Leptospira biflexa serovar Patoc Patoc 1 Paris uid58993

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|183219697|ref|YP_001837693.1| hypothetical protein LEPBI_I0273 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MVPEIDVVSLKKRLDARAEGKDDFFVLDVRNPNEQQIALVPGTDKLIPVSELAARIDEIKSQIDKEILVYCRSGGRSGMA
    CGILAQAGFKSYKNVAGGTLAYSDLVDPNMQKY

    >gi|183219707|ref|YP_001837703.1| putative polyketide biosynthesis associated protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MSTNSEVFPIDIVSDVACPWCYVGKKKLEKALSIVGNTINPEVRWRPFQLSPEIPEEGIDYKLHLTQKFGSLDRLDGAWK
    RLSEIGKDVGINFQFQNIPKATNTLALHALVAALPSLEEQQKLVERFFAANFEEALDLTDKEVVWKVTEPVYKDRNKFDA
    IYSDSNLKQEIQQEIQYYHQNGISGVPYFIIGGKYAVSGAQDTSVFVEVIETVIKERESENKGQ

    >gi|183219763|ref|YP_001837759.1| putative 4-carboxymuconolactone decarboxylase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MAENHYYNAKDLGKFGEIGRTNPALADKFFGYYNAVMAEGALSEREKALIALAVAHALKCPYCIDAYTTTSLQKGADEAQ
    MNEAVHVAAAMAAGINLVHSVQMQNKIDELSF

    >gi|183219835|ref|YP_001837831.1| putative signal peptide [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MPSLSFPSFPLVEATYTSLPNSFFQVTKPTPVTSPEVLFWNDALALEFQFSHWKKQEEATARFFSGSILPEGIEPFAQAY
    AGHQFGHFTMLGDGRTIVMGEFKNKNGERFDFQWKGSGRTKYSRNGDGRATISAMVREYIMSEAMAGLRIPTTRSLAVVK
    TGEAVLREDPQEGAVLTRVAKSHIRVGTFEYAYQALSLEELEALFLYTARRHAPDVLNTENPALAFLEFVMRRQVSLITN
    WMRVGFIHGVMNTDNMSIAGETIDYGPCAFMNGFSAKRVFSSIDVNGRYAFSNQVGIAQWNLACLTNSLLPLLDPNQETA
    IALAKTKLNELESWFHESYIRMLGEKIGFPNLTEKDLLLLQSLYQWMQDTEADFTNTFLVLEGVYSPKDTIYNDIRWKDW
    VKLWKEEKTKQGIRDEDAISLMQKTNPSFVPRNHLVEMALANVHQGNTSVVDQFIERSLSPYKREIGYDYGDEVPMGGDA
    NYQTF
    CGT

    >gi|183219870|ref|YP_001837866.1| putative peroxiredoxin Bcp [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MLEVGKKAPNFKSVNQNGESVKLADLTGKNGIVVYFYPRDMTPGCTTEACDFRDNFSRLKKFGYNVVGISKDNPKSHTKF
    IEKQELNFDLISDESGEICEAYGVWREKVFMGRKGMGIVRSTFLLDSSLKIKKIYDSVKVKGHVEEIIKDIQEIQGK

    >gi|183220048|ref|YP_001838044.1| putative glutathione peroxidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MTFHDLKTITIQGKEISLGEYKGHPVLVVNVASKCGYTPQYEGLEKLHLAYKDKGLKVVGFPSNDFGGQEPGTEAQIAEF
    CKLNFGVSFDLMKKTKVLGNDKDPVYQFLTENAKEKGDVKWNFEKFLIDKNGNIVNRFPSSTKPESVELKQAIESIL

    >gi|183220205|ref|YP_001838201.1| glutathione peroxidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MAEEFYNIKVKRGSEEIPMEQFKDKVLLIVNTASQCGFTPQYKGLQETYDRWKGKGLEILAFPCNQFGEQEPGSDADIKL
    FCEKTFSTTFPIFSKLEVNGPNTDALYMHLKKNAPGIFGSLDIKWNFTKFLVDKNGKVVKRYAPITKPEAIEKDIEKLVQ
    G

    >gi|183220282|ref|YP_001838278.1| putative DSBA oxidoreductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MNRKNLAIGGLVVGVLGLLFSFLLAVEYFGIGTDNVAGAACSALGGGDSCLKVAESSYSAIPGVPFLGNIPIALLGFGFY
    GLLVYTFYLIYKSTNSEEISKLISLVLPVLILGFIFDLILFGISVGIIGTICQLCFITYIVTISLLAIVFLLWKTEGKPK
    LNIPASIKDGYATFGLVFFFSFSVGFASSKMWVKGESSNTLATSRGMDSKEIQTKIVSYFQEPTLGINVSGSPFIGKKDA
    PITIVKYADYN
    CGHCLHTSHILHTVLSEYDGMVKVVYKNFPLDGSCNRLMQQPRPGASSCVAAMAAICADKQGKFEPMYR
    GLYDNLEKGVAHSGASVVNLGNLIGLNVNSLKACMASKEAQNQLNAEIDEAEKLNIQSTPSLYINDRRIESGTPNPVFLK
    TLLEQIIQKM

    >gi|183220342|ref|YP_001838338.1| putative protein-disulfide reductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MFRFSLLLISFLFGSILSADSNWGNSIQKGFETAKQEKKFIIVDVFADWCTYCMVLEKEIFPDPEVSRILDQFVRVRLDG
    EEFPNLRKKYNVEGYPTILFLDGEGNFVTKITGLATKEDILILSKRILQEPNLESFLKTEMRKDKENPNLHFRLGLLYFQ
    SKEYTKAEEQFISSIQKSKQLPIVKENSYFNLNLIRSVNGPKELAVTSWKEFIQLYPNSKRLITAKLYYGISLKESGDFK
    HAKTILKEIQPKLESESDQLICKETLEQIEKGF

    >gi|183220460|ref|YP_001838456.1| dihydrolipoyl dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MEQYDIIVIGAGPGGYVAAVRAAQLGKKVAIIEKRKTLGGTCLNVGCIPSKALLDSSEEFHKTKHKLADHGISVKDVKID
    IAKMMARKDKVVSEVTSGVDYLMKKNKITRYLGQASFVSKTEVSITADDGKKESISGTNIIIATGSTPIEIPPLPVDGKN
    IVTSDHAIGFDSVPEHLIIVGAGVIGLELGSVWLRLGAKVTVVELMPRLFGTADQAMASLAERLLTQQGINFLFETKVHG
    AKVKGKKVEVEIEGKDGKKSVLEGDKVLVSIGRRPNTDGLGAKEIGIEMTDRGRVKVEPNKFQTNIPNIYAIGDVVDGPM
    LAHKAEDEGIAVAELICGKYGHVNYKAIPWIVYTWPEVAWVGLGEEELKAKGIEYKVGKYMFKPNARAKAMNETDGQVKV
    LADKKTDKLLGVYIVGPRASDMIAEAAIAFEFGASAEDIARSTHAHPTLSEVLREAAMDADAKWSIHS

    >gi|183220540|ref|YP_001838536.1| hypothetical protein LEPBI_I1143 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MENNFKSWMAQPISKIFIGTNLVFALLFFVSVPSFVKEYITQDAVSIGGKKYDLSDVKNSSPIAYSKFQSEYKSLLKNTF
    GEFAQDKLFELVAKDRNIKPSEVLNEGLILREPSEEDIINVYMSNKAQLGGKSLAETREKIVGFLKNQQEQEHSRNKYRE
    IITKYPVDFLIKEPEAIRVTVDEKNNPSIGPKDAKVTVIEFSDFE
    CPFCKRSQDVNNQLREKYKGQIRWVFRDFPLPFHQ
    DAMYAHMAANCSIEEGKYWDVFNVLFENSGNLSKSKVDEFVLKTGLSKEKYQSCMKDQSKLKSEIEADIQDGQKVGVSGT
    PAFFINGIFVSGALPFENFDEIIQKELKQ

    >gi|183220553|ref|YP_001838549.1| putative thiol-disulfide isomerase and thioredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MMKIWKQLPYGWKVFFAFVFFFSATLGFAYFKARDTNPSVPIEALATTPTEANSWKGHPKVVYFWATWCTVCKAYTPILE
    ANLKFLPKETLFLSVLESEDSEETKEILSQLSTDSPYPIYTADYRMLKEWRISAYPTTLFLNREGKVIFADSGILSPLGF
    WLRSFLLRFF

    >gi|183220568|ref|YP_001838564.1| peptide methionine sulfoxide reductase MsrB [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MENKNWKEILTPLQYQVTREKGTERPFTGEYYAHKEKGTYLCVCCGEALFSSETKYESGSGWPSYYEPVRSDAVSTETDR
    SHGMTRTEIQCQNCGAHLGHVFPDGPKPTGLRY
    CVNSASLKFQKSE

    >gi|183220748|ref|YP_001838744.1| alkyl hydroperoxide reductase subunit C [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MPQVTSHAPDFKATAVIGDSFKEIKLSDYKGKWVVLFFYPLDFTFVCPTEIIEYDAKLEDFKKIGAEVLGVSVDSEFSHL
    AWKKTPKKEGGIGEIKYPLIADKTKEIAKSFGVLIESGPDAGVALRGTFIIDPQGIIRQATVNDLPVGRNIEEALRLIKA
    FQFVEKHGEVCPANWDEGKKTMKADPTGSKAYFASVN

    >gi|183221026|ref|YP_001839022.1| putative thioredoxin-related protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MNPKMKTIFNRLISSRIYLLVLLTLFFCKPDVGKVDFYPDPLPTVSGSSESMNEWKGKVIVLDFWATWCEPCAKAVPTIN
    EWKKSVSDTDFVFRGINTDTTEPLEKIKDDMARLKMTYPTLLDKDWKMTDFYKVEGIPCVLVFDRNGKIVYRQYGLEKED
    LTGLVIRSHVWASSELP

    >gi|183221075|ref|YP_001839071.1| putative flavin-containing monooxygenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MTTSGFRNPSVVVIGAGMTGILLAIELEKAGITDITILEKKHDLGGTWRENTYPGVACDIPAHMYTYSFAPNPEWSHRFA
    HGDEIQAYFKRVSDEYKVTPKIHFNEAVTESSYQNAKWTIKTSKDKTYVSDFLISATGILHHPAKPNIPGLERFQGKCFH
    TAEWDHSVPLEGKRIGVIGTGSTAAQVIPEVMKLGKKVSVFQRTPQWIVKVPDTTYTEEDKKKWRKEPNLLKRFHKWYTF
    AVEQTFSKAVIGKKIPHMLMSFLCKRNLRTSVKDPELRKKLTPNYRVGCKRVIVNSTFYDAIQKPNADLVTEGIEKITEK
    GVVTKDGKLHELDVLVLATGFHPFHFMRPMNLTGENGISIETAWKKKVQAYRSLFIPHFPNFVLMLGPNTPIGNFSVIAM
    SEVQTKYVLKIIEDWRRGKFNSIQATEEALHRFAAYLKKGMAGTVWLGGCQSWYLDPDGDPAMWPYTWKQWEKEMKTPDY
    NDFSLTTQ

    >gi|183221169|ref|YP_001839165.1| hypothetical protein LEPBI_I1783 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MANLSKKPNRLVHEKSPYLLQHAHNPVDWFPWGTEAFEKAKKEDKIILLSIGYSTCHWCHVMERESFEDISTAEVLNRDF
    VCIKLDREERPDIDKIYMDALHAMGTQGGWPLNMFLTPEKEPILGGTYFPPENRYGKRSFKEVLRLVTKAWKEQKGELLQ
    AANELSNYLRENQTRTNDGKVPGTEILVQNFNRYWQVYDQEFFGFKTNTINKFPPSMALIFLLDYYSIHKDNRALEMAYN
    TGYAMKSGGIYDQVGGGIYRYATDHEWLVPHFEKMLYDNALYVEFLAKLYQITGEIFFLEALMEIISYIQRDMRLDIGGI
    ASAEDADSEGEEGKFYLWKESEILSELTEEEVIGYWNVTEEGNFENNQNILNVAIKGKNPYQEGIHFKDGFKIKLERSKE
    ILYQLRNQRIRPLRDDKILTSWNCLWIRALLASFEATGDPLFLNQSKTIYEFLFTYLVKEDGSVYRRFREGETKFFGTLP
    DYSELIWVSFRLFQLVGDKQYFLQGLQIFKYVETHFLSDMGPYFESAAGDEELIARTIDGYDGVEPSGNSTILHIFYFLH
    SLGFLHADILKKANAIFSYFLPELTQNSLSYPSMLSAFQKFQTPSKVVIVLHRNQSEEKMNEIRKNLSSLNDPTLIWLVL
    SEDVSRSLELDLGILNGRDAGDGVRYYVCQNFQCELPTDTWEEAFHLISK

    >gi|183221286|ref|YP_001839282.1| dihydrolipoamide dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MKEYDILVIGAGAGTKLVTPPSQIGKRVAVFERETPGGTCLNRGCIPSKMVIFPSELLRLKEESERFGIQYPSPPIYDVN
    SIFQRVNERVKADSDSIPIAYEKNPNIDYIPKNVWFKASKIITDGENDYTAKHILVVTGTRPNLPEIPGLKDTPFWTSRE
    ALSPDEFPKSLLIIGAGFISLELGAAYQAYGAQVTGITRGEVLRQVDFEIKEELKKHLPFPIHTGFHMEQVEFRNGEFRV
    SGTNKEGQTQTFVAEKLLVATGIKPNTEDLKLENTKIQCNPDGYILVDETLQTNEEGVYAFGDVIGRYFFRHSANFEGEY
    LFHHLYEGGEKKPIVYPPMPEAIFTHPQIASVGKTEDELIQEKIPYYKGLNPYRSSATGMARLSEVGFVKVLVSKETEEV
    LGAHVIGEEAANLLHQIVMGMYLKAKLDDYLGMIYIHPAISEITRNAFRKVREQKLKEIKS

    >gi|183221287|ref|YP_001839283.1| hypothetical protein LEPBI_I1904 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MKKFLFNRYDKETLKKKVLEDKRERRVISFYRYVKITDPIAFRDVLYDSLEDLGVLGRIYLANEGINAQFSIPIGNYDAL
    RKFVDFIPELKNIYFNDAVEDKKESFIKLAIKVRKKIVADGLDDSQFDPSNVGTHLSPLEFHQALEEDGVIVVDLRNNYE
    SEVGHFENAILPDVGTFREELPLVEQILEKDKDKKILLY
    CTGGIRCEKASAYLKYKGFEKVHQLQGGIINYAKAVTDHGL
    KSKFKGKNFVFDDRLGERITDDVLTVCYTCGNPSDRHTNCANLGCHVLIVQCESCSEKLLGTCSEECKEIVSLPEETQKK
    LRQEQRKQQKYPTHHLTRKLVGK

    >gi|183221291|ref|YP_001839287.1| putative glutathione S-transferase protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MTKPTLVSFKLCPYVQRSVINLLEKKVEYEIKYIDLANKPDWFLKISPFGRVPVLVVGEEVLFESAVINEYLDETNLPSL
    HPKDPLLKAKHRAWAEFASALLVDQYGWTMSKEESDSNKKKEEILSKFKILESILPEPKNGTLFFAGETKHLVDTAYAPF
    FMRMEFLKNKGVEFDLVSGFPKVQTWSDTLLSLPSVKNSVLPEVPKEYIEFIKAHNSWMGGKL

    >gi|183221293|ref|YP_001839289.1| putative glutaredoxin-related protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MEQELKDKIESLIKSEKVFLFMKGTPEMPQCGFSAGVVSTLKQQGISFGSFNVLSDMNIREGIKEYTNWPTIPQLYINGE
    FVGGHDITVQMAQSGELKKKIG

    >gi|183221294|ref|YP_001839290.1| putative glutathione S-transferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MIRLYQYDSCPYCYRVRQSISALGLVEGKDYELVEARNGTAGREEVIRLGGISQVPFLVDGGVKMYESLDIIDYLEKKFS


    >gi|183221569|ref|YP_001839565.1| hypothetical protein LEPBI_I2190 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MLSHIYSKENIFGRIAMYKIFNDFRIQVSAGFLLAISSSLCCVSPIVGVIGGFSGIASTFSWLEPYRSFLIILSMVIFSL
    LWYNLITKSKKSDLDCDCERSIFNRFFYSKIYLTFVTILSLFLFLFPNYSSILKSVNEVKGKLESEHLVVAEFVISGMTC
    VGCEYSVNTALVELTGVLKVTSDYKKGVTQIVYDKRKVGIQEFKDIIQNKVGYKVINIKGERKWK

    >gi|183221609|ref|YP_001839605.1| hypothetical protein LEPBI_I2232 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MLSHIYSKENIFGRIAMYKIFNDFRIQVSAGFLLAISSSLCCVSPIVGVIGGFSGIASTFSWLEPYRSFLIILSMVIFSL
    LWYNLITKSKKSDLDCDCERSIFNRFFYSKIYLTFVTILSLFLFLFPNYSSILKSVNEVKGKLESEHLVVAEFVISGMTC
    VGCEYSVNTALVELTGVLKVTSDYKKGVTQIVYDKRKVGIQEFKDIIQNKVGYKVINIKGERKWK

    >gi|183221643|ref|YP_001839639.1| putative glutathione S-transferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MIEFYEFKTSGNCYKIKLMLSLLDLKFESRFINPIDKEHKSEQFLELNPFGQVPVLKDGSIILRDSQAILVYLARKYGKE
    HWFPIEPSDMAEIVSWLSIATNEVARGPALLRMHYLLGRKIDLEEAVSTTDQILSILDNMLSSRDWLVNQEVSIADIAIY
    PYLALSHQGNIDLSKYTNIVNWMSRVEHLPGYVQFTQ

    >gi|183221675|ref|YP_001839671.1| thioredoxin [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MALTEINDANFKAETANGVVLVDCWAEWCGPCRMVAPVLDELSQEMADIKITKLNVDFNQKTAQELGIQSIPTLLLYKDG
    VLVDKAIGALPKPQIKKFIENHK

    >gi|183221730|ref|YP_001839726.1| thioredoxin reductase 1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MNHKVVIIGSGPAGHTAAIYAARANLNPVMYEGFMAGGVAAGGQLTTTTEVENFPGFPEGIDGTKLTQLFREQSAKYGTT
    IHTQTITKVDFSKRPFTIWSDDEEIKADSIIIATGATAKRMFVKGEDVFWQRGISA
    CAVCDGALPIYRNKALAVVGGGDS
    AVEEANHLTKFASKVYLVVRRDQLRASQIMQKRAMEHPKIEILWNQTVVEAKGGAGGLTSIVLESTKDKTQKDLEVGGLF
    YAIGHVPNTEIFKGQLNLDETGYIITKPGTTQTNVEGVFAAGDVQDKVYRQAITAAGSGCMAALEAERWLEGH

    >gi|183221918|ref|YP_001839914.1| putative arsenate reductase-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MNLQIFGTKKCKDSKKAQLFFQERRIPFQFINLQEKEMSKGELRSILGSVKLDDLIDTESKVYEDKNLKYMLYDKEEALL
    TNPLLFKTPIVRDGKRATIGFVPEIWKQWINDSKK

    >gi|183221926|ref|YP_001839922.1| putative thiosulfate sulfurtransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MKIQRSYGIYLFAIALFWALWLQLSAGPKKQGLNPKTHTWFLSPKEALDLPEFKTIDTRSFPSRLLEKLPMSQVLGWEDL
    SLKENPFRGKLQKEEDIQKKLLSLGFHLEDLILVLGDGASGWGEEGRIVWSLREVGFSNVFWFDGNVRSLKEVLVVRKQR
    ASHPIEKDTIQIKTNITKEEISKQLQNNFYQILDTRETREFSGSTPYGESRGGHIPGAKSFYYQNLFDAKGSIKSKQEVE
    TILSQLGITKTKPIIAY
    CTGGVRSAFVVGILRSYGYNAYNYSGSMWEWSFYPDLPMEK

    >gi|183221947|ref|YP_001839943.1| hypothetical protein LEPBI_I2586 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MIQKWIQTLTAFLLLSFSVSCVEKKEDKNTLLAALLYLAANQIKVNSATDLVNESADDYNQNNWGLITPQTLARFVTNWP
    ANKPSHITGNLIILQTDDANRVAGGAASAYVAENPGQGVYVYLLDDYKPADLPSGGFRFNQTRDTGLFTNSVRYQANGQF
    VDDWLKTFGINLSKDLVVFAVGTGNGISGGAYPGKAVGAGAVQDITRGVYWLRYWGAEIKNLAILNGNLNKKATGAGIPL
    STSRSGINLERNGGFSVKQLRVDNTVLTLGLEDIYEIAKTGGNANLSGLTAKQQIIDARPATQYDGSADGLNVPRNLLVA
    NPASQAYITTSYQSSGAPSASAGNQTFVPFEGSIKSSKTFPWSDLLKDNADGYEYLDKAALKTLFNTTRAVYTPGATIVS
    Q
    CRTNFEAQVNGFASLNILGYPTVYYDGSLVEWTALVAGHGTSSINQIPTDFKWRTDNTSVSNFLWYNNATHVVRPNVNL
    TATTTKKFIQEDKAYKY

    >gi|183221959|ref|YP_001839955.1| putative thioredoxin-disulfide reductase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MESLQKADITIIGGSYSGLSAALTLVRSLRNVLVIDSERPCNQNTPFSHNFITHDGIKPSEIRQKALSDLNEYKTFKLQI
    GEATSIQKKGSGYLIKGNGLSEIQTDKIIFATGVKDILPEIPGFAQAWGKTVIH
    CPYCHGYEYVGNQTGLWMNEEGVYEH
    AKFLKHWSKEITIFTNGPVQFSTEEINKIESEGISIQTEPVMEIVQKDGKISGLLFQLGKNIPLQTLYSKIPIVQHSKLP
    EELGCKLQPSGHIDVSPFYETSVQGVYAIGDMASMFRTVAHAVYSGNIAGAMLNRSMILS

    >gi|183221988|ref|YP_001839984.1| rhodanese-like domain-containing protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MVREWSVYHTPYGIHFFLTPILARKKWKKEINMKTFVIVGVIIGFLFVFVKKIQSKGDKQMVQEWIQSGAVVVDVRTKSE
    FAEGHFPGSINIPVDVLPNELGAIKNKQSKIVVY
    CRSGARSERAKQILTASGYSSVINAGGLGDMPNSR

    >gi|183221992|ref|YP_001839988.1| peptide methionine sulfoxide reductase MsrA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MIGLDCLFGKKLVPLAIFGLAFVLFPFCGPVTQISKQESLPLVPKSGQKIAVFAEGCFWCSEHIFESIPGVIDVVSGYAG
    GHTENPTYESVNTEMTGHAESVYIVYDPTKISYAELCRIFFLSHDPTTKDRQGPDIGSSYRSILFYADEEEFKIANTIKK
    EIQTQNIWNGTIVTEFQKLKHFYKAEGYHQDFIKNNPSQSYVLAVSIPRFKEFQNRYNEFKTRKTVP

    >gi|183222096|ref|YP_001840092.1| putative heavy-metal transporting ATPase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    METSNKLAEHTLDLFGMTCANCALRIEKGLSKVAGVSDVRVNFARESVFLRSEESVTVDSLLKTVEFLGYSATEHDPNKQ
    SETEKKQKDHIRVLKIRFILSALFSLPLFYGMVTHFQFLSFLPMPHILMDRWVQLVLATPVQFIIGFPFYQSAYRALRNG
    SANMDVLVVIGTSAAYGYSIFGKDLYFETSSVLITFILGGKWIEHVAKGKSSDGIKALLTLRPETATVKTNGVWTEVPNE
    YLKQGDLVLVKALERFPMDGIVTEGESYADESMLTGESMPVEKKQGDKILGGTVNGNGSLVVKAMKVGNDTTLSHIIRSV
    EESLGTKAPLQRIADQISAYFVPVVIAISILDFLVWFFLLAPGEITTAIETSIAILVIACPCALGLATPISLLVGTGRAA
    KRGVLFRSAEALESVSKINLIFFDKTGTLTEGKPKVTDVLVTGISDEKKSIVFGHVLAMEETSDHPLAKAILAFGKEKDF
    YLGSVGMVKTITSPGGGIQTELDGTVYFAGKQSFVEMNGFTIPETIRSAVEGWIKDGVSLVFVGIRGNMEGMIVFRIEDQ
    IRESSVKAIQELRSIGVEPILLTGDNLEAANKVAKAVGIVSVYSGLLPEEKSKIIKQLKNNQIHSAMVGDGINDAPALAS
    ADVGIAMGGGSDIAISTADVVLVNGDIQRIVDLIRIGKDTVLNIRQNFGWALGYNLLGIPIAASGLLAPWVSGAAMAFSS
    ISVVFNALRMSRWK

    >gi|183222130|ref|YP_001840126.1| molybdopterin biosynthesis protein MoeB [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MKSEKEIFFQRQCLVPEIGQEGQKKWNDASVLIIGLGGLGCPSALQLALAGVSRIGLVDFDVVEVSNLHRQTLFTWKDIG
    RKKTEVVSEVLKEHIPWIQIETFSEFLNSNSNTQIFETWDIVLDCTDTIISKYAINDFCLEKKIPLVTASVFRTSAQFAI
    FSGDGKPCYRCLFPNLSEGDTFS
    CNEGGVLGIQTSLAGNYQASLVLQYLLNPHQFELNTVYFIEWNPISFYQSKVEQDLQ
    CPSCSEQRYLKKSEGNCLEIDQVGYLELKSKTSVILLDVREEEEVIHSPIPDAVWFPLSELEKGKSPPGISDQTIVCVCE
    TGVRSLKATSYLTNFQNKFSLIGGRRVLSRFKNE

    >gi|183222157|ref|YP_001840153.1| hypothetical protein LEPBI_I2800 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MKELVLALEKFAIFSSALDDQSNSKLKYKNSNIQLDELQKKMKKGGILLIDVRSKEEYKKGHIPEAVNIPYNEIESFKFP
    KNKELIVY
    CRGPMCLLSVNALNFLQSREMNVTRFGGGYSQWEMREV

    >gi|183222168|ref|YP_001840164.1| hypothetical protein LEPBI_I2813 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MRQSSESDMIQIVQLIIMIFLYLSCGGSSFESNYLPESLPSEDSIKETLSSDVHLSQLNEKAHSLGKNLQEWKESEKSLV
    SDQEINTYWQREKVRLRNSIPDTDAIDRLRESIRMRIVWSRIFHKTNINIKQKPIYQSKSNLLTQLDVQYSPQFGNKKAK
    WVIVEWSDYL
    CGFCKKTFPHTKNLLLKYKTQIHYIHKDFPLDGESDQSLIPLVVSRCLWEKDPTQFSLHMQLLYAHANHL
    AKGEAISSNNWNYFTECISQTSNARYRNLVEADWEEAKKLGVSSVPTFWVNGRWILGALDAETWERVLEDTKP

    >gi|183222253|ref|YP_001840249.1| thiol peroxidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MAQVTLKGNPVPLEGSIPKPGDKAPDFKVAKQDLSDITLKDLAGKVKILVAVPSLDTPVCAIETKKFNEKVAKENGITTL
    IISGDLPFAMKRFCTTEGINSDNLITGSQFKDFSFSKNYGTHISSGPLAGLSARAVFVVDKDDVVRYTELVPEIGSEPNY
    DTVLAEAKKLV

    >gi|183222268|ref|YP_001840264.1| alpha keto acid dehydrogenase complex E3 component dihydrolipoamide dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MSNSNHFQVIVIGGGPGGYVAAIRAAQLGLQTCVVERDKLGGVCLNWGCIPTKALLESAHVLEHLKEAAKFGISADNIKV
    DFDAVIKRSRSVADQMAKGVEFLMKKNKVTVVSGEAKFLNSKSIEVKSISGEVTSLTADYFILAVGAKNKALPFLPFDGK
    RVLSAREAMVEPKVIANLAIIGAGAIGVEFADFYASMGSKVSIIEFQDHLLPNEDKEISSILERSFKKRGIEQYLSYGVE
    TASVSDSGVLLTIQDRNSAKKEKLNFDKVIVGVGISPNTNAIGLDEIGVKLKNGFVEFTGNYRSTVDHIYAIGDCIPTPS
    LAHVASAEGIRAAEDISVRLGNPHLLQINRLNYSYIPGCTYCHPEVASVGLSEDKAKAMGHELKIGKFPFSASGRAQAQG
    DTTGMVKIVSDAKHGEILGAHIIGPGATELIAELTLGANMEITVRELANTIHAHPTLAEGIMESAAAVLGEAINI

    >gi|183222274|ref|YP_001840270.1| peptide methionine sulfoxide reductase MsrA [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MTEKAILGGGCFWCTEAVYLRIPGVLSVVSGYAGGSSPNPSYKEICTGTTGHAEVIQIEYNPEIISYAKILEIFWVSHDP
    TTLNKQGNDVGTQYRSVIFYLNEKQKELAVESKRKHAFLFPDPIVTEISPAPTFYPAEDYHQNYFTLNPQNPYCHYVIFP
    KLKKLGLKLN

    >gi|183222355|ref|YP_001840351.1| alkyl hydroperoxide reductase subunit F [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MLDESTKQQVKQYFERIKNPVSITLYSGDHEKREELVSFLNDIESLSPMISIQHSSDVTDGLRFTIISNGNPTGIHFSGI
    PMGHEFTSFILAILQSGGNPIKLEEGILSAVSKLKGEFRFETFISLD
    CHNCPEVVQTLNSFALVNPNISHNMIDGAMYPE
    LVKEKNIQGVPAVYLNGERFLSGKAEASIIFDKLLELYTIPSESESSDGLANPSEIYDVTVIGGGPSGVTAAVYAARKGL
    RTLVIADRLGGQVKDTLGIENIISIPYTTGPELIHVLADQLEKNQIKKKENVRVQKIEQGQTKIIHLNTGEKILSKTVIL
    STGAKWRELNVPGEKEFVGKGVAY
    CPHCDGPFFKDKDVAVIGGGNSGVEAALDLSGIVKSVTLVEFGDKLNADKVLLDKV
    ASSPNIKTLVKAQTTEIQTGVDKVTGLTYKDRNTEQVSTIPLDGVFVQIGLVPNSSFVKDLVATNRFGEILVDEKCKTNV
    DGIFACGDVTNTPYKQIIIAMGEGAKAAISAFEYLLHAA

    >gi|183222356|ref|YP_001840352.1| alkyl hydroperoxide reductase subunit C [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MSNINTQIPDFTTEAFHNGAFKKISKKDVLGKWSVFVFYPADFTFVCPTELGDVADHYEELQKMGVEVYSVSTDTHFVHK
    AWHEASDTIKKIKFPMLGDASGKITRGFGVMIEDDGQALRGTFVVNPEGVIKTAEIHDLGIGRSAEELVRKVQAAQYVAN
    NDGEVCPAKWKPGNTTLKPGLDLVGKI

    >gi|183222519|ref|YP_001840515.1| thioredoxin 1 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MSDIYPKSFETLLQTHDKPILVDFWAPWCGPCKMVAPELEKLAKDWKGKVSIIKVNTDEKQEIAGKYGISGIPTFILFKN
    GKEVHRISGAMRSEEFKIVFGSYL

    >gi|183222553|ref|YP_001840549.1| putative OsmC-like protein [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MTAVFEDKVIVTTEKSKYETKIRKGKHQWIADEPADKEGTDLGPMPTELLASSLGACTSITIRMYADRKGYALDSVTVQV
    TIDKRSPEDHKFIREVELKGNLKPEERERLHSVANA
    CPVHKILSGKIEIETVLIN

    >gi|183222642|ref|YP_001840638.1| thiol:disulfide interchange protein DsbD [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MFSEIQTFIESQLSSGHFSIATVFFLALGGLLSGLLPCVYPLYPITAGILKTRVAKHKWAHPLVYYFGLALMYAIFGLIA
    GVSGGVFNSFLRYPETQLVLSILLFVLGLSVAEYLYFPFFSGDLKNSVNVNYANTFFLGMGAGLLSSPCVGPVVVSILVQ
    LVTYQTEGFKIVPILFTSFKMFVFGMGLGIPFLMIGVFGLSLPKSGKWMKYVQWVLAILIFYFSYTYLEKAFLLWGFDSG
    LSAKVYFLWTTSLVFLYLLNKEGTHSERMKHSLFQIFAITGFLFLFLILTHSILKLGPGISMGNRMSESTIQKEEHGNLV
    WYRNKNDAFQLAQDKNLPIFIDFYADW
    CTNCKEFQKLTLSHQELNQTFQNVVLWKVYDTDPIFEEFVNDPNYPELKIGLP
    FFLILSPNGKMLYKSNDYLDTKGMIETIRKLQKNNE

    >gi|183222649|ref|YP_001840645.1| putative phage shock protein E [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MNRMILIIIAIVAVLFIVYQLRNVSGMDQSQLKEKIDAGALVVDVRTVTEFNSGHFPNARNIPIDEVSKRVDEFGDKNQT
    IIVY
    CASGGRSGSAKSFLESIGYKQVINAGGLSNMPNP

    >gi|183222712|ref|YP_001840708.1| ArsC family arsenate permease [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MSRSKLKVYEYSGCSTCRNALKYLNSKKIQFEQIPIRETPPSVSELKKAKQYLGDIKKLLNTSGKDYREGNWKEKLAKLS
    EDQIYKSLSENGNLVKRPFVVGDGWYLVGFKEEEWGERF

    >gi|189913194|ref|YP_001964423.1| NADH dehydrogenase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MSQNKKKVVIIGAGFGGLQVIKTLANDKNFEVLVIDKKNHHLFQPLLYQVATAVLSPADIAIPTRSITTKYKNVKILFGE
    VTDINFKNKEVKFQNYTESYDYLVMATGAKTSYFGNPQWQNKTLGLKNLKDALAIRRQILLSFEQAELIADYETSKSLMH
    YVIIGGGPTGVELAGSIAELSHNIIRKDFRNIDSGMTKVTLIEAGPKLLNAFSESSSQFTKKKLESRGVEVLTNSPVLDI
    TDSGVVLKDRTIESKTIIWAAGVEGSDLAKKTSINKDKANRILVDEY
    CRSIDHNDVFVIGDAANFSKGLNRPLPGVSPVA
    MQQGRYVAKLIQSIDKGKKTIPFQYFDKGNMATIGRTDAVAEFGALRLKGIIGWFGWLFVHLVYQVGFKNKMSTLISWVW
    SYLTFRAGSRLIQEEVNDLSVRS

    >gi|189913231|ref|YP_001964460.1| Putative P-type ATPase, copper transporting ATPase, a phophatase-like domain [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MNKTNSQSTTTECDHCGNPIQLIRIESKLGDEPKVFCCEGCETVYSIIHSLGGSYYYNLKGNTKLSPVAMEETDVDLENE
    LVYQKFVRPSSGHSEVSIQITNIH
    CSACVWINEKVLNEEEGILSAQINFASGRARIRFDESKIKISRILSLIRAIGYKPV
    LFSPTEGNLQKSKQLKTLLLRIGVAGFCFGNIMILSVALYSGYFTGIDLNLKRMFHYASWVFATPAYLYSGFPFMSGFLT
    SIRRRTLSMDFLLFLGISMAYFYSVYVTLTDRGEVYFDSVAMIYFFILVGKYFEEKARVFASDKLESILCKLPETSNRIT
    ETGDQTIPSSEIKLGDKIQVAPGKRIPVDAILVSKETYIDESFLTGESVPIRKQKGDSILAGSLTMDNPALIIASSDYHA
    STLSSLKLRLEEALHLKPKIQIVTERIASYFISIVFLLAFVCFGVWMFLTSGDLEQSLVTTISVLIVACPCALGISVPTA
    LVTNHILNAEKGVLLKNPSVVETLAKANTIFLDKTGTLTEGKFLVRLVTVSEDHLPFVYRIEKEINHPLAKSLVKYLSPF
    DSVKKRASEMELIQLQNVPGQGVKAEIQWHGKEYSILIGNQTLLKHQNIPLESIPETEGSLILVAINGKMEGSFLLADEV
    RPGALSFVSLLKEMIPKIAILSGDRFSAVKFIANSLGIQQFYSDLSPEEKASIIEDSQNKGNVVIMVGDGINDSLSLARA
    NVSISHSEAEDLSLEKSDVVLTSGNLNGLVHSLLSAKKTKEVISQNIIISFFYNSIMLPLAMFGLMLPVICAVFMACSSL
    TVLLNSLSIRVRIPKWKPSI

    >gi|189913305|ref|YP_001964534.1| Bifunctional protein: transcriptional regulator of DNA repair/O6-methylguanine-DNA methyltransferase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MDFQKKHYQLIQNSIEYMIQNFESQPNLETLSGLAGLSPSHFQKLFLTFVGVSPKQFLSSITIMHAKRILPNTSILDTSY
    QLGLSGTGRLHDLFIKLEAMTPGVYKAAGEGLTLYYEFFPTILGEMVVVSSGIGIQNLQFIDETKTKDQILDQIKREFPK
    AIWMEEKSGRHLPMQQFLQTFSLPKDPIQLSVLGTPFQIKVWQSLLSIPIGEVTTYGEIAKSIGKTNAQRAVGTAIGKNP
    IAVLVP
    CHRVIQSSGLFGGYRWDPKRKQMLIAWEKSKHPPKQIHFV

    >gi|189913314|ref|YP_001964543.1| Putative soluble pyridine nucleotide transhydrogenase (NAD(P)(+) transhydrogenase [B-specific]) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MLFFTLSVAFFYPMSINRFDLIAIGGGPAAQKAAIQASKLGKKAAIIEKDPYLGGGCVHWGTIPSKSLQETSRFYRNLKL
    SNLHGLQSPQTAQLTLQELMFRAGTVIEKEEDVTREQMIQNRVTTLTGWGKIIDKNQVEVTDSAGRKKVYETENILIATG
    SSPRRPTNENIPFEEGLVYDSDGLFAMKKMPRTLAVIGAGIIGSEYATIFAHIGVKVHLFDSQSRILGFLDEDISNEMTR
    IMQNAGIQIHVDSSITSYQKISEETGFQLTTNKGEVITVNQVLISRGRLGNVDNLGLEAVGILPNDRKQIQVNENYQTNI
    PNIYACGDVIGFPSLASVSMYQGAYVAKHMFGLPSVPVDAEEFPIGIYTLPEIATIGPTEEALKKRGVPYGVGLAKFDTI
    TRAQISGDQVGLLKILFDKQTRRVLGVHIISDKATELIALGQCVVNLKAPIEYFTEHIFNYPTMIGAYKNAANDALLREK


    >gi|189913316|ref|YP_001964545.1| Putative peroxidase [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MNHLGETSMALRLGDEAPNFQADTSEGKIDFHEYLGQSWGILFSHPKDYTPVCTTELGYVAKIKPEFEKRNVKVIALSVD
    PVDSHKGWISDINETQNTNVNYPIIADADKKVSNLYDMIHPNASETTTVRSVFVIGPDKKVKLTLTYPASTGRNFDELLR
    VIDSLQLTSQFSVATPANWKDGEDTIIVPSVSDDDAKKKFPKGFRTIKPYLRYTPQPNK

    >gi|189913317|ref|YP_001964546.1| hypothetical protein LEPBI_II0147 [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MHIHLKRIESPFVLEATNESGNSIKIDASPEIGGKNSGPRPMELLIMGLAGCSSIDVLMILNKHRIEVKDYSVDVEADRE
    KVGDANLFKNIHMKFFIKGDFQETQVKRAIDLSLEKYCSVAKTLEKTAKITYEFVLVP

    >gi|189913374|ref|YP_001964603.1| Putative peptide methionine sulphoxide reductase (MsrB) [Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)']
    MKRNLPFLFLSVVVFSMLFGFVCSPTAKESQKKPENPELRKKLTDLQYRVTQEDDTEPAFQNEYWNNHEEGIYVDIVSKE
    PLFSSKDKFESGTGWPSFTKPLVKANVVEIEDQSYGMSRTEVRSKLGDSHLGHVFDDGPKPTGKRY
    CMNSASMEFIPKSK
    LKERGYESFLSEFGK