Leptospira borgpetersenii serovar Hardjo bovis L550 uid58507

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116326871|ref|YP_796591.1| glutaredoxin family protein [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MKLKVYEYKNCSTCRNALKFLSSKKVELEILPIREIPPKKTELKTMLKYVGNESKKLFNTSGGDYKELGLKDKLRSLSLE
    EQLDLLSKNGNLVKRPFVLGDGFGFVGFKEEEWKKWIS

    >gi|116326879|ref|YP_796599.1| protein-disulfide isomerase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MSQLSKNKISIILSALGLIFSFLLIQKYYGDPTSVGETLCNVLSESGSCDKVSESTYSAIRNVPGLGDLPIALFGFVFYG
    FVGFLFVFSEIKKETSEKNLRFAFYVLILGLIADLGLFFLSVGVIKALCGLCVATYVITIALLAVNFPVFKSLSDKSIRA
    VLNSFSGSFVNLLIVILSFFVLGLYGGRISMGGTRLVSGSADGEKSIPEQLKEFETAQTVQIDLKDVPILGDLNAPITIV
    KYADFN
    CGHCMHTSKILKSFLNEYEGIIKVAYKNFPLDGNCNRLVGRKSPEASSCIAASAALCANQQNKFYPVYTGLYDD
    NEAGVMHTAATVTRLAEKSGLKMDQFRACMSSTKIRDHINREVDEAEKLKINSTPTLFINNKPFPKSGTPDVDFLRRLIY
    QLINQS

    >gi|116326940|ref|YP_796660.1| glutathione peroxidase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MTQTLYDLTATLNSGKEQRLEDYRGKVLLIVNTASECAFTPQYAGLQSLYGKYKTEGLEILGFPCDQFKHQEPGSDETIK
    NFCQKNYGVEFPIFKKINVNGDSAHPVFRFLRKKASGFFGNSIKWNFTKFLVDKQGNVIKRYSPITTPEKIEKVIQDLLK
    K

    >gi|116326974|ref|YP_796694.1| methylated-DNA--[protein]-cysteine S- methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MEHYKKIAEAIQFIQKHAVSQPELDEIAKSVGLSPFHFQRLFTEWAGVSPKQFLQYLTLQNAKSILSKPQTTLFDAAFEV
    GLSGTSRLHDLFVKIEGMTPGEFKNGGEKLKIRYSFQKNVFGDYVIASTEKGICNLYFYDVSKEQVVSELKEQWSKANLI
    QKTDENQNRVIRFFDKTFDGKEKIKLHLKGTDFQIKVWEALLKIPEGQLSSYMDIANSIGQENASRAVGTAIGKNPIGYL
    IP
    CHRVIKSTGSIGEYRWGPERKMAMIGWEMSRTDHLVSSIS

    >gi|116327035|ref|YP_796755.1| rhodanese-related sulfurtransferase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MTPKELKSRLDLREMKKDSFYLLDVRNPNEAEICTIKGTDLLIPVGELSNRLPEINSWKESDKDMIVYCRSGGRSAMACG
    ILKQSGFTKVHNVEGGILLYSDEVDSSIAKY

    >gi|116327186|ref|YP_796906.1| protein-methionine-S-oxide reductase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MEQATLGGGCFWCLEAVYQMVEGIESVVSGYAAGQTKNPDYRSVCSGTTGHAETVQITFDSKVISYFEILEIFWISHDPT
    TLNRQGNDVGIQYRSIIPYHSPEQKKQAEQSIQKAGEHFSDPIVTQVEILKEFYPAEDYHQNYFRTNPKQAYCHYVIKPK
    IDKYLKTGFKVKKEGS

    >gi|116327207|ref|YP_796927.1| peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MTQVTLKGNPVSLEGKIPVPGDKAPDFKVIKQDLSEFSLKDYSGKVKILVAVPSWDTSVCALETRVFNEKAAGLSDITTL
    IISGDLPFAMKRFCSTEGINSPNLITGSQFRDFSFSKAYGTHIADGPLKGLSARAVFVVDKSDIVRYVELVSEIGSEPNY
    EAALTAAKAAL

    >gi|116327308|ref|YP_797028.1| glutathione peroxidase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MYPKISVLFFILGILFPLAGTFAKESFYDFKVKDIKGNEISLSKYKGKVVMVVNVASKCGYTYQYDNLEKVYKKYKNQGF
    VVVGFPANNFGSQEPGTNQEIETFCRIQKGASFDMMSKISVKGKDQHPLYSYLIENSPNPGEIEWNFEKFLISKEGKVEA
    RYRSAVEPDASVVAQKIESLLK

    >gi|116327457|ref|YP_797177.1| hypothetical protein LBL_0674 [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MANRGDLQKKTHTKKRPLHNIYGKEILSKRLEAENFPRTTLSFYRYVILENVQELRNRLYVEWEALGVLGRIYVAREGIN
    AQLSIPSHNLNSFKENLNSRIQFKDMLLKIAVEDDHRSFLKLDLKVRNKIVADGLNDDAFDVTNVGKHLSAEEFNRCMED
    KNSIVVDVRNHYESEIGHFENAILPQSDTFREELQILLELLNGKEDHKILMY
    CTGGIRCEKASAWLKHHGFKDVNQLHGG
    IISYAHEISQKGLESKFRGKNFVFDGRLQETIGNEIISVCHQCGKKSDRHINCSNPGCHILFIQCDDCSEKFEGCCTEEC
    KTVLHLPKEKQKEIRKGKSNENRFFTKSKIRPKISELYRNRKPFETA

    >gi|116327565|ref|YP_797285.1| hypothetical protein LBL_0795 [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MQFSSRSPNRLSKEKSPYLQQHAYNPVDWFPWGEEALTKAREQDKLIFLSIGYATCHWCHVMEKESFENQMVADYLNSHF
    VSIKVDREERPDIDRIYMDALHAMDQQGGWPLNIFLTPDGKPIAGGTYFPPEPVYGRKSFLEVLNILRKVWSEKRQELIV
    ASSELSRYLKDSGEGRAIEKQEEGSLPSKDCFNSGFSLYESYYDAEFGGFRTNHVNKFPPSMGLSFLLRYHHSSGNPKAL
    EMVENTLLAMKRGGIYDQVGGGLCRYSTDHRWMVPHFEKMLYDNSLFLETLVECSQVSKKISAESFALDVISYLHRDMRI
    VGGGICSAEDADSEGEEGLFYIWDFEEFREVCGEDSRILEKFWNVTNKGNFEGKNILHESYGGEATKLSEEEWKRIDSVL
    ERARAKLLERRSKRVRPLRDDKILTSWNGLYIKALAKAGIAFQREDFLKLAEETYSFIERNLIDPDGRILRRFRDSESGI
    LGYSNDYAEMISSSIVLFEAGCGIRYLKNAVLWMEEAIRLFRSPAGVFFDTGNDGEVLLRRSVDGYDGVEPSANSSLAYS
    LVKLSLLGIDSVRYRKFAELIFSYFTKELSTHSLSYPHLLSAYWTYKYHSKEIVLIRKDANSGKDLLAAIQTRFLPDSVF
    AVVNENELEEARKLSVLFDSRDSGGNALVYVCENFSCKLPVSNLADLQKWIE

    >gi|116327756|ref|YP_797476.1| dihydrolipoamide dehydrogenase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MSESYDLTVIGAGPGGYVAAIRGAQLGMNVCIIEKERPGGICLNWGCIPTKALLESAHLLDKIHSAKGFGIDLSGAKPDF
    PSIIARSRNVADSMASGVEFLLNKNKITRKKGTAVFKDSNTIWLPDTSKEEITSKYYILATGARARELPGLPFDAGTVLS
    SKTAMIQEKIPESLLIVGAGAIGVEFADFYSTMGTKVTLVEMMDQILPVEDKEISAFLEKSFVKRGIRVLTGVGVSDPVI
    KNGKVKVLLKGKNLPESGEISETEKILVSIGLVPNTDTMNLEEIGVFLQKGFVKTDSQYKTSIPHIYAIGDCNGPPLLAH
    VASMEGIKAAEAISIQVGNPHHLSYTPINYDAIPGCTYCYPEVASIGFTEKKATDMGYTISVGKFPFIASGRAKAMGDTG
    GFTKVVVDKSSGEILGAHLIGPGVTELLPAVALGITQELTAKEIASTIFAHPTLSETVMESFGAALGEAINL

    >gi|116327794|ref|YP_797514.1| protein-disulfide reductase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MLLKIHQYKNFLIRFAILSALFLGLPLSAETLSGSWFSGIRKSISEGISSGTFDWTSGFLLIAGGVLASLLPCVYPLYPI
    TVGIVRARGEGSPRILHPAIYYFGLITIYASFGLIAGLSGGAFNVILRYPIVNLALSVLIFLLALGSLDLIHLPFFQSKE
    VKTVQGCGGTFFLGMGAGLLSSPCVGPVVVAILLRITVDSGAISVDSVLLAVFKMFLFGVGLGFPFLMIGVFGLSLPKSG
    KWMRWIQWVLGIFVLYFSYAYFQKSLLGWEISDSLIPLSAFGILFLLLCIYFFLPEEWDRYVRMKKTLFLGGVVLSAVGL
    VILFTQNLRGSNSVSAMEIETRGNLSWFRSTSKAYKEAAITGKKMFVDFYADW
    CTNCNAFEELTQSDSVLNEALQGVVLL
    KIKDQDPIFETYVKDSRFEELKIGLPFFVILDAEGNLLYKNTDYQDTETMIQTLKQP

    >gi|116328086|ref|YP_797806.1| glutaredoxin-like protein [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MKLYQFQSCPYCSYVRDEFQNMGLVPGKDYELVEASRGTPGREEVVKLGGRSQVPFLVDDDIKMYELREIVNYTKLKKKI
    S

    >gi|116328087|ref|YP_797807.1| glutaredoxin-like protein [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MNEEVKQKINDLIGTSKVFLFMKGTPEAPMCGFSAGVSNVLRSLGISFGSFNVLSDETMRQGIKDYANWPTIPQLYIDGE
    FIGGHDIVVEMAKSGDLQKKAGILNS

    >gi|116328092|ref|YP_797812.1| dihydrolipoamide dehydrogenase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MKEYDIIVIGTGGGTKLITPPSKIGYKVAVIEKESPGGTCLNRGCIPSKMLIYPAEILSLAKNSEKFQISFPGKPKVDFK
    SLVERVSKTVDEESASIRPAYDKNPNINYIQGTASFVSDKVIVVNGEQLTAKKIFIASGARPSIPNIPGLVGTPYMTSRE
    ALRRTDLPKSLIVIGGGFIALELGFAYSAFGSEVTFLVRSRMLKNEDGDIVNEFERVFTKEHNVLLRTDIHKLEYKEKMF
    HVEVETAGKKLQLRSEALLVATGIRPNTDLLNLSNTKIQTDTNGYIIVNEYLETTSPEVYALGDITGKYFYRHSVNFEGE
    FLFRTLYLEKKRTPIDYPPVPHAVFTHPQVARVGKTEEQLVQEGIDYIAAKNPYSASATGMARLSDSGFVKILVDKKSRK
    VLGAHAIGDEASNVIHLFILLMTIGGNLDDLLRMIYIHPALPEIARNAARKAGELLQIKE

    >gi|116328111|ref|YP_797831.1| oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MQDIIEKLKAREFRPLLILSAVFFIYILLTIFPLVTYFSSDGVVQINGKNYTIKDVEKDNPRIARKFYAETNDRLYRVLS
    EFASKKVVSLAAKERNVSEKDLLELSIQSPSVEEMRAVYEQYKNSPALQGKSFDQVKTEIENHLVSQKKEEARNALFSEL
    RNRYNISIKVKELPPLRDDTITAGNNPSIGPENAKVTVIEFSDFE
    CPFCKRSQDVNAQLRAKYKDQIRWVFRDYPLSFHP
    NAMFAHIAANCSTFQGKYWEFFKVLFDNSGNLSKERVLDLARGVGLDMKTFSQCVNDASVRKEVEADIAEGEKYGVSGTP
    AFFINGIMVEGAQPIEAFTKVIDQELKN

    >gi|116328212|ref|YP_797932.1| Thiol-disulfide isomerase or thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MWNFRPILLFIFFLGFSCSFTKEESILYQLSLYDLDGRPASLKEYKGKVLLLDVWASWCEPCKDAVPVLEKLSKDLQGKN
    GVLLGINTEPELSKEEHLKAVKEFGITYPFFVDRDFTFINQYKVEGQPALIVFSPSGILLKIQYGVREKDYPKLRANFSN
    WLSAP

    >gi|116328367|ref|YP_798087.1| Zinc/cadmium-exporting ATPase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MESITEIENRCYHCNTQIRSEKEKIYAELKGKTELFCCFGCKSLATLLMENGLTRFYDLRGSGILEPASYVRPNPENLET
    DSTYQEYVIQKGNGICETLITIGKIH
    CSACVWLNERVVSEQTGVLETRINFATGRMKLIYDRNRIDLNKIFFLIRKIGYE
    PALYSPLKTETKVGLFSKDLFLRMAVAGFSWGNIMLFSVGLYTGYFSGIEVEFKRLFHFVSWVFTTPVYIYSGYPFYKGS
    MESIKRKMLSMDMLLFLGVSLAYFYSVYVTLSDKGEVYFDSVCTIYFFVLIGKFLESTIRLKAGRKIGELLSALPEEYTI
    IQGLRQISVSPSKIQKGDKILLKNGNRVPVDGILETENAHFDESFLTGESKPVSRKKGDSILSGSLCLNTNVFVTATTTV
    RESTLSRISSLVEAALQSKPKIQRIIDKLSAYFTLIVLLLAIATFSIFFFYYSNGESAVLNTISVLIVACPCALGLAVPT
    AHVAGNLLYGANGILVKNPDSMEILSHADRIYFDKTGTLTFGKLSIREEWFLKPDDSFRIYSILLSMESNSTHPLAISLM
    KEIEKKLRQKNKPPVPIFWKKIQEVPGNGIEAVSLNGDQTYRIGNRKFVSNGQDSQDGKIYIGVNEKLIASFCLEDTIRP
    EAKDTIQKLKPKISFLGILSGDSKSNVQSLASFLDLKNSFYELKPEEKLKVIKQAQNNGETVVMVGDGINDSACLAAANL
    GISMGIASDLSIDKSDLVLLSNRLDSLVRAISISRRTRNIIFQNILISLIYNSIMIPLAAFGFMLPVICAGFMTLSSLSV
    VLNSISLQWRTEP

    >gi|116328378|ref|YP_798098.1| thioredoxin-disulfide reductase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MVHKIVIVGSGPAGHTAAIYAARANLNPVMYEGFMAGGIAAGGQLTTTTEVENFPGFPNGIDGTQLTQLFREQSVKYGTK
    ILTQTITKVDFSSRPFQLWSDEERIEAEAVIIATGATARRMHVTGEDTYWQRGISA
    CAVCDGALPIYRNKELAVVGGGDS
    AVEEASHLTKFASKVYLVHRRDSLRASKIMQKRATTHPKIEIIWNSQVKEAKGDGKNLTALTLEDTMSGQKKELSVGGLF
    YAIGHKPNTDIFKGILDLDESGYIKTVPGSTKTSIEGIFAAGDVQDKIYRQAVSAAGSGCMAALDAERWLESREE

    >gi|116328459|ref|YP_798179.1| thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MALAEVNDSNFKSETSGGLVLIDCWAEWCGPCRMVAPVLEELSNEMNGTVKIKKLNVDDNQDTAQSLGISSIPTLLLYKD
    GQLVDKVIGALPKAQIKNFIERHK

    >gi|116328653|ref|YP_798373.1| peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MPQVTSLAPDFKAEAVLGKEIKEIKLSDYKGKWVVLFFYPLDFTFVCPTEIIEYDNKLPEFKKLGAEILGVSVDSAFTHL
    AWKNTPKKEGGIGDIKYPLIADLTKSISRDYNVLTDGGVALRGTFIIDPAGLIRQATINDLPVGRNIDEAIRLIKAFQFV
    EKHGEVCPANWDEGKKTMKADPEKSKDYFSAVN

    >gi|116328747|ref|YP_798467.1| dihydrolipoamide dehydrogenase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MSAEFDVVVIGAGPGGYVCAIRAAQLGFKTAIIEKRKTLGGTCLNVGCIPSKALLDSSEEYHKVLHKLDVHGITVGKVEV
    DLGKLMNRKDQIVKEVTDGVDFLIGKNKIKRYEGFGKVLSAGKVEVASSGGDKEVINAKHIVVATGSVPIDIPGLTVDGK
    NIITSDHAIELRKLPKKMIIIGAGVIGLELGSVWARLGTAVTVVEFLPGLISNVDRPMGALLERSLTSQGIEFLFEHKVK
    SATTSKNGVKVQIEDSKGATKDLEADVVLVAVGRRPFLEGVGLEEAGVALTPRNRIQVDGHFKTSVPGIYAIGDAIDGPM
    LAHKAEEEGVALAELLAGQSGHVNYDAVPYVIYTWPEMAWVGKGEEELKAAGIEYKTGKSLFRPNARSKAMNEAEGQVKI
    LADKKTDKLLGAFIFGPRASDMIAELAVAMEFGASAEDIARSFHAHPTLAEVIKEAAMAVDKWAIHA

    >gi|116328872|ref|YP_798592.1| peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MNELKVGSKAPNFAGINEKGEKVKLLELTGPKGIVLYFYPKDQTPGCTTEACDFRDNFSRIKKTGFNVVGVSKDSVKSHQ
    KFIEKQELNFTLISDEDGKICEDYGVWQLKKFMGKEFMGIVRSTFLIGTDGKILKVYPKVSVKGHVDEILSDIKALEKK

    >gi|116328906|ref|YP_798626.1| hypothetical protein LBL_2297 [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MSLLESEKIPLGSLLPEFRLEDPDGKMYSSDQLFGSTGLLLVVTCNHCPYAQAIWPRLIRFAVEIRSLGVRTVAINPNIH
    PDYPDDSPQMMLSKIKEWGVPFPYLVDKTQEVAKKLSSMCTPDIYLYDEEKKLYYHGRMDDNWKNEKQVSRKELEYAVHQ
    LVKGNPAPINQMPSIGCSIKWKE

    >gi|116329076|ref|YP_798796.1| cation transport ATPase [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MNVKNEIFPDEITLDVIGMTCSNCALRIEKGLKKVPGVKDARVNFAMETATVGFESSVKKELLLDKIDSLGYRAFVQEDF
    EIHGEAEKAHTKEFKDLKVRVFISALLSFPMVSGMIGHIGNNQIFEYFSSIMNPWLQFALATPVQFWIGASFYKGGFRAI
    RNKGANMDVLVVLGTSAAYFYSVYWTFLEFGTYAHGEIPLYYETSSILITLILFGKFLEHIAKGKSSKAIQSLVGLQPKS
    ARIIRNGEIQKIPLFAVRPGDLLLIKAGETIPVDGTVEEGSSSVDESMLTGESIPVEKTISSPLYGSSLNQNGILKLRAS
    KVGKDTLLSEIIRVVRETQGSKAPIQRIADQISGIFVPVVVLISILTLFLWYFWIEPSHFSGALKKAIAVLVIACPCALG
    LATPISILTGSGKAATLGILFRTAEALEIAHKVDTIVFDKTGTLTLGKHILKDLESLNSQEENFLLTLAASAEQGSEHPL
    SKAIVESAQKKGLLLSMPEDFETIPGGGISASVQGEKIVIGTDRLFCERGIELNPKFLDLKRIREKEGNTVVHLSLNGTH
    SAILSLADRIKESTPTAVEKLKSLGMKIYIITGDNERTARAIANVCGIKQVLAEILPQEKAKEIKKLMDAGKVVAMVGDG
    INDAPALVIADLGISMGTGTDVAMESSDVVIVNGDLVSIVNAFSISKKTVYNIRQNLFWALFYNTLGIPIAAAGLLTPWI
    AGGAMALSSVSVVLNALRLQRK

    >gi|116329111|ref|YP_798831.1| methionine sulfoxide reductase B [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MKNMFLFPVILVSLVFSGCCKVGGDSNRTNQKGESMSYEINKSEDEWQKELTPEQYKILRQKGTEMAFTGALYKNQDKGT
    YVCAACGAVLFSSETKYESGSGWPSFYQPTKKGAVNEERDNTHGMVRTEILCAKCGGHLGHVFNDGPSPTGLRY
    CINSAS
    LKFRKE

    >gi|116329178|ref|YP_798898.1| thioredoxin domain-containing protein [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MIKKNLSNFPAPPSKMRIGPNYHSELSYLRRDLFSDSNNLWVKSKLRLFKRNTTFSLRYVRFLSFSTSVLFCVIFCLPIS
    AEIQWEKSVKTAFEKAKINGKPIFIDVYADW
    CGYCKILKNEIYPKKEVQLELSKFVTLSLDGDTFPNLKRKYGIKGYPSI
    LFLDQNGSLIDKITGMPDSKMILKYLKNAYAHRNLEKEYLEKLAKDPNGIKTNFQAGVYYFEAKEYTKAIQFFRKVIDAN
    DTKNTDKKHDALFNLGISYLEVGNFKFAIATFNSYISRYPNGDLSSILYFRANAYEELNRKEEAKADYKKVLELTVDPEE
    KRDLQFRIDSLN

    >gi|116329254|ref|YP_798974.1| Thiol-disulfide isomerase or thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MKEILKKGGNVALWILLFLTITIVLSIFKASDVKPSISIDGMKSFEGERYDSKGRVTVVYFWATWCGVCSFHLPLIKWYS
    HQLENSFRFSFVSVEEGENLEELNQYIREKDLRFKVIPANISLLKEWKINSYPSFVILDRFGKIRFMDSGMMNPLSFFLR
    IWIVSFF

    >gi|116329649|ref|YP_799368.1| bacterioferritin comigratory protein [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MSDSILGTNLPTISLESTEGKNVKLPEDIAGSWTLLYFYPKDDTPGCTKQACSYRDNIGEFKKIGAKVYGVSLDHLDSHK
    NFIQKYSLNFPLLSDPDHKLSEALGVYGDQEWKGKVFKGLSRDSFLISPNGKIQKVWRKVDPTTTVEETLQEISKVSGT

    >gi|116328436|ref|YP_798156.1| hypothetical protein LBL_1778 [Leptospira borgpetersenii serovar Hardjo-bovis L550]
    MNSEPHFRIISSFFLGSYIYLMNRILLCFVFCILTVHCTLSEQPNLGIYEFQGITLDGTLVRLSEVEAPRLVLNVYGPNC
    VPCIKEIPALNYLYQDMQKDPKIQFYMAVDPTLFFDEAETMSEEELLTKGIFLVKEEIRKYGIQVPTLLMKKPFRVSRTG
    SIVTGTPETLLFKTKPFVLYYNFIGPISEEENPQRLSVDQKVLFFKRMAGSS