Leptospira borgpetersenii serovar Hardjo bovis JB197 uid58509

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116329818|ref|YP_799536.1| glutaredoxin family protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MKLKVYEYKNCSTCRNALKFLSSKKVELEILPIREIPPKKTELKTMLKYVGNESKKLFNTSGGDYKELGLKDKLRSLSLE
    EQLDLLSKNGNLVKRPFVLGDGFGFVGFKEEEWKKWIS

    >gi|116329889|ref|YP_799607.1| protein-disulfide isomerase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MSQLSKNKISIILSALGLIFSFLLIQKYYGDPTSVGETLCNVLSESGSCDKVSESTYSAIRNVPGLGDLPIALFGFVFYG
    FVGFLFVFSEIKKETSEKNLRFAFYVLILGLIADLGLFFLSVGVIKALCGLCVATYVITIALLAVNFPVFKSLSDKSIRA
    VLNSFSGSFVNLLIVILSFFVLGLYGGRISMGGTRLVSGSADGEKSIPEQLKEFETAQTVQIDLKDVPILGDLNAPITIV
    KYADFN
    CGHCMHTSKILKSFLNEYEGIIKVAYKNFPLDGNCNRLVGRKSPEASSCIAASAALCANQQNKFYPVYTGLYDD
    NEAGVMHTAATVTRLAEKSGLKMDQFRACMSSTKIRDHINREVDEAEKLKINSTPTLFVNNKPFPKSGTPDVDFLRRLIY
    QLINQS

    >gi|116330140|ref|YP_799858.1| Thiol-disulfide isomerase or thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MKEILKKGGNVALWILLFLTITIVLSIFKASDVKPSISIDGMKSFEGERYDSKGRVTVVYFWATWCGVCSFHLPLIKWYS
    HQLENSFRFSFVSVEEGENLEELNQYIREKDLRFKVIPANISLLKEWKINSYPSFVILDRFGKIRFMDSGMMNPLSFFLR
    IWIVSFF

    >gi|116330214|ref|YP_799932.1| thioredoxin domain-containing protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MIKKNLSNFPAPPSKMRIGPNYHSELSYLRRDLFSDSNNLWVKSKLRLFKRNTTFSLRYVRFLSFSTSVLFCVIFCLPIS
    AEIQWEKSVKTAFEKAKINGKPIFIDVYADW
    CGYCKILKNEIYPKKEVQLELSKFVTLSLDGDTFPNLKRKYGIKGYPSI
    LFLDQNGSLIDKITGMPDSKMILKYLKNAYAHRNLEKEYLEKLAKDPNGIKTNFQAGVYYFEAKEYTKAIQFFRKVIDAN
    DTKNTDKKHDALFNLGISYLEVGNFKFAIATFNSYISRYPNGDLSSILYFRANAYEELNRKEEAKADYKKVLELTVDPEE
    KRDLQFRIDSLN

    >gi|116330313|ref|YP_800031.1| cation transport ATPase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MNVKNEIFPDEITLDVIGMTCSNCALRIEKGLKKVPGVKDARVNFAMETATVGFESSVKKELLLDKIDSLGYRAFVQEDF
    EIHGEAEKAHAKEFKDLKVRVFISALLSFPMVSGMIGHIGNNQIFEYFSSIMNPWLQFALATPVQFWIGASFYKGGFRAI
    RNKGANMDVLVVLGTSAAYFYSVYWTFLEFGTYAHGEIPLYYETSSILITLILFGKFLEHIAKGKSSKAIQSLVGLQPKS
    ARIIRNGEIQKIPLFAVRPGDLLLIKAGETIPVDGTVEEGSSSVDESMLTGESIPVEKTISSPLYGSSLNQNGILKLRAS
    KVGKDTLLSEIIRVVRETQGSKAPIQRIADQISGIFVPVVVLISILTLFLWYFWIEPSHFSGALEKAIAVLVIACPCALG
    LATPISILTGSGKAATLGILFRTAEALEIAHKVDTIVFDKTGTLTLGKHILKDLESLNSQEENFLLTLAASAEQGSEHPL
    SKAIVESAQKKGLLLSMPEDFETIPGGGISASVQGEKIVIGTDRLFCERGIELNPKFLDLKRIREKEGNTVVHLSLNGTH
    SAILSLADRIKESTPTAVEKLKSLGMKIYIITGDNERTARAIANVCGIKQVLAEILPQEKAKEIKKLMDAGKVVAMVGDG
    INDAPALVIADLGISMGTGTDVAMESSDVVIVNGDLVSIVNAFSISKKTVYNIRQNLFWALFYNTLGIPIAAAGLLTPWI
    AGGAMALSSVSVVLNALRLQRK

    >gi|116330487|ref|YP_800205.1| hypothetical protein LBJ_0782 [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MSLLESEKIPLGSLLPEFRLEDPDGKMYSSDQLFGSTGLLLVVTCNHCPYAQAIWPRLIRFAVEIRSLGVRTVAINPNIH
    PDYPDDSPQMMLSKIKEWGVPFPYLVDKTQEVAKKLSSMCTPDIYLYDEEKKLYYHGRMDDNWKNEKQVSRKELEYAVHQ
    LVKGNPAPINQMPSIGCSIKWKE

    >gi|116330522|ref|YP_800240.1| peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MNELKVGSKAPNFAGINEKGEKVKLLELTGPKGIVLYFYPKDQTPGCTTEACDFRDNFSRIKKTGFNVVGVSKDSVKSHQ
    KFIEKQELNFTLISDEDGKICEDYGVWQLKKFMGKEFMGIVRSTFLIGTDGKILKVYPKVSVKGHVDEILSDIKALEKK

    >gi|116330690|ref|YP_800408.1| peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MPQVTSLAPDFKAEAVLGKEIKEIKLSDYKGKWVVLFFYPLDFTFVCPTEIIEYDNKLPEFKKLGAEILGVSVDSAFTHL
    AWKNTPKKEGGIGDIKYPLIADLTKSISRDYNVLTDGGVALRGTFIIDPAGLIRQATINDLPVGRNIDEAIRLIKAFQFV
    EKHGEVCPANWDEGKKTMKADPEKSKDYFSAVN

    >gi|116330936|ref|YP_800654.1| Thiol-disulfide isomerase or thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MWNFRPILLFIFFLGFSCSFTKEESILYQLSLYDLDGRPVSLKEYKGKVLLLDVWASWCEPCKDAVPVLEKLSKDLQGKN
    GVLLGINTEPELSKEEHLKAVKEFGITYPFFVDRDFTFINQYKVEGQPALIVFSPSGILLKIQYGVREKDYPKLRANFSN
    WLSAP

    >gi|116331093|ref|YP_800811.1| Zinc/cadmium-exporting ATPase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MESITEIENRCYHCNTQIRSEKEKIYAELKGKTELFCCFGCKSLATLLMENGLTRFYDLRGSGILEPASYVRPNPENLET
    DSTYQEYVIQKGNGICETLITIGKIH
    CSACVWLNERVVSEQTGVLETRINFATGRMKLIYDRNRIDLNKIFFLIRKIGYE
    PALYSPLKTETKVGLFSKDLFLRMAVAGFSWGNIMLFSVGLYTGYFSGIEVEFKRLFHFVSWVFTTPVYIYSGYPFYKGS
    MESIKRKMLSMDMLLFLGVSLAYFYSVYVTLSDKGEVYFDSVCTIYFFVLIGKFLESTIRLKAGRKIGELLSALPEEYTI
    IQGLRQISVSPSKIQKGDKILLKNGNRVPVDGILETENAHFDESFLTGESKPVSRKKGDSILSGSLCLNTNVFVTATTTV
    RESTLSRISSLVEAALQSKPKIQRIIDKLSAYFTLIVLLLAIATFSIFFFYYSNGESAVLNTISVLIVACPCALGLAVPT
    AHVAGNLLYGANGILVKNPDSMEILSHADRIYFDKTGTLTFGKLSIREEWFLKPDDSFRIYSILLSMESNSTHPLAISLM
    KEIEKKLRQKNKPPVPIFWKKIQEVPGNGIEAVSLNGDQTYRIGNRKFVSNGQDSQDGKIYIGVNEKLIASFCLEDTIRP
    EAKDTIQKLKPKISFLGILSGDSKSNVQSLASFLDLKNSFYELKPEEKLKVIKQAQNNGETVVMVGDGINDSACLAAANL
    GISMGIASDLSIDKSDLVLLSNRLDSLVRAISISRRTRNIIFQNILISLIYNSIMIPLAAFGFMLPVICAGFMTLSSLSV
    VLNSISLQWRTEP

    >gi|116331104|ref|YP_800822.1| thioredoxin-disulfide reductase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MVHKIVIVGSGPAGHTAAIYAARANLNPVMYEGFMAGGIAAGGQLTTTTEVENFPGFPNGIDGTQLTQLFREQSVKYGTK
    ILTQTITKVDFSSRPFQLWSDEERIEAEAVIIATGATARRMHVTGEDTYWQRGISA
    CAVCDGALPIYRNKELAVVGGGDS
    AVEEASHLTKFASKVYLVHRRDSLRASKIMQKRATTHPKIEIIWNSQVKEAKGDGKNLTALTLEDTMSGQKKELSVGGLF
    YAIGHKPNTDIFKGILDLDESGYIKTVPGSTKTSIEGIFAAGDVQDKIYRQAVSAAGSGCMAALDAERWLESREE

    >gi|116331191|ref|YP_800909.1| thioredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MALAEVNDSNFKSETSGGLVLIDCWAEWCGPCRMVAPVLEELSNEMNGTVKIKKLNVDDNQDTAQSLGISSIPTLLLYKD
    GQLVDKVIGALPKAQIKNFIERHK

    >gi|116331436|ref|YP_801154.1| oxidoreductase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MQDIIEKLKAREFRPLLILSAVFFIYILLTIFPLVTYFSSDGVVQINGKNYTIKDVEKDNPRIARKFYAETNDRLYRVLS
    EFASKKVVSLAAKERNVSEKDLLELSIQSPSVEEMRAVYEQYKNSPALQGKSFDQVKTEIENHLVSQKKEEARNALFSEL
    RNRYNISIKVKELPPLRDDTITAGNNPSIGPENAKVTVIEFSDFE
    CPFCKRSQDVNAQLRAKYKDQIRWVFRDYPLSFHP
    NAMFAHIAANCSTSQGKYWEFFKVLFDNSGNLSKERVLDLARGVGLDMKTFSQCVNDASVRKEVEADIAEGEKYGVSGTP
    AFFINGIMVEGAQPIEAFTKVIDQELKN

    >gi|116331455|ref|YP_801173.1| dihydrolipoamide dehydrogenase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MKEYDIIVIGTGGGTKLITPPSKIGYKVAVIEKESPGGTCLNRGCIPSKMLIYPAEILSLAKNSEKFQISFPGKPKVDFK
    SLVERVSKTVDEESASIRPAYDKNPNINYIQGTASFVSDKVIVVNGEQLTAKKIFIASGARPSIPNIPGLVGTPYMTSRE
    ALRRTDLPKSLIVIGGGFIALELGFAYSAFGSEVTFLVRSRMLKNEDGDIVNEFERVFTKEHNVLLRTDIHKLEYKEKMF
    HVEVETAGKKLQLRSEALLVATGIRPNTDLLNLSNTKIQTDTNGYIIVNEYLETTSPEVYALGDITGKYFYRHSVNFEGE
    FLFRTLYLEKKRTPIDYPPVPHAVFTHPQVARVGKTEEQLVQEGIDYIAAKNPYSASATGMARLSDSGFVKILVDKKSRK
    VLGAHAIGDEASNVIHLFILLMTIGGNLDDLLRMIYIHPALPEIARNAARKAGELLQIKE

    >gi|116331460|ref|YP_801178.1| glutaredoxin-like protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MNEEVKQKINDLIGTSKVFLFMKGTPEAPMCGFSAGVSNVLRSLGISFGSFNVLSDETMRQGIKDYANWPTIPQLYIDGE
    FIGGHDIVVEMAKSGDLQKKAGILNS

    >gi|116331461|ref|YP_801179.1| glutaredoxin-like protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MKLYQFQSCPYCSYVRDEFQNMGLVPGKDYELVEASRGTPGREEVVKLGGRSQVPFLVDDDIKMYELREIVNYTKLKKKI
    S

    >gi|116331547|ref|YP_801265.1| protein-disulfide reductase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MSALFLGLPLSAETLSGSWFSGIRKSISEGISSGTFDWTSGFLLIAGGVLASLLPCVYPLYPITVGIVRARGEGSPRILH
    PAIYYFGLITIYASFGLIAGLSGGAFNVILRYPIVNLALSVLIFLLALGSLDLIHLPFFQSKEVKTVQGCGGTFFLGMGA
    GLLSSPCVGPVVVAILLRITVDSGAISVDSVLLAVFKMFLFGVGLGFPFLMIGVFGLSLPKSGKWMRWIQWVLGIFVLYF
    SYAYFQKSLLGWEISDSLIPLSAFGILFLLLCIYFFLPEEWDRYVRMKKTLFLGGVVLSAVGLVILFTQNLRGSNSVSAM
    EIETRGNLSWFRSTSKAYKEAAITGKKMFVDFYADW
    CTNCNAFEELTQSDSVLNEALQGVVLLKIKDQDPIFETYVKDSR
    FEELKIGLPFFVILDAEGNLLYKNTDYQDTETMIQTLKQP

    >gi|116331581|ref|YP_801299.1| dihydrolipoamide dehydrogenase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MSESYDLTVIGAGPGGYVAAIRGAQLGMNVCIIEKERPGGICLNWGCIPTKALLESAHLLDKIHSAKGFGIDLSGAKPDF
    PSIIARSRNVADSMASGVEFLLNKNKITRKKGTAVFKDSNTIWLPDTSKEEITSKYYILATGARARELPGLPFDAGTVLS
    SKTAMIQEKIPESLLIVGAGAIGVEFADFYSTMGTKVTLVEMMDQILPVEDKEISAFLEKSFVKRGIRVLTGVGVSDPVI
    KNGKVKVLLKGKNLPESGEISETEKILVSIGLVPNTDTMNLEEIGVFLQKGFVKTDSQYKTSIPHIYAIGDCNGPPLLAH
    VASMEGIKAAEAISIQVGNPHHLSYTPINYDAIPGCTYCYPEVASIGFTEKKATDMGYTISVGKFPFIASGRAKAMGDTG
    GFTKVVVDKSSGEILGAHLIGPGVTELLPAVALGITQELTAKEIASTIFAHPTLSETVMESFGAALGEAINL

    >gi|116331658|ref|YP_801376.1| dihydrolipoamide dehydrogenase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MSAEFDVVVIGAGPGGYVCAIRAAQLGFKTAIIEKRKTLGGTCLNVGCIPSKALLDSSEEYHKVLHKLDVHGITVGKVEV
    DLGKLMNRKDQIVKEVTDGVDFLIGKNKIKRYKGFGKVLSAGKVEVASSGGDKEVINAKHIVVATGSVPIDIPGLTVDGK
    NIITSDHAIELRKLPKKMIIIGAGVIGLELGSVWARLGTAVTVVEFLPGLISNVDRPMGALLERSLTSQGIEFLFEHKVK
    SATTSKNGVKVQIEDSKGATKDLEADVVLVAVGRRPFLEGVGLEEAGVALTPRNRIQVDGHFKTSVPGIYAIGDAIDGPM
    LAHKAEEEGVALAELLAGQSGHVNYDAVPYVIYTWPEMAWVGKGEEELKAAGIEYKTGKSLFRPNARSKAMNEAEGQVKI
    LADKKTDKLLGAFIFGPRASDMIAELAVAMEFGASAEDIARSFHAHPTLAEVIKEAAMAVDKWAIHA

    >gi|116331824|ref|YP_801542.1| hypothetical protein LBJ_2312 [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MQFSSRSPNRLSKEKSPYLQQHAYNPVDWFPWGEEALTKAREQDKLIFLSIGYATCHWCHVMEKESFENQMVADYLNSHF
    VSIKVDREERPDIDRIYMDALHAMDQQGGWPLNIFLTPDGRPIAGGTYFPPEPVYGRKSFLEVLNILRKVWSEKRQELIV
    ASSELSRYLKDSGEGRAIEKQEEGSLPSKDCFNSGFSLYESYYDAEFGGFRTNHVNKFPPSMGLSFLLRYHHSSGNPKAL
    EMVENTLLAMKRGGIYDQVGGGLCRYSTDHRWMVPHFEKMLYDNSLFLETLVECSQVSKKISAESFALDVISYLHRDMRI
    VGGGICSAEDADSEGEEGLFYIWDFEEFREVCGEDSRILEKFWNVTNKGNFEGKNILHESYGGEATKLSEEEWKRIDSVL
    ERARAKLLERRSKRVRPLRDDKILTSWNGLYIKALAKAGIAFQREDFLKLAEETYSFIERNLIDPDGRILRRFRDSESGI
    LGYSNDYAEMISSSIVLFEAGCGIRYLKNAVLWMEEAIRLFRSPAGVFFDTGNDGEVLLRRSVDGYDGVEPSANSSLAYS
    LVKLSLLGIDSVRYRKFAELIFSYFTKELSTHSLSYPHLLSAYWTYKYHSKEIVLIRKDANSGKDLLAAIQTRFLPDSVF
    AVVNENELEEARKLSVLFDSRDSGGNALVYVCENFSCKLPVSNLADLQKWIE

    >gi|116331930|ref|YP_801648.1| hypothetical protein LBJ_2438 [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MANRGDLQKKTHTKKRPLHNIYGKEILSKRLEAENFPRTTLSFYRYVILENVQELRNRLYVEWEALGVLGRIYVAREGIN
    AQLSIPSHNLNSFKENLNSRIQFKDMLLKIAVEDDHRSFLKLDLKVRNKIVADGLNDDAFDVTNVGKHLSAEEFNRCMED
    KNSIVVDVRNHYESEIGHFENAILPQSDTFREELQILLELLNGKEDHKILMY
    CTGGIRCEKASAWLKHHGFKDVNQLHGG
    IISYAHEISQKGLESKFRGKNFVFDGRLQETIGNEIISVCHQCGKKSDRHINCSNPGCHILFIQCDDCSEKFEGCCTEEC
    KTVLHLPKEKQKEIRKGKSNENRFFTKSKIRPKISELYRNRKPFETA

    >gi|116332085|ref|YP_801803.1| glutathione peroxidase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MYPKISVLFFILGILFPLAGTFAKESFYDFKVKDIKGNEISLSKYKGKVVMVVNVASKCGYTYQYDNLEKVYKKYKNQGF
    VVVGFPANNFGSQEPGTNQEIETFCRIQKGASFDMMSKISVKGKDQHPLYSYLIENSPNPGEIEWNFEKFLISKEGKVEA
    RYRSAVEPDASVVAQKIESLLK

    >gi|116332130|ref|YP_801848.1| peroxiredoxin [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MTQVTLKGNPVSLEGKIPVPGDKAPDFKVIKQDLSEFSLKDYSGKVKILVAVPSWDTSVCALETRVFNEKAAGLSDITTL
    IISGDLPFAMKRFCSTEGINSPNLITGSQFRDFSFSKAYGTHIADGPLKGLSARAVFVVDKSDIVRYVELVSEIGSEPNY
    EAALTAAKAAL

    >gi|116332162|ref|YP_801880.1| protein-methionine-S-oxide reductase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MEQATLGGGCFWCLEAVYQMVEGIESVVSGYAAGQTKNPDYRSVCSGTTGHAETVQITFDSKVISYFEILEIFWISHDPT
    TLNRQGNDVGTQYRSIILYHSPEQKKQAEQSIQKAGEHFSDPIVTQVEILKEFYPAEDYHQNYFRTNPKQAYCHYVIKPK
    IDKYLKTGFKVKKEGS

    >gi|116332306|ref|YP_802024.1| rhodanese-related sulfurtransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MTPKELKSRLDLREMKKDSFYLLDVRNPNEAEICTIKGTDLLIPVGELSNRLPEINSWKESDKDMIVYCRSGGRSAMACG
    ILKQSGFTKVHNVEGGILLYSDEVDSSIAKY

    >gi|116332360|ref|YP_802078.1| methylated-DNA--[protein]-cysteine S- methyltransferase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MEHYKKIAEAIQFIQKHAVSQPELDEIAKSVGLSPFHFQRLFTEWAGVSPKQFLQYLTLQNAKSILSKPQTTLFDAAFEV
    GLSGTSRLHDLFVKIEGMTPGEFKNGGEKLKIRYSFQKNVFGDYVIASTEKGICNLYFYDVSKEQVVSELKEQWSKANLI
    QKTDENQNRVIRFFDKTFDGKEKIKLHLKGTDFQIKVWEALLKIPEGQLSSYMDIANSIGQENASRAVGTAIGKNPIGYL
    IP
    CHRVIKSTGSIGEYRWGPERKMAMIGWEMSRTDHLVSSIS

    >gi|116332395|ref|YP_802113.1| glutathione peroxidase [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MTQTLYDLTATLNSGKEQRLEDYRGKVLLIVNTASECAFTPQYAGLQSLYSKYKTEGLEILGFPCDQFKHQEPGSDETIK
    NFCQKNYGVEFPIFKKINVNGDSAHPVFRFLRKKASGFFGNSIKWNFTKFLVDKQGNVIKRYSPITTPEKIEKVIQDLLK
    K

    >gi|116332535|ref|YP_802252.1| bacterioferritin comigratory protein [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MSDSILGTNLPTISLESTEGKNVKLPEDIAGSWTLLYFYPKDDTPGCTKQACSYRDNIGEFKKIGAKVYGVSLDHLDSHK
    NFIQKYSLNFPLLSDPDHKLSEALGVYGDQEWKGKVFKGLSRDSFLISPNGKIQKVWRKVDPTTTVEETLQEISKVSGT

    >gi|116331164|ref|YP_800882.1| hypothetical protein LBJ_1554 [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
    MNSEPHFRIISSFFLGSYIYLMNRILLCFVFCILTVHCTLSEQPNLGIYEFQGITLDGTLVRLSEVEAPRLVLNVYGPNC
    VPCIKEIPALNYLYQDMQKDPKIQFYMAVDPTLFFDEAETMSEEELLTKGIFLVKEEIRKYGIQVPTLLMKKPFRVSRTG
    SIVTGTPETLLFKTKPFVLYYNFIGPISEEENPQRLSVDQKVLFFKRMAGSS