALSSIRLTEPTGATATDLAQAAR
    GRPVVVNLWASW
    CGPCRQEMPVLAAAQQREAAVGFVFVNQGESAAAVQAYLTDQDLALREVLLDAGSRLGPAVGSRGLPT
    TLFYDAGGRLVDAHFGVLNAVALESRLRVLRAGVRTAP

    >gi|171060381|ref|YP_001792730.1| rhodanese domain-containing protein [Leptothrix cholodnii SP-6]
    MTSPARLLLALCATLGASFATLAPVQAAEPELLRIIGEDKKFIVQTAKGPLEITRTMTPCAKNKGWLQPLVPVAGVHPVG
    EIEILHALNDRDAMLVDMRESQDRVNGTIPNSYHIPYTEVAGRMDELGCKKTGKGWDCSSAKKVYAFCNGPV
    CPQSPTAI
    LAMTRDGFPADKIYYYRGGMLDWEALGFPVIKGDF

    >gi|171060417|ref|YP_001792766.1| OsmC family protein [Leptothrix cholodnii SP-6]
    MSDAPATVRLTQRHDYHFDADFGADLPPLQLDEPPPLGQGEGPSPLQLLAAAVGNCLSASLLFALRKYKQAPEPITCEVQ
    AQTGRNAENRLRVTQIQARLTLGVPAASLERLDRVLDQFEAF
    CTVTESIRAGIPVTVEVWDSTGARLK

    >gi|171060439|ref|YP_001792788.1| redoxin domain-containing protein [Leptothrix cholodnii SP-6]
    MMRRRLMIGSGLALAGLLPAVVPALAAPAQRGDKVRWPAITLLDGRMVAAESLRDTATVVVFFSTTCPFCKRHNQHLDKL
    ARATAGRGLQVIAAAHDRQSEPVRQYLASQGYAFEATLDATPLHAALSERRVIPLTCVIDRQGLLREVIPGEMFEDDVLE
    LARWARA

    >gi|171060444|ref|YP_001792793.1| protein of unknown function DUF395 YeeE/YedE [Leptothrix cholodnii SP-6]
    MNIEGLFAQWGEMGSVTALGAAIGLLFGFFAHRSRFCLRSAVIEFARHTREGKLTVWLFTFSTAVLLTQLFVVLGWLDVS
    GARQLSARGSLSGAAIGGAMFGTGMILARG
    CSSRLMVLAAQGNLRALLSGLVFAVTAQAALTGVLSPVRLAMASWWTVEG
    GASRDILALTGIGHTGGIVFAAIWLAAALVWARRQHVRFWGWFGAIGVGVMVALAWLMTYLFSRAAFDLVVPIQSLSFTG
    PAADTLMLVLSPPGQALKFDLGLVPGVFLGAFISAALWRELKLEGFQGGQAMRRYIAGAFLMGFGGMLAGGCAVGAGISG
    AAVFTLTSWVTLSTIWGAAMLTDRLVDRGDEVVHSPAAIDPKFDPELSASYARP

    >gi|171060446|ref|YP_001792795.1| protein of unknown function DUF395 YeeE/YedE [Leptothrix cholodnii SP-6]
    MEPTANLASIVIGGGLALGAIFGAIAGKTNFCTMGALSDVVNMGHWGRLRMWLLAIAVAVIGTQVLALGGSVDLAKSIYL
    RPQLPLLSLVVGGLLFGVGMTIAGGCANRNLVRLGAGSVRSLVVLVFMAIAAYMTLKGLFGQWRVSWLDPVSVDLAGRGL
    KDSSLGTLLSAWGGLEVGRATQLATAVLVVPLLAFVFKDGRFRRNAWQVLGGIALGAVAVAGWYLTGHIGFAENPETLEM
    SYFATNSRTLESVSFVAPTAYSLELLMLWTDKSLHASFGIACAGGVVLGSLAVALLTGHFRWEGFASMQDLRNQLIGAGL
    MGFGGVTAMG
    CTVGQGITGVSTLALGSMVALLAIMAGAVATLRFILWRAMRED

    >gi|171060472|ref|YP_001792821.1| protein of unknown function DUF395 YeeE/YedE [Leptothrix cholodnii SP-6]
    MTHFTPWSALAGGALIGLAAVLLLWLNGRIAGISGITGGLWFSATGERAWRLRFVGGLIVGTLAWFAYSGQPAPLRNGFP
    TGLLVLAGLLVGYGTSLAGG
    CTSGHGVCGLARFSVRSLVATAVFLGVAIVTTFIVRHLLQIA

    >gi|171060481|ref|YP_001792830.1| hypothetical protein Lcho_3811 [Leptothrix cholodnii SP-6]
    MTAPALAPIAHPDAGWLVACLCARWCNTCEAYRVTFAQVAAQFPALRFVWVDIEDEADTLGDAALEVENFPTVMLLQHGR
    PRFFGTLLPHASTLSRTLTAALAGELAGAGLGTTADALAPGVLRVAAHDEASAPR

    >gi|171060654|ref|YP_001793003.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Leptothrix cholodnii SP-6]
    MNRRKLTLGVVAGTALAAGIGWSLRRGAGTPPATPDTANPSAARAPAGADAASAGAAPDLWSLRFDRPEGGEVVMASLRG
    KPLLINFWATW
    CPPCVREMPLLDSHAREFGPRGLQVLGLAVDGPSPVREFLLKTPVSFPIGLTGFAGTELARSLGNTTGG
    LPFTVLFDSAGTAVQQKLGETHLAELQGWAKSVGL

    >gi|171060659|ref|YP_001793008.1| redoxin domain-containing protein [Leptothrix cholodnii SP-6]
    MLKVGDKLPAGTLNEYIEVEGNGCSLGPNSFDVTKETAGKTVAIFALPGAFTPTCSAQHVPGYVQAADALKAAGVDEIWC
    LSVNDAFVMGAWGRDQGTAGKVRMMADGSGTFTQATGLTLDLVARGMGLRSQRYSMLVVDGVVKTLNVEAPGKFEVSDAQ
    TMLRQAAA

    >gi|171060714|ref|YP_001793063.1| redoxin domain-containing protein [Leptothrix cholodnii SP-6]
    MKPIRVVAIAALVLGCAGATAVVLARRDAAPVVDYTLLDGSRHRSDALRGQVVLVNFWATSCTVCVKEMPELMATYRRFR
    DRGFETLAVSMSYDPPAYVVNYARSRELPFPVAIDNTGEIARRFGDVQLTPTTVVINRRGRIVRRYVGAPDFAELNRLLE
    RLLTES

    >gi|171060775|ref|YP_001793124.1| thioredoxin [Leptothrix cholodnii SP-6]
    MHIACAHCGATNRVPDERLRESPTCGKCGRELLPATPLDASDATLPKLIAQTELPVLVDFWAPWCGPCRQMAPMYAQAAA
    QWQGRVLFAKVDSDDNPQASSRHAIRSIPTLLLFQGGREIGRQSGAMPAAQLSAWLQQTLR

    >gi|171060895|ref|YP_001793244.1| DSBA oxidoreductase [Leptothrix cholodnii SP-6]
    MDRRDFLAQTAAVLGLTGVAGHAAAQSFQEGKHYVRLSQQLSVTAPEGKIEVVEFFWYGCPHCHAFEPTLDAWARKLPAD
    VAFRRVHVGFRPNFEPQQRLYATLEALGLVDSLHRKVFHAIHQLRQRLDRPEDIFAFVEKNGADRAKFVEMYNSFGMQAK
    VRQGKQLAEAYKIDGVPALGIHGRYYTSPALAGGDNTPELEGGLRALALTDQLVARVRKGA

    >gi|171061034|ref|YP_001793383.1| methionine-R-sulfoxide reductase [Leptothrix cholodnii SP-6]
    MTRRNLNQLLASWGLGAGPRARPAADVPPAVPRDDALLLTDAQWRERLGAAAYDVLRHEGTEHPYTSALNDEKRAGRYLC
    AGCGLALFDARAKFDSGTGWPSFFAALPGAIETRVDHQLIMPRTEYHCARCGGHHGHVFNDGPAPTGQRH
    CNNGVALRFV
    PDAD